Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D01705g32131616630.0
Kwal_27.103143153175484e-68
CAGL0F03443g3123085153e-63
Scas_696.373223254945e-60
YMR274C (RCE1)3153124702e-56
AAL186W3193184004e-46
Scas_717.60325975637.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01705g
         (316 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01705g complement(152307..153272) similar to sp|Q03530 Sac...   645   0.0  
Kwal_27.10314                                                         215   4e-68
CAGL0F03443g complement(339175..340113) similar to sp|Q03530 Sac...   202   3e-63
Scas_696.37                                                           194   5e-60
YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease ...   185   2e-56
AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH] complement(810...   158   4e-46
Scas_717.60                                                            29   7.0  

>KLLA0D01705g complement(152307..153272) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of RAS2P
           singleton, start by similarity
          Length = 321

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/316 (100%), Positives = 316/316 (100%)

Query: 1   MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIP 60
           MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIP
Sbjct: 1   MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIP 60

Query: 61  LLLKYMNGDSIQNTLLRFGLLPGFLNETETGLPSWVPFNYFKDSSRHLSLAIVLYSTPLL 120
           LLLKYMNGDSIQNTLLRFGLLPGFLNETETGLPSWVPFNYFKDSSRHLSLAIVLYSTPLL
Sbjct: 61  LLLKYMNGDSIQNTLLRFGLLPGFLNETETGLPSWVPFNYFKDSSRHLSLAIVLYSTPLL 120

Query: 121 DSLLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLGDSS 180
           DSLLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLGDSS
Sbjct: 121 DSLLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLGDSS 180

Query: 181 QYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTNYLFL 240
           QYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTNYLFL
Sbjct: 181 QYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTNYLFL 240

Query: 241 NSSGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLPLLVI 300
           NSSGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLPLLVI
Sbjct: 241 NSSGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLPLLVI 300

Query: 301 SIVLFKNNLTSLTAGT 316
           SIVLFKNNLTSLTAGT
Sbjct: 301 SIVLFKNNLTSLTAGT 316

>Kwal_27.10314
          Length = 315

 Score =  215 bits (548), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 192/317 (60%), Gaps = 14/317 (4%)

Query: 1   MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIP 60
           MFS P  ++++Y+S+SYV A+H  S+ + +F+ RRDDP+VIK+RM+ V  +++ +L  +P
Sbjct: 1   MFSAPF-LISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVP 59

Query: 61  LLLKYMNGDSI--QNTLLRFGLLP-GFLNETETGLPSWVPFNYFKDSSRHLSLAIVLYST 117
            L    +   I   +  L  G++P G+ ++T     S    N+  D  R L L  +LYS 
Sbjct: 60  WLQSTFSAREITFMDAFLALGIIPAGYKSDTFYFDVS----NFVYDIVRALKLVCILYSG 115

Query: 118 PLLDSLLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLG 177
           PLLD++L+Y  +PD +  +   D+  E  +IWGLR+Y+FGP TEELFYT M++  +L   
Sbjct: 116 PLLDNVLYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFLLTS 175

Query: 178 -DSSQYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTN 236
            D   Y A  + L+ P  FG+AH+HHA+E  ++GI +   I   TL+QM+YT LFG FTN
Sbjct: 176 TDPVTYKA--ILLLPPLFFGLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTN 233

Query: 237 YLFLNSSGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLP 296
           +++L +  N W C  IH F NYMGLP+ +   + + L    + +   +L S  W+  Y+ 
Sbjct: 234 FVYLRTGQNFWCCFAIHAFANYMGLPKMSALCEQFDL---NRSTGFRSLVSKFWKWGYVA 290

Query: 297 LLVISIVLFKNNLTSLT 313
           +L+I +V FK N+  LT
Sbjct: 291 MLLIGLVKFKGNMWELT 307

>CAGL0F03443g complement(339175..340113) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of
           RAS2P, hypothetical start
          Length = 312

 Score =  202 bits (515), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 121/308 (39%), Positives = 177/308 (57%), Gaps = 13/308 (4%)

Query: 9   VAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIPLLLKYMNG 68
           + + ISLSYV  ++  S+ +  +  RRDDP+VIK R+K V+ +S  +   +PLL   +  
Sbjct: 8   INIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPLLHSIIVP 67

Query: 69  D-SIQNTLLRFGLLPGFLNETETGLPSWVPFNYFKDSSRHLSLAIVLYSTPLLDSLLHYC 127
             S +   L  G++PG+     + +       Y     ++L L ++LY  PL D +L+Y 
Sbjct: 68  QLSYKEAFLNIGIIPGYHQHGSSQIKL-----YIGTILKNLCLVMLLYIGPLTDMVLYYI 122

Query: 128 FLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLGDSSQYDANYL 187
              + S   I+S    EF  IWGLR+YIF PITEELFYTS++L  YL L          L
Sbjct: 123 SNKESS---ILSAFREEFMNIWGLRNYIFAPITEELFYTSLLLNTYLTLEPRKPKLTTLL 179

Query: 188 TLIVPNLF-GIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTNYLFLNSSGNL 246
               P+LF  IAH+HHA+E   +G  +  +II  TL QM+YT +FG+FTN++FL + GNL
Sbjct: 180 W--QPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTGGNL 237

Query: 247 WSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLPLLVISIVLFK 306
           WSCIL+H+FCN MG P G+   + + ++   K   L  L  S+W  +Y  LL + I+ FK
Sbjct: 238 WSCILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHLL-SIWNKVYYILLFMGILFFK 296

Query: 307 NNLTSLTA 314
           + L  LT+
Sbjct: 297 DGLWRLTS 304

>Scas_696.37
          Length = 322

 Score =  194 bits (494), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 176/325 (54%), Gaps = 26/325 (8%)

Query: 1   MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKI-RRDDPKVIKARMKAVIALSAFHLTTI 59
           M + PA  V  YIS+SYV  ++  S+D  ++ +  RDDP VIK R++ V+ L+AF++  +
Sbjct: 1   MLNFPAFCVLSYISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLV 60

Query: 60  PLL---LKYMNGD-----SIQNTLLRFGLLPGFLNETETGLPSWVPFNYFKDSSRHLSLA 111
           P L   +K +        S+   ++  G++PG   +       W   +Y+ D    + + 
Sbjct: 61  PFLQCLIKNLRDSTDSSISVIGAIMNLGIVPGHYRDGH-----WDISSYYYDIISGIWVV 115

Query: 112 IVLYSTPLLDSLLHYCFLPDKS----YKDIISDICCEFSTIWGLRDYIFGPITEELFYTS 167
            +LY  PL+D  L Y F   K+    YKD       EFS I+ LR+YIF PITEE+FYTS
Sbjct: 116 TLLYVGPLMDLFLFYVFTKGKTLYVDYKD-------EFSNIYCLRNYIFAPITEEIFYTS 168

Query: 168 MMLVAYLRLGDSSQYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSY 227
           M+L  YL L          L       FG+AH+HHA+  +  G  NL  I+  T++Q  Y
Sbjct: 169 MLLNTYLMLCPIESLSLKTLLWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGY 228

Query: 228 TWLFGSFTNYLFLNSSGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFS 287
           T LFG+FTN++FL + GNLW+C+  H+FCN MG P  +  S  + ++  E + +      
Sbjct: 229 TTLFGAFTNFIFLRTGGNLWACMFAHSFCNIMGFPGRSRLSLHFTMIE-EVKGDWRRKLI 287

Query: 288 SVWRLLYLPLLVISIVLFKNNLTSL 312
           + W   Y+ LL + I LFK N+ +L
Sbjct: 288 AAWNKSYIFLLFLGIYLFKANIDTL 312

>YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease
           involved in ras and a-factor C-terminal proteolysis [948
           bp, 315 aa]
          Length = 315

 Score =  185 bits (470), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/312 (33%), Positives = 171/312 (54%), Gaps = 17/312 (5%)

Query: 8   VVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIPLLLKYMN 67
           +V +YIS+SYV+ ++  S+       +RD+P+ IK+RM+ +  +   +L  +P L   ++
Sbjct: 8   LVLLYISISYVLPLYATSQPEGS---KRDNPRTIKSRMQKLTIMLISNLFLVPFLQSQLS 64

Query: 68  GD----SIQNTLLRFGLLPGFLNETETGLPS-WVPFNYFKDSSRHLSLAIVLYSTPLLDS 122
                 S ++  L  G++PG+       LP+ W    + KD ++ +++ + LY  P+LD 
Sbjct: 65  STTSHISFKDAFLGLGIIPGYY----AALPNPWQFSQFVKDLTKCVAMLLTLYCGPVLDF 120

Query: 123 LLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLGDSSQY 182
           +L++   P  S   I+ D   EF  IW  R++IF PITEE+FYTSM+L  YL L   SQ 
Sbjct: 121 VLYHLLNPKSS---ILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQL 177

Query: 183 DANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTNYLFLNS 242
               L       FG+AH HHA+EQ   G M   +I+  T  Q+ YT LFG  T ++F+ +
Sbjct: 178 SYQQLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVRT 237

Query: 243 SGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLPLLVISI 302
            GNLW CI++H  CN MG P  +  +  + +V  +K++   +   S+W   Y  LLV+ +
Sbjct: 238 GGNLWCCIILHALCNIMGFPGPSRLNLHFTVV--DKKAGRISKLVSIWNKCYFALLVLGL 295

Query: 303 VLFKNNLTSLTA 314
           +  K+ L +L  
Sbjct: 296 ISLKDTLQTLVG 307

>AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH]
           complement(8108..9067) [960 bp, 319 aa]
          Length = 319

 Score =  158 bits (400), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 113/318 (35%), Positives = 160/318 (50%), Gaps = 12/318 (3%)

Query: 1   MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIP 60
           MF   A +++ Y + SYV A++            R+DPK I   MKAV      +L  IP
Sbjct: 1   MFPSSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIP 60

Query: 61  LLLKYMNGD--SIQNTLLRFGLLPGFLNETETGLPSWVPFNYFKDSSRHLSLAIVLYSTP 118
            L   +  D  S  +   R GL+PG       GL  W    Y  D  R LS+   LY+  
Sbjct: 61  WLQSRLASDGFSFVDCFFRLGLVPGAYAHFR-GL-HWDTLAYATDILRALSILGSLYAAD 118

Query: 119 LLDSLLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLGD 178
           LLDS  +Y  +PD S    + D+    S   GLR+Y+FGPITEEL YTSM+L  Y RL  
Sbjct: 119 LLDSAAYYLLVPDTS---PVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNY-RLLQ 174

Query: 179 SSQYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTNYL 238
            +   A  L L  P  FG+AHVHHA +  + G    A +   +  Q+ YT LFG+FTNY+
Sbjct: 175 PTISRAM-LLLATPMFFGVAHVHHARQLLATG-HRPAQVALTSSFQILYTTLFGTFTNYI 232

Query: 239 FLNSSGNLWSCILIHTFCNYMGLP--QGNTFSKAYALVPIEKRSNLGTLFSSVWRLLYLP 296
           + +++GNLW+CIL+H  CNY+  P    + F+   A VP   R+         W   Y  
Sbjct: 233 YYHTAGNLWACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRALWKMRLLHAWGYTYRL 292

Query: 297 LLVISIVLFKNNLTSLTA 314
            L+  ++ F + + + ++
Sbjct: 293 CLLCGLLAFLDGIRTFSS 310

>Scas_717.60
          Length = 3259

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 165  YTSMMLVAYLRLGDSSQYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQ 224
            YTS++   +L+LG+    D        P L  +    H F++    ++ L N + + +  
Sbjct: 964  YTSIIFRCFLKLGEGKSID--------PVLHDLKTETHIFDEVVTEVLELRNAVHL-MDN 1014

Query: 225  MSYTWLFGSFTNYLF 239
            ++Y+ +  +F +Y+F
Sbjct: 1015 LAYSLVLLNFNSYIF 1029

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,419,174
Number of extensions: 457964
Number of successful extensions: 1286
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1288
Number of HSP's successfully gapped: 9
Length of query: 316
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 214
Effective length of database: 13,065,073
Effective search space: 2795925622
Effective search space used: 2795925622
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)