Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D02068g40539918000.0
Kwal_14.21864653073009e-30
ADL029W5352512108e-18
Scas_638.623584750.23
CAGL0E00407g37194701.1
Scas_660.3731743672.2
YOL100W (PKH2)108149682.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D02068g
         (399 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D02068g 177264..178481 no similarity, hypothetical start         697   0.0  
Kwal_14.2186                                                          120   9e-30
ADL029W [1713] [Homologous to ScYGL170C (SPO74) - SH] complement...    86   8e-18
Scas_638.6                                                             33   0.23 
CAGL0E00407g 34107..35222 similar to sp|P25366 Saccharomyces cer...    32   1.1  
Scas_660.37                                                            30   2.2  
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    31   2.4  

>KLLA0D02068g 177264..178481 no similarity, hypothetical start
          Length = 405

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/399 (87%), Positives = 350/399 (87%)

Query: 1   MTDCNSTTERSLTSGLEAMSLKAISPSKLNRRHKVSSKPDKLNENVCLDRRAEVLVNTEN 60
           MTDCNSTTERSLTSGLEAMSLKAISPSKLNRRHKVSSKPDKLNENVCLDRRAEVLVNTEN
Sbjct: 1   MTDCNSTTERSLTSGLEAMSLKAISPSKLNRRHKVSSKPDKLNENVCLDRRAEVLVNTEN 60

Query: 61  EMPTEIVSKIKNENFHLQLELEQKNHEISKLKSMLLPKLTPPAIDLRLTTSLKDPLYYHP 120
           EMPTEIVSKIKNENFHLQLELEQKNHEISKLKSMLLPKLTPPAIDLRLTTSLKDPLYYHP
Sbjct: 61  EMPTEIVSKIKNENFHLQLELEQKNHEISKLKSMLLPKLTPPAIDLRLTTSLKDPLYYHP 120

Query: 121 ESNKIPGMSGATVTNXXXXXXXXXXXXXGNRNDVRETSTVASTTISRKEKNHMLFTRNIL 180
           ESNKIPGMSGATVTN             GNRNDVRETSTVASTTISRKEKNHMLFTRNIL
Sbjct: 121 ESNKIPGMSGATVTNSDYVSHFSSSSYDGNRNDVRETSTVASTTISRKEKNHMLFTRNIL 180

Query: 181 PFIRDSINMYKNSHVLNEEVVPIEKELDKFYDNSLKKDEKCEVFSNVLLGLLRVQRLNIA 240
           PFIRDSINMYKNSHVLNEEVVPIEKELDKFYDNSLKKDEKCEVFSNVLLGLLRVQRLNIA
Sbjct: 181 PFIRDSINMYKNSHVLNEEVVPIEKELDKFYDNSLKKDEKCEVFSNVLLGLLRVQRLNIA 240

Query: 241 ALNRELELKTVERKMDYLATLFLDPQEYEIPRHSSMKRIRDQMLDVIISLYGELPNPNQR 300
           ALNRELELKTVERKMDYLATLFLDPQEYEIPRHSSMKRIRDQMLDVIISLYGELPNPNQR
Sbjct: 241 ALNRELELKTVERKMDYLATLFLDPQEYEIPRHSSMKRIRDQMLDVIISLYGELPNPNQR 300

Query: 301 AAREMKYQQPQQVPLKIKSDSKLNRQSHNPEILPIGYXXXXXXXXXXXXXXXXNIKLTPF 360
           AAREMKYQQPQQVPLKIKSDSKLNRQSHNPEILPIGY                NIKLTPF
Sbjct: 301 AAREMKYQQPQQVPLKIKSDSKLNRQSHNPEILPIGYSNSSSKPARSAKKRMRNIKLTPF 360

Query: 361 KTASQEXXXXXXXXXXXXXXXXXXXXAERITGTDLENTT 399
           KTASQE                    AERITGTDLENTT
Sbjct: 361 KTASQEDMDADDDLDVDLSDPLQLLLAERITGTDLENTT 399

>Kwal_14.2186
          Length = 465

 Score =  120 bits (300), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 85/307 (27%), Positives = 161/307 (52%), Gaps = 35/307 (11%)

Query: 2   TDCNSTTERSLTSGLEAMSLKAISPSKLNRRHKVSSKPDKLNENVCLDRRAEVLVNTENE 61
           +DC+ +    L+ G+  +SL+ +     NR H  + K      +   DR A      ++E
Sbjct: 6   SDCDLSL---LSQGVTQLSLRPV-----NRIHSRNGK------SKTKDRSATKAAPQKDE 51

Query: 62  MPTEIVSKIKNENFHLQLELEQKNHEISKLKSML-----LPK--LTPPAI----DLRLTT 110
           +P  + S I+NEN+HL+LEL QK+ E+  L+  +      PK  + P AI    DL  TT
Sbjct: 52  VPAPLAS-IRNENYHLKLELMQKSQELEALQKRIQNLEKAPKTSVAPAAILLPPDLAHTT 110

Query: 111 SLKDPLYYHPESNKIPGMSGATVTNXXXXXXXXXXXXXGNRN-DVRETSTVASTTISRKE 169
                  +    +     S ++++              G R     E+++ AST+ SR  
Sbjct: 111 -------WGIAGDSPTRFSHSSLSQYEVVTHFSGSPYKGARVLSQHESASQASTSGSRLR 163

Query: 170 KNHMLFTRNILPFIRDSINMYKNSHVLNEEVVPIEKELDKFYDNSLK-KDEKCEVFSNVL 228
           +NH  F  +++PF++ SI+ +++S +  ++   + ++L+ F +   K KD K ++   +L
Sbjct: 164 RNHKFFKNSVVPFLQKSIDTFQHSDIFGDDAKTLGRKLEAFKNCGAKDKDSKVQLMVEIL 223

Query: 229 LGLLRVQRLNIAALNRELELKTVERKMDYLATLFLDPQEYEIPRHSSMKRIRDQMLDVII 288
            GL  +Q+  +A LNREL+ K +  ++++L T+FLDP++Y + R   +K++R +ML++++
Sbjct: 224 DGLNHLQQQCVAVLNRELQSKKISSQLEFLFTIFLDPEQYGLLRQDHIKKLRQEMLEIML 283

Query: 289 SLYGELP 295
            ++   P
Sbjct: 284 EIWDHNP 290

>ADL029W [1713] [Homologous to ScYGL170C (SPO74) - SH]
           complement(648582..650189) [1608 bp, 535 aa]
          Length = 535

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 128/251 (50%), Gaps = 27/251 (10%)

Query: 55  LVNTENEMPTEIVSKIKNENFHLQLELEQKNHEISKLKSMLLPKLTPPAIDLRLT----- 109
           +  +    P E+++ ++NEN HLQL L +K  E+  LKS +  +L     +L L+     
Sbjct: 95  VCKSSGTAPDEVLA-LQNENCHLQLMLSEKGSEVELLKSKV-GQLQQRLDELLLSNNSAM 152

Query: 110 ---TSLKDPLYYHPESNKI-PGMSGATVTNXXXXXXXXXXXXXGNRNDVRETS-TVASTT 164
                L D LY  P+ +++    SG+                 G+R     T  +  S T
Sbjct: 153 TGNVPLSD-LYLKPDEDEVMTHFSGSPY--------------RGSRPFSHSTKHSAVSVT 197

Query: 165 ISRKEKNHMLFTRNILPFIRDSINMYKNSHVLNEEVVPIEKELDKFYDNSLKKDEKCEVF 224
            + +  +++  +R ++P++R++I++++ S + + + +   +   K  D +L    + +  
Sbjct: 198 SNSRHMSYLFVSRQLVPYMREAISIFERSDLFSGQALKARRAFVKAIDGALSAVPQFDDL 257

Query: 225 SNVLLGLLRVQRLNIAALNRELELKTVERKMDYLATLFLDPQEYEIPRHSSMKRIRDQML 284
            +VL  L  +QR  I  LNRELE K V ++++YLAT+F DP+E  +     ++ +R Q++
Sbjct: 258 VDVLDELTILQRNAIVCLNRELEYKKVSQQLEYLATIFRDPKECGLRTEDYVEHLRKQLI 317

Query: 285 DVIISLYGELP 295
           +VI +++  +P
Sbjct: 318 EVITNIHSTMP 328

>Scas_638.6
          Length = 235

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 1/84 (1%)

Query: 83  QKNHEISKLKSMLLPKLTPPAIDLRLTTSLKDPLYYHPESNKIPGMSGATVTNXXXXXXX 142
           Q+N     LKS+ L  LT P + L+L    K P+YY P +   P + G  ++        
Sbjct: 99  QRNQTTKLLKSVKLVSLTVPFLILKLWKG-KFPVYYLPHAEVFPKIIGGVLSQGWLYLGL 157

Query: 143 XXXXXXGNRNDVRETSTVASTTIS 166
                    N V E   V   ++S
Sbjct: 158 LPLRILRGGNKVEELDIVPKVSVS 181

>CAGL0E00407g 34107..35222 similar to sp|P25366 Saccharomyces
           cerevisiae YCR095c, start by similarity
          Length = 371

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 51/94 (54%), Gaps = 7/94 (7%)

Query: 203 IEKELDKFYDNSLKKDEKCEVFSNVLLGLLR-VQRLNIAALNRELELKTVERKMDYLATL 261
            EK LD+   N+L  D+     +++++G+LR +Q+ NI+++  E  L    +   Y A  
Sbjct: 150 FEKLLDRKNYNTLLVDK-----TSLVIGILRKIQKWNISSIINEYRL-FAGKNRGYFAET 203

Query: 262 FLDPQEYEIPRHSSMKRIRDQMLDVIISLYGELP 295
           FL+  + +I +    + + +Q +D I+S   +LP
Sbjct: 204 FLEMIQIKIEQTIEERSLDEQQIDTIVSEEQQLP 237

>Scas_660.37
          Length = 317

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 237 LNIAALNRELELKTVERKMDYLATLFLDPQEYEIPRHSSMKRI 279
           L +A LN +LEL   ++  D L T F D  E+  P   +MKR+
Sbjct: 250 LFLAHLNVQLELPEGDKVKDILETKFADEWEWLQPHLGAMKRL 292

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 231 LLRVQRLNIAALNRELELKTVERKMDYLATLFLDPQEYEIPRHSSMKRI 279
           +LR ++L+    N ++    +E+KM  L    LDPQ +  PRH+ + ++
Sbjct: 707 VLRTEKLDFVTTNYDI----LEKKMLKLNGSLLDPQLFGKPRHTFLSQV 751

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,333,686
Number of extensions: 474650
Number of successful extensions: 1582
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1578
Number of HSP's successfully gapped: 37
Length of query: 399
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 295
Effective length of database: 12,995,837
Effective search space: 3833771915
Effective search space used: 3833771915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)