Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D02178g28327912980.0
Scas_636.133212797871e-105
CAGL0G08019g3162797561e-100
YDR090C3102247433e-98
Kwal_23.65652492227356e-98
Kwal_14.73991511974e-19
Sklu_1971.229047770.085
Scas_518.331049720.36
AFR605C31549710.42
Scas_720.9727032710.45
CAGL0I07689g30949710.51
KLLA0C03762g30649690.75
Sklu_2437.130549690.83
CAGL0L06710g32940690.94
Scas_628.230540681.1
KLLA0D15180g237965671.9
Kwal_55.2153829447652.3
YBR147W29640652.9
Kwal_56.2262330849643.4
CAGL0M06985g24932643.5
Sklu_805.125132617.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D02178g
         (279 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D02178g 186452..187303 some similarities with sgd|S0002497 ...   504   0.0  
Scas_636.13                                                           307   e-105
CAGL0G08019g complement(756917..757867) similar to tr|Q03193 Sac...   295   e-100
YDR090C (YDR090C) [942] chr4 complement(625060..625992) Protein ...   290   3e-98
Kwal_23.6565                                                          287   6e-98
Kwal_14.739                                                            80   4e-19
Sklu_1971.2 YDR352W, Contig c1971 2812-3684                            34   0.085
Scas_518.3                                                             32   0.36 
AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH] (1...    32   0.42 
Scas_720.97                                                            32   0.45 
CAGL0I07689g 738658..739587 similar to tr|Q12010 Saccharomyces c...    32   0.51 
KLLA0C03762g 342637..343557 similar to sgd|S0005452 Saccharomyce...    31   0.75 
Sklu_2437.1 YOL092W, Contig c2437 3219-4136 reverse complement         31   0.83 
CAGL0L06710g complement(756297..757286) similar to tr|Q12010 Sac...    31   0.94 
Scas_628.2                                                             31   1.1  
KLLA0D15180g 1284273..1291412 weakly similar to sgd|S0006321 Sac...    30   1.9  
Kwal_55.21538                                                          30   2.3  
YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing...    30   2.9  
Kwal_56.22623                                                          29   3.4  
CAGL0M06985g complement(710622..711371) similar to sp|P17261 Sac...    29   3.5  
Sklu_805.1 YCR075C, Contig c805 253-1008 reverse complement            28   7.6  

>KLLA0D02178g 186452..187303 some similarities with sgd|S0002497
           Saccharomyces cerevisiae YDR090c, hypothetical start
          Length = 283

 Score =  504 bits (1298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/279 (89%), Positives = 249/279 (89%)

Query: 1   MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGIYFLIT 60
           MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGIYFLIT
Sbjct: 1   MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGIYFLIT 60

Query: 61  RGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCILPMILFIVSFEIGFTLWL 120
           RGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCILPMILFIVSFEIGFTLWL
Sbjct: 61  RGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCILPMILFIVSFEIGFTLWL 120

Query: 121 RPVYDHGTHWPXXXXXXXXXXXXXXXXXPPYFELAKRQGRVVGINFIFLFVDSLGAWCSI 180
           RPVYDHGTHWP                 PPYFELAKRQGRVVGINFIFLFVDSLGAWCSI
Sbjct: 121 RPVYDHGTHWPALVIGIIATILLAAGLIPPYFELAKRQGRVVGINFIFLFVDSLGAWCSI 180

Query: 181 ASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFKWFGNGTGEFXXXXXXXXXXXXX 240
           ASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFKWFGNGTGEF             
Sbjct: 181 ASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFKWFGNGTGEFDDDDVGSTSSSVG 240

Query: 241 IEINGIDGDSAEDGIFAGPYINNEQDKDDIGSNNTKSMK 279
           IEINGIDGDSAEDGIFAGPYINNEQDKDDIGSNNTKSMK
Sbjct: 241 IEINGIDGDSAEDGIFAGPYINNEQDKDDIGSNNTKSMK 279

>Scas_636.13
          Length = 321

 Score =  307 bits (787), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 187/279 (67%), Gaps = 28/279 (10%)

Query: 1   MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGIYFLIT 60
           MISE+AA ALAT+ T+CWCVQLIPQI  N+ RKDCTG PP MMFLWV+SG+PF IYF ++
Sbjct: 1   MISERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVS 60

Query: 61  RGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCILPMILFIVSFEIGFTLWL 120
           +GN+ LQ+QPHLFMFFC +S+VQ+ YYPP  L V KI++   L +I   +  E+GF LWL
Sbjct: 61  KGNVTLQVQPHLFMFFCGISFVQTCYYPPTKLPVWKIIVIVSL-IIATDIGMEVGFILWL 119

Query: 121 RPVYDHGTHWPXXXXXXXXXXXXXXXXXPPYFELAKRQGRVVGINFIFLFVDSLGAWCSI 180
           RP+Y  G HWP                 PPYFELAKR+GRVVGINF+FLF+DSLGAW +I
Sbjct: 120 RPLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAI 179

Query: 181 ASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFKWFGNGTGEFXXXXXXXXXXXXX 240
           ASVIVGNMD MGI+LYA +A +ELGIFASHFIWCCRFKWF                    
Sbjct: 180 ASVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKN----------------- 222

Query: 241 IEINGIDGDSAEDGIFAGPYINNEQDKDDIGSNNTKSMK 279
                +D +  ++G       N+ Q+K+++   N   ++
Sbjct: 223 ---KFVDDEEQKEG-------NSTQEKEELSEKNQHEIE 251

>CAGL0G08019g complement(756917..757867) similar to tr|Q03193
           Saccharomyces cerevisiae YDR090c, start by similarity
          Length = 316

 Score =  295 bits (756), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 192/279 (68%), Gaps = 9/279 (3%)

Query: 1   MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGIYFLIT 60
           MISE AA  LAT+ TVCWCVQLIPQIIYN+ RKDCTG PP MMFLWVVSG+PF IYF ++
Sbjct: 1   MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60

Query: 61  RGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCILPMILFIVSFEIGFTLWL 120
           +GN++LQIQPHLFMFFC +S+VQS YYPP SL+V+KI+   +  +I+  +  E+GF LWL
Sbjct: 61  KGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLAVRKIVAIVVG-IIVVDIGMEVGFILWL 119

Query: 121 RPVYDHGTHWPXXXXXXXXXXXXXXXXXPPYFELAKRQGRVVGINFIFLFVDSLGAWCSI 180
           RP+Y  G  WP                 PPYFELAKR GRVVGINFIFLF+DSLGAW SI
Sbjct: 120 RPLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSI 179

Query: 181 ASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFKWFGNGTGEFXXXXXXXXXXXXX 240
            SV+VGNMD MGI+LY+V+A LELGIF SHFIWCCRFKWFGN   E              
Sbjct: 180 ISVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNHDPE-ETDAVSEEKSVKD 238

Query: 241 IEINGIDGDSAE-----DGIFAGPYINNEQD--KDDIGS 272
            + +  DG  ++     D +F+     NE D  +DD+ S
Sbjct: 239 TQYDEKDGSLSKNKMGHDAMFSKTEEVNETDEPRDDVSS 277

>YDR090C (YDR090C) [942] chr4 complement(625060..625992) Protein
           containing two PQ loop repeat domains, has high
           similarity to uncharacterized C. albicans Orf6.6869p
           [933 bp, 310 aa]
          Length = 310

 Score =  290 bits (743), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 174/224 (77%), Gaps = 1/224 (0%)

Query: 1   MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGIYFLIT 60
           MISEKAA ALAT+ TVCWCVQLIPQIIYN+ +KDCTG PP MMFLWVVSG+PF IYF ++
Sbjct: 1   MISEKAATALATIATVCWCVQLIPQIIYNWKKKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60

Query: 61  RGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCILPMILFIVSFEIGFTLWL 120
           +GN+ILQ+QPHLFMFFCS+S+VQS YYPP S++  KI++  +  +I   V  E+GF LWL
Sbjct: 61  KGNVILQVQPHLFMFFCSISFVQSCYYPPISMARSKIVM-IVAAIIAADVGMEVGFILWL 119

Query: 121 RPVYDHGTHWPXXXXXXXXXXXXXXXXXPPYFELAKRQGRVVGINFIFLFVDSLGAWCSI 180
           RP+Y+ G  WP                 PPYFELAKR+GRV+GINF FLF+DSLGAW SI
Sbjct: 120 RPLYEKGVKWPDLIFGISASVLLAVGLLPPYFELAKRKGRVIGINFAFLFIDSLGAWLSI 179

Query: 181 ASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFKWFGNGT 224
            SVI+GNMDIMGI+LY++VA +ELGIFASHFIW CRF++   G 
Sbjct: 180 ISVILGNMDIMGIILYSIVAGMELGIFASHFIWWCRFRFLAKGN 223

>Kwal_23.6565
          Length = 249

 Score =  287 bits (735), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 133/222 (59%), Positives = 165/222 (74%), Gaps = 1/222 (0%)

Query: 1   MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGIYFLIT 60
           MISEK A ALA +GTVCWCVQLIPQII+NY RK+C GFPP MMFLW +SG+PF IYF++T
Sbjct: 1   MISEKGATALAIMGTVCWCVQLIPQIIFNYRRKNCEGFPPIMMFLWTISGIPFAIYFMVT 60

Query: 61  RGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCILPMILFIVSFEIGFTLWL 120
             N+ILQIQPHLFM F  +S+ Q L+YPP   +  +I ++ ++ ++   V  E GFTLWL
Sbjct: 61  NANLILQIQPHLFMVFSGISYAQCLHYPPVKWNKWRI-IQVLVALVAIDVGLETGFTLWL 119

Query: 121 RPVYDHGTHWPXXXXXXXXXXXXXXXXXPPYFELAKRQGRVVGINFIFLFVDSLGAWCSI 180
           +P+Y  G HWP                 PPYFEL KRQGRV+GI+F+FLF+DS+GAW SI
Sbjct: 120 KPLYLRGVHWPSLIFGIIASVLLGIGLLPPYFELMKRQGRVIGIDFLFLFIDSMGAWLSI 179

Query: 181 ASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFKWFGN 222
            S+I+GNMD+MGI LY V+A LE+GIF SHFIWCCRFKWF +
Sbjct: 180 ISIILGNMDVMGIALYCVIAGLEIGIFLSHFIWCCRFKWFND 221

>Kwal_14.739
          Length = 91

 Score = 80.5 bits (197), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 35/51 (68%), Positives = 45/51 (88%)

Query: 156 KRQGRVVGINFIFLFVDSLGAWCSIASVIVGNMDIMGIVLYAVVAALELGI 206
           KRQGRV+GINF+FLF+DS+GAW S  S+I+GN+D+MGI LY V+A LE+GI
Sbjct: 2   KRQGRVIGINFLFLFIDSMGAWLSFISIILGNLDVMGIALYCVIAGLEVGI 52

>Sklu_1971.2 YDR352W, Contig c1971 2812-3684
          Length = 290

 Score = 34.3 bits (77), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 9   ALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGI 55
           AL+ +G +C+    IPQ+I NY RK   G  P +    +++ + + +
Sbjct: 177 ALSWVGAMCYVCARIPQLIKNYKRKSTDGLSPFLFINTLLTNITYAL 223

>Scas_518.3
          Length = 310

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 22/49 (44%)

Query: 3  SEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
          SE  +     +   CW V  +PQI  N+ RK   G     + LW++  +
Sbjct: 10 SENVSGITGCISISCWIVVFVPQIYENFTRKSSDGLSLLFIILWLLGDI 58

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 7   AYALATLGTVCWCVQLIPQIIYNYIRKDCTG 37
           A     LG V +    IPQII N+ R+ C G
Sbjct: 191 AQVFGYLGAVLYLGSRIPQIILNFKRRSCEG 221

>AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH]
          (1530918..1531865) [948 bp, 315 aa]
          Length = 315

 Score = 32.0 bits (71), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 3  SEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
          SE  +    ++   CW +  +PQI  N+ RK   G     + LW+   +
Sbjct: 8  SETISGITGSISIACWVIVFVPQIYENFRRKSAEGLSLLFVVLWLAGDI 56

>Scas_720.97
          Length = 270

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 20  VQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
           V+ IPQ++YN+ RK   GF    +FL V  GV
Sbjct: 169 VKYIPQVVYNFDRKTMVGFAIQGVFLDVTGGV 200

>CAGL0I07689g 738658..739587 similar to tr|Q12010 Saccharomyces
          cerevisiae YOL092w, hypothetical start
          Length = 309

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 22/49 (44%)

Query: 3  SEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
          S+  +    ++   CW V  +PQI  N+ RK   G     + LW+   V
Sbjct: 11 SQAVSGIAGSVSIACWVVVFVPQIYENFYRKSADGLSLLFVVLWLAGDV 59

>KLLA0C03762g 342637..343557 similar to sgd|S0005452 Saccharomyces
          cerevisiae YOL092w, start by similarity
          Length = 306

 Score = 31.2 bits (69), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 22/49 (44%)

Query: 3  SEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
          S+  +    ++   CW +  +PQI  N+ RK   G     + LW+   +
Sbjct: 10 SQTVSGITGSISIACWIIVFVPQIYENFYRKSAEGLSLMFVVLWLAGDI 58

>Sklu_2437.1 YOL092W, Contig c2437 3219-4136 reverse complement
          Length = 305

 Score = 31.2 bits (69), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 22/49 (44%)

Query: 3  SEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
          S+  +    ++   CW +  +PQI  N+ RK   G     + LW+   +
Sbjct: 8  SQTVSGITGSISIACWVIVFVPQIYENFYRKSAEGLSLLFVVLWLAGDI 56

>CAGL0L06710g complement(756297..757286) similar to tr|Q12010
          Saccharomyces cerevisiae YOL092w or sp|P38279
          Saccharomyces cerevisiae YBR147w, start by similarity
          Length = 329

 Score = 31.2 bits (69), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 19/40 (47%)

Query: 12 TLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
          ++   CW V   PQI  N+ RK   G     + LW++  +
Sbjct: 19 SISIACWVVVFAPQIYENFRRKSSDGLSLMFIILWLIGDI 58

>Scas_628.2
          Length = 305

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 19/40 (47%)

Query: 12 TLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
          ++   CW +  +PQI  N+ RK   G     + LW+   V
Sbjct: 19 SISIACWVIVFMPQIYENFYRKSADGLSLLFVVLWLAGDV 58

>KLLA0D15180g 1284273..1291412 weakly similar to sgd|S0006321
           Saccharomyces cerevisiae YPR117w, start by similarity
          Length = 2379

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 42  MMFLWVVSGVPFGIYFLITRGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRC 101
           M  L+V   + F +  L     I++      F+F  S+ W+  L Y  YS  V+K+LL  
Sbjct: 20  MTILFVTQQIIFNLALLYFNARIVISKLQIGFLFGRSIYWLH-LIYKGYSFKVRKVLLLS 78

Query: 102 ILPMI 106
           +   I
Sbjct: 79  LFSKI 83

>Kwal_55.21538
          Length = 294

 Score = 29.6 bits (65), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 24/47 (51%)

Query: 9   ALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGI 55
            L+ +G +C+    IPQ+  NY RK   G  P +    +++ + + +
Sbjct: 170 TLSWIGALCYVGARIPQLFKNYNRKSTDGLSPFLFINTLIANITYTV 216

>YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing
          two PQ loop repeat domains, has low similarity to S.
          pombe Stm1p, which is a G protein-coupled receptor that
          acts as a nutrient sensor for sexual diffentiation and
          stress response pathways [891 bp, 296 aa]
          Length = 296

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 20/40 (50%)

Query: 12 TLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
          ++   CW V  +PQI  N+ R+   G     + LW++  +
Sbjct: 19 SISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDI 58

>Kwal_56.22623
          Length = 308

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/49 (22%), Positives = 22/49 (44%)

Query: 3  SEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
          S+  +    ++   CW +  +PQI  N+ R    G     + LW++  +
Sbjct: 8  SQTVSGITGSISIACWIIVFVPQIYENFYRHSADGLSLLFVVLWLLGDI 56

>CAGL0M06985g complement(710622..711371) similar to sp|P17261
           Saccharomyces cerevisiae YCR075c ERS1, hypothetical
           start
          Length = 249

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 20  VQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
           ++ IPQ+++N+ RK   GF  S +FL +  G+
Sbjct: 166 IKYIPQVLHNFERKSMQGFAISGVFLDMTGGI 197

>Sklu_805.1 YCR075C, Contig c805 253-1008 reverse complement
          Length = 251

 Score = 28.1 bits (61), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 20  VQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGV 51
           ++ IPQ+ +NY RK   GFP   +   ++ G+
Sbjct: 170 IKYIPQVKHNYERKSMRGFPIEAVLCDLIGGI 201

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.146    0.489 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,209,538
Number of extensions: 306162
Number of successful extensions: 773
Number of sequences better than 10.0: 24
Number of HSP's gapped: 772
Number of HSP's successfully gapped: 25
Length of query: 279
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 179
Effective length of database: 13,134,309
Effective search space: 2351041311
Effective search space used: 2351041311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 61 (28.1 bits)