Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D02046g24524112581e-178
Scas_602.524524112371e-175
Sklu_1537.124524112311e-174
CAGL0K02497g24524112201e-172
YPR016C (TIF6)24524112161e-172
Kwal_14.219124524112051e-170
ADL030C24524112051e-170
AER159C119167720.35
Kwal_26.668041691661.6
YKR031C (SPO14)168343671.6
Kwal_47.1887631130652.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D02046g
         (241 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D02046g complement(175907..176644) highly similar to sp|Q12...   489   e-178
Scas_602.5                                                            481   e-175
Sklu_1537.1 YPR016C, Contig c1537 383-1120 reverse complement         478   e-174
CAGL0K02497g 225229..225966 highly similar to sp|Q12522 Saccharo...   474   e-172
YPR016C (TIF6) [5450] chr16 complement(592327..593064) Translati...   473   e-172
Kwal_14.2191                                                          468   e-170
ADL030C [1712] [Homologous to ScYPR016C (TIF6) - SH] (647423..64...   468   e-170
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    32   0.35 
Kwal_26.6680                                                           30   1.6  
YKR031C (SPO14) [3286] chr11 complement(500986..506037) Phosphol...    30   1.6  
Kwal_47.18876                                                          30   2.2  

>KLLA0D02046g complement(175907..176644) highly similar to sp|Q12522
           Saccharomyces cerevisiae YPR016c TIF6 translation
           initiation factor 6 (eIF6) singleton, start by
           similarity
          Length = 245

 Score =  489 bits (1258), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 241/241 (100%), Positives = 241/241 (100%)

Query: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60
           MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG
Sbjct: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180
           IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP
Sbjct: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240
           LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL
Sbjct: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>Scas_602.5
          Length = 245

 Score =  481 bits (1237), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 232/241 (96%), Positives = 240/241 (99%)

Query: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60
           MATRTQFENSNEIGVFSKLTN+YCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEIGVFSKLTNTYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNCLPD+VK+QRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180
           IDRETEELI+DVLGVEVFRQTISGN+LVGSYCALSNQGGLVHPQTT+QDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240
           LVAGTVNRGS VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPE+ISGNLRDTL
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>Sklu_1537.1 YPR016C, Contig c1537 383-1120 reverse complement
          Length = 245

 Score =  478 bits (1231), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/241 (96%), Positives = 239/241 (99%)

Query: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60
           MATRTQFENSNE+GVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEVGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRN LPD+VK+QRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180
           IDRETEELIADVLGVEVFRQTISGNVLVGSYC+LSNQGGLVHPQTT+QDQEELSSLLQVP
Sbjct: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCSLSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240
           LVAGTVNRGS VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPE+ISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>CAGL0K02497g 225229..225966 highly similar to sp|Q12522
           Saccharomyces cerevisiae YPR016c Eukaryotic translation
           initiation factor 6, start by similarity
          Length = 245

 Score =  474 bits (1220), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 229/241 (95%), Positives = 239/241 (99%)

Query: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60
           MATRTQFENSNE+GVFSKLTN+YCLVA+GGSENFYSAFEAELGD+IPIAHTTIAGTRIVG
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVAVGGSENFYSAFEAELGDSIPIAHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRN LPD+VK+QRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180
           IDRETEELI+DVLGVEVFRQTISGN+LVGSYCALSNQGGLVHPQTT+QDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240
           LVAGTVNRGS VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQP+AISGNLRDTL
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPDAISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>YPR016C (TIF6) [5450] chr16 complement(592327..593064) Translation
           initiation factor 6 (eIF6), nuclear protein required for
           transit of pre-60S ribosomal subunits from the nucleus
           to the cytoplasm [738 bp, 245 aa]
          Length = 245

 Score =  473 bits (1216), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 228/241 (94%), Positives = 238/241 (98%)

Query: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60
           MATRTQFENSNEIGVFSKLTN+YCLVA+GGSENFYSAFEAELGDAIPI HTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRN LPD+VK+QRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180
           IDRETEELI+DVLGVEVFRQTISGN+LVGSYC+LSNQGGLVHPQT+VQDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240
           LVAGTVNRGS VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPE+ISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>Kwal_14.2191
          Length = 245

 Score =  468 bits (1205), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 225/241 (93%), Positives = 236/241 (97%)

Query: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60
           MA+RTQFENSNE+GVFSKLTNSYCLV +GGSENFYSAFEAELGDAIP+ HTTIAGTRI+G
Sbjct: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQEL HLRN LPD+VK+QRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180
           +DRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQT++QDQEELSSLLQVP
Sbjct: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240
           LVAGTVNRGS VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPE+ISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>ADL030C [1712] [Homologous to ScYPR016C (TIF6) - SH]
           (647423..648160) [738 bp, 245 aa]
          Length = 245

 Score =  468 bits (1205), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/241 (93%), Positives = 235/241 (97%)

Query: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60
           MATRTQFENSNE+GVFSKLTN+YCLV +GGSENFYSAFEAELGDAIPI HTTIAGTRIVG
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRN LPD+VK+QR+EERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180
           ID ETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTT+QDQEELSSLLQVP
Sbjct: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240
           LVAGT+NRGS VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDA P+AISGNLRDTL
Sbjct: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240

Query: 241 I 241
           I
Sbjct: 241 I 241

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 32.3 bits (72), Expect = 0.35,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 7/67 (10%)

Query: 149 GSYCALSNQGGLVHPQTTVQDQEELSSLLQVPLVAGTVNRGSQVVGAGMVVNDYLAVTGL 208
           G   A S+ G LV P      +    +L+  PL+   +  GS V GAG         TG+
Sbjct: 314 GEQRATSDTGTLVMPSMRASHEFIAPTLVHTPLIMDFLQIGSSVGGAG-------GFTGV 366

Query: 209 DTTAPEL 215
           DT  P L
Sbjct: 367 DTADPTL 373

>Kwal_26.6680
          Length = 416

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 42/91 (46%), Gaps = 17/91 (18%)

Query: 119 PDIDRETEELIADV----------------LGVEVFRQTISGNVLVGSYCALSNQGGLVH 162
           P++  ET+ ++A V                +  +V ++ I+G +L+ S+  L+ +    +
Sbjct: 141 PEVQEETDLIVAGVEAQREQGEASWGELFSVKTKVLQRLITG-ILMQSFLQLTGENYFFY 199

Query: 163 PQTTVQDQEELSSLLQVPLVAGTVNRGSQVV 193
             TT+ D   L+   Q  +V GTVN  S  +
Sbjct: 200 YGTTIFDSIGLTDSFQTSIVLGTVNLASSFI 230

>YKR031C (SPO14) [3286] chr11 complement(500986..506037)
           Phospholipase D, catalyzes hydrolysis of
           phosphatidylcholine to yield phosphatidic acid and
           choline [5052 bp, 1683 aa]
          Length = 1683

 Score = 30.4 bits (67), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1   MATRTQFENSNEIGVFSKL-TNSYCLVALGGSENFYSAFEAEL 42
           M+T T +   N  G F+ + TNS+C   + G + F+S  EA L
Sbjct: 660 MSTSTPWSKPNRFGSFAPVRTNSFCKFLVDGRDYFWSLSEALL 702

>Kwal_47.18876
          Length = 311

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 14 GVFSKLTNSYCL--VALGGSENFYSAFEAE 41
          GVF KL N+YCL   A GG+   Y  F  +
Sbjct: 50 GVFEKLWNNYCLHVCADGGANRLYEYFSCD 79

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,143,753
Number of extensions: 279312
Number of successful extensions: 667
Number of sequences better than 10.0: 12
Number of HSP's gapped: 653
Number of HSP's successfully gapped: 12
Length of query: 241
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 142
Effective length of database: 13,168,927
Effective search space: 1869987634
Effective search space used: 1869987634
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)