Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D01683g94493037620.0
YML109W (ZDS2)9423895558e-59
AAL185W10181075132e-53
Kwal_27.103189251085024e-52
YMR273C (ZDS1)915964732e-48
Scas_650.229931024634e-47
CAGL0F03421g817974472e-45
CAGL0J06688g828974204e-42
Scas_631.2264138731.4
AFL191W157564687.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01683g
         (930 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01683g complement(148855..151689) some similarities with s...  1453   0.0  
YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in r...   218   8e-59
AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS...   202   2e-53
Kwal_27.10318                                                         197   4e-52
YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein t...   186   2e-48
Scas_650.22                                                           182   4e-47
CAGL0F03421g complement(336157..338610) similar to sp|P50111 Sac...   176   2e-45
CAGL0J06688g complement(637917..640403) similar to sp|P54786 Sac...   166   4e-42
Scas_631.22                                                            33   1.4  
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    31   7.5  

>KLLA0D01683g complement(148855..151689) some similarities with
           sp|P54786 Saccharomyces cerevisiae YML109w ZDS2
           multicopy suppressor of SIN4, hypothetical start
          Length = 944

 Score = 1453 bits (3762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/930 (79%), Positives = 735/930 (79%)

Query: 1   MPMSKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSSRXXXXXXX 60
           MPMSKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSSR       
Sbjct: 1   MPMSKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSSRQGTGTAT 60

Query: 61  XXXXXXPYIAXXXXXXXXXXXXQGEQEYGNDDNQETQLSHSSLSEDDTTTAGAAVEEEDD 120
                 PYIA            QGEQEYGNDDNQETQLSHSSLSEDDTTTAGAAVEEEDD
Sbjct: 61  DQDTGTPYIATSSIKTETTKSEQGEQEYGNDDNQETQLSHSSLSEDDTTTAGAAVEEEDD 120

Query: 121 SYSFTDDSMDVTNAEYLDKDAQANMINNNYRHEPLPRRRVLXXXXXXXXXXXXXXXDGND 180
           SYSFTDDSMDVTNAEYLDKDAQANMINNNYRHEPLPRRRVL               DGND
Sbjct: 121 SYSFTDDSMDVTNAEYLDKDAQANMINNNYRHEPLPRRRVLSGSISRSISGTSSTSDGND 180

Query: 181 ESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLK 240
           ESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLK
Sbjct: 181 ESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLK 240

Query: 241 TLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSSRRTVSLKDIT 300
           TLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSSRRTVSLKDIT
Sbjct: 241 TLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSSRRTVSLKDIT 300

Query: 301 EELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTGQGLSNNLADEEEEFASTMFTKSGF 360
           EELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTGQGLSNNLADEEEEFASTMFTKSGF
Sbjct: 301 EELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTGQGLSNNLADEEEEFASTMFTKSGF 360

Query: 361 TVPARHSLRRSKFNTYRIQSSSSKEERIIETRXXXXXXXXXXXXXXLYNDEPFNEKKPIV 420
           TVPARHSLRRSKFNTYRIQSSSSKEERIIETR              LYNDEPFNEKKPIV
Sbjct: 361 TVPARHSLRRSKFNTYRIQSSSSKEERIIETRSPSGSNNSPNSIIGLYNDEPFNEKKPIV 420

Query: 421 QEFFSTLPXXXXXXXXXXXXXXXXXXXXXNEVSSELETTDKQRINETSKSWRWSQSPTTS 480
           QEFFSTLP                     NEVSSELETTDKQRINETSKSWRWSQSPTTS
Sbjct: 421 QEFFSTLPASDDFESESSTEDAESSADFSNEVSSELETTDKQRINETSKSWRWSQSPTTS 480

Query: 481 NDYQQAQYVPKENIAPLKINHSRNRHNIAATNSERNTSETSINTTGSAATVVTQTSIDTS 540
           NDYQQAQYVPKENIAPLKINHSRNRHNIAATNSERNTSETSINTTGSAATVVTQTSIDTS
Sbjct: 481 NDYQQAQYVPKENIAPLKINHSRNRHNIAATNSERNTSETSINTTGSAATVVTQTSIDTS 540

Query: 541 SKETSNTQEIKPEKRRSASMNLDHDTTSIEVNDKKLKKGNHGQNXXXXXXXXXXXXXXXX 600
           SKETSNTQEIKPEKRRSASMNLDHDTTSIEVNDKKLKKGNHGQN                
Sbjct: 541 SKETSNTQEIKPEKRRSASMNLDHDTTSIEVNDKKLKKGNHGQNKFMKFFKKRSSSASSG 600

Query: 601 XXXXXESTTENLPSMPIERELKKKQSGSGLSNKFWISPXXXXXXXXXXXXXXXHKDRIXX 660
                ESTTENLPSMPIERELKKKQSGSGLSNKFWISP               HKDRI  
Sbjct: 601 GKIFKESTTENLPSMPIERELKKKQSGSGLSNKFWISPKKQSKSESGKEEQLKHKDRIKF 660

Query: 661 XXXXXXXXXXXXXXXXPSLQPAVTVVKSNRQVSGELGTVNYYADDKTKGXXXXXXXXXXX 720
                           PSLQPAVTVVKSNRQVSGELGTVNYYADDKTKG           
Sbjct: 661 EYEKEKKQKEKRTKKKPSLQPAVTVVKSNRQVSGELGTVNYYADDKTKGNTHNQQSSSSF 720

Query: 721 XXXXXXXXXDYEEDDVEVTEFSVHEDSFTSVHSNSSVNTFKDAILQTDHXXXXXXXXXXX 780
                    DYEEDDVEVTEFSVHEDSFTSVHSNSSVNTFKDAILQTDH           
Sbjct: 721 SKSNSNRTSDYEEDDVEVTEFSVHEDSFTSVHSNSSVNTFKDAILQTDHSQDSPYSGTSS 780

Query: 781 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTLENQYPLPPRKLTFADVLKPDRP 840
                                              GTLENQYPLPPRKLTFADVLKPDRP
Sbjct: 781 TSSPSSPASPPAPMQIPSASTPPPPTQQQEQEQAQGTLENQYPLPPRKLTFADVLKPDRP 840

Query: 841 NSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSHLKLSDPKRVLRQQVLLS 900
           NSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSHLKLSDPKRVLRQQVLLS
Sbjct: 841 NSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSHLKLSDPKRVLRQQVLLS 900

Query: 901 NFMYAYLNLVNHSLYLQQIEEEHMGNNGSM 930
           NFMYAYLNLVNHSLYLQQIEEEHMGNNGSM
Sbjct: 901 NFMYAYLNLVNHSLYLQQIEEEHMGNNGSM 930

>YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in
           regulation of transcriptional silencing and life span,
           multicopy suppressor of sin4 [2829 bp, 942 aa]
          Length = 942

 Score =  218 bits (555), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 153/389 (39%), Positives = 213/389 (54%), Gaps = 53/389 (13%)

Query: 7   DKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSSRXXXXXXXXXXXXX 66
           +KRKS+VLIAA+SLD E+++VKNLKRLSIGSMDL++DPELE++V+SR             
Sbjct: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQ 105

Query: 67  PYIAXXXXXXXXXXXXQGEQEYGNDDNQETQLSHSSLSEDDTTTAGAAVEEEDDSYSFTD 126
             +             + ++E G++DN                    A EE D   +  D
Sbjct: 106 ESL-----HEENIIRSEQKEEQGSEDND-------------------AYEEGD--ATNVD 139

Query: 127 DSMDVTNAEYLDKD---AQANMINN-----NYRHEPLPRRRVLXXXXXXXXXXXXXXXDG 178
           DS+D+T  EYL  +    +  +I N     +       R R L                 
Sbjct: 140 DSIDITQTEYLHDEETLEKEKIIRNASSSTSSSARVTSRNRRLSGVKTLAHDVVLDVE-- 197

Query: 179 NDESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSG 238
           ND       L QNLLWV ADQHPNVKPENYLEL+Q+TL+N+ +               + 
Sbjct: 198 NDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDENKLELGNNH 257

Query: 239 LKTLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAA--------AAPTMSS 290
           + + RKR+     S+ RRPSRL+TSYT+    D++  + D+P           ++  + +
Sbjct: 258 VISNRKRT----GSVVRRPSRLKTSYTKF---DDEPPLADKPQEGEIQVDKRISSSDIKT 310

Query: 291 RRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTGQGLSNNLADEEEEF 350
            R+VSLK+ITEELTK+SN AGLTD+DAVTLAR+L ++   T +S    L+ N  + + EF
Sbjct: 311 IRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESL--HLNGNHTENDNEF 368

Query: 351 ASTMFTKSGFTVPARHSLRRSKFNTYRIQ 379
           AS MF ++G T+P R SLRRSKFNTY+I+
Sbjct: 369 ASNMFNETGLTIPERSSLRRSKFNTYKIR 397

 Score =  179 bits (453), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (86%)

Query: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883
           LPPRKLTF DV+KPD  N+P+KFTDSAFGFPLP +T STVIMFDHRL I+VERAIYRLSH
Sbjct: 817 LPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 876

Query: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEEHMGNNG 928
           LKLSDP R LRQQVLLSNFMY+YLNLVNH+LY++Q+    +  NG
Sbjct: 877 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTGDIAFNG 921

>AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS1)
           - SH] complement(9537..12593) [3057 bp, 1018 aa]
          Length = 1018

 Score =  202 bits (513), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 98/107 (91%)

Query: 816 GTLENQYPLPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVE 875
           G  E  + LPPRKL F DVL+P++PNSPMKFT SAFGFPLPPLT+STVIMFDHRLPI+VE
Sbjct: 888 GPGEIAHSLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVE 947

Query: 876 RAIYRLSHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEE 922
           RAIYRLSHLKLSDPKR LRQQVLLSNFMY+YLNLVNHSLYLQQIEE+
Sbjct: 948 RAIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEED 994

 Score =  169 bits (429), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 97/200 (48%), Positives = 127/200 (63%), Gaps = 4/200 (2%)

Query: 185 NESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLKTLRK 244
            E    NLLWVRADQHPNVKPENYLELV +TL N+ +G R    +    QS + +    +
Sbjct: 225 GEPFSSNLLWVRADQHPNVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVAN-GE 283

Query: 245 RSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSSRRTVSLKDITEELT 304
            S  S  SL R+ SRLR S+TE+ E  E+   TD  + +  P     R  SLK+ITEELT
Sbjct: 284 SSTASARSLVRKQSRLRKSFTEV-EAIEESQFTDS-IGSEIPVGKRMRVSSLKEITEELT 341

Query: 305 KLSNQAGLTDTDAVTLARTLWVADESTTD-STGQGLSNNLADEEEEFASTMFTKSGFTVP 363
           ++SN AGLTD+DA+TLARTL +  +S  + +T      +   EE E+AS++  K+G  +P
Sbjct: 342 RISNNAGLTDSDAITLARTLGIGSQSADEHATFSECVPSAEAEENEYASSILAKNGLAIP 401

Query: 364 ARHSLRRSKFNTYRIQSSSS 383
           AR SLRRSKF TYRI+S+ S
Sbjct: 402 ARSSLRRSKFTTYRIRSAGS 421

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/45 (77%), Positives = 44/45 (97%)

Query: 6   RDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRV 50
           ++KRKSEVLIAAQSLD E+++VKNLKR+SIGSMDLLMDPE+E+R+
Sbjct: 70  KEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRM 114

>Kwal_27.10318
          Length = 925

 Score =  197 bits (502), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 87/108 (80%), Positives = 100/108 (92%)

Query: 822 YPLPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRL 881
           Y LPPRKLTF+DV+KP+RPNSPMKF+DS+FGFPLPPLTISTV+M DHRL I+VERAIYRL
Sbjct: 809 YTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRL 868

Query: 882 SHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEEHMGNNGS 929
           SHLKL DPKR LRQQV+LSNFMYAYLNLVNHSLYLQQ+EE++  ++ S
Sbjct: 869 SHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEEDNPADSAS 916

 Score =  196 bits (498), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 149/401 (37%), Positives = 208/401 (51%), Gaps = 72/401 (17%)

Query: 4   SKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSSRXXXXXXXXXX 63
           ++ +KRKSEVLIAAQSLD E++HVKNLKR+S GSMDL +DPE+E+R+S            
Sbjct: 28  ARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMSPSHS-------- 79

Query: 64  XXXPYIAXXXXXXXXXXXXQGEQEYGNDDNQETQLSHSSLSEDDTTTAGAAVEEEDDSYS 123
                              Q E+   +DD+                         DD+ S
Sbjct: 80  ------QRSSSSDAVSLESQAEEPNQDDDS-------------------------DDNLS 108

Query: 124 FTDDSMDVTNAEYLD--KDAQANMINNNYRHEPLPRRRVLXXXXXXXXXXXXXXXDGNDE 181
           + +DS+++T  EYL+  +D      + +   +    R +                +G D+
Sbjct: 109 YLNDSIELTAHEYLEEPRDFLVERSSVSKSEDSHNGRNLSGVRRGGMSKKPRELSNGGDD 168

Query: 182 SKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGG--RSPTANETQAQ----S 235
           +     + QNL WV A+QHPNVKPENYLELVQ+TL  +++      PT    +      +
Sbjct: 169 N-----VTQNLFWVPANQHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLA 223

Query: 236 LSGLKTLRKRSMQSG-NSLARRPSRLRTSYTEL-----------SEDDEDKGMTDQPLAA 283
            +  K      ++SG NSL RRPS LR SYTEL            E++E+       +  
Sbjct: 224 SANTKASPSSQLRSGQNSLVRRPSGLRKSYTELEDLLQHEIQDSDENNENAQSELNNIIK 283

Query: 284 AAPTMSSRRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTGQGLSNNL 343
             P  +S  + SLKDITEELT++SN+AG TD DAV LARTL +A  S+ D   Q  +N  
Sbjct: 284 NRPRATSSGS-SLKDITEELTRISNKAGFTDGDAVCLARTLSMA--SSYDGE-QSQANQS 339

Query: 344 ADEEE----EFASTMFTKSGFTVPARHSLRRSKFNTYRIQS 380
           A+ +     E+AST+ TK+G  +PAR SLRRSKFNTYRI++
Sbjct: 340 ANTDHTPDSEYASTILTKNGLAIPARSSLRRSKFNTYRIRT 380

>YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein that
           regulates SWE1 and CLN2 transcription, Sir3p
           phosphorylation, rDNA recombination and silencing, and
           life span, involved in high calcium tolerance and
           regulation of beta-1,3 glucan biosynthesis [2748 bp, 915
           aa]
          Length = 915

 Score =  186 bits (473), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 92/96 (95%)

Query: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883
           LPPRKLTFADV KPD+PNSP++FTDSAFGFPLP LT+STVIMFDHRLPI+VERAIYRLSH
Sbjct: 806 LPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 865

Query: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQI 919
           LKLS+ KR LR+QVLLSNFMYAYLNLVNH+LY++Q+
Sbjct: 866 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 901

 Score =  137 bits (344), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 132/240 (55%), Gaps = 45/240 (18%)

Query: 188 LGQNLLWVRADQHPNVKPENYLELVQNTLENMNLG-------GRSPTANETQ-------A 233
           L +NLLWV A+QHPNVKP+N+LELVQ+TL+N+ L        G S   N+ +       +
Sbjct: 146 LKKNLLWVPANQHPNVKPDNFLELVQDTLQNIQLSDNGEDNDGNSNENNDIEDNGEDKES 205

Query: 234 QSLSG-----LKTLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTM 288
           QS        +   R  S     SL RRPS LR SYTE  ++++D         +A+ T+
Sbjct: 206 QSYENKENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFDDNEDDDNKG----DSASETV 261

Query: 289 SS---------RRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVAD----------- 328
           +           R VSL+DITEELTK+SN AGLTD DA+TLARTL +A            
Sbjct: 262 NKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQP 321

Query: 329 ESTTDSTGQGLSNNLAD--EEEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQSSSSKEE 386
           E   D    G S + A+  ++ EFAS M   +  T P R SLRRS+FNTYRI+S   ++E
Sbjct: 322 EGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIRSQEQEKE 381

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%)

Query: 4  SKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYR 49
          S+RDKRKSEVLIAAQSLD E++ VKNLKRLSIGSMDLL+DPEL+ +
Sbjct: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66

>Scas_650.22
          Length = 993

 Score =  182 bits (463), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 94/102 (92%)

Query: 821 QYPLPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYR 880
           ++ LP RKLTFADV +PDRPN+P++FTDSAFGFPLP LT+STVIMFDHRL I+VERAIYR
Sbjct: 847 EHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYR 906

Query: 881 LSHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEE 922
           LSHLKLSD KR LRQQVLLSNFMYAYLNLVNH+LY++Q+ ++
Sbjct: 907 LSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQ 948

 Score =  165 bits (417), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 108/237 (45%), Positives = 142/237 (59%), Gaps = 45/237 (18%)

Query: 188 LGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQ----------SLS 237
           L +NLLWV A+QHPNVKPENYLELVQ+TL+N++L   + +      +          S S
Sbjct: 196 LTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDISKS 255

Query: 238 GL----------KTLRKRSMQSGN---SLARRPSRLRTSYTELSEDD-----EDKGMTDQ 279
            +          ++L K  ++  N   SL RRPSRLRTSYTE  EDD     E +  T++
Sbjct: 256 NMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEESEAKTNE 315

Query: 280 PLAAA---APTMS------------SRRTVSLKDITEELTKLSNQAGLTDTDAVTLARTL 324
              ++    P +             S+R+VSLKDITEELT +SN+AGLTD+DA+TLARTL
Sbjct: 316 SQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLARTL 375

Query: 325 WVADESTTDSTGQGLS--NNLADEEEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQ 379
            +A   +  +   G S   N ++EE EFAS MF K+G T+P R SLRRSKFNTYRI+
Sbjct: 376 SMASSFSDGNVNLGKSKLQNESNEESEFASNMFMKNGLTIPERSSLRRSKFNTYRIR 432

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (95%)

Query: 4  SKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRV 50
          ++RDKRKSEVLIAAQSLD EV+ VKNLKRLSIGSMDLL+DPELE+RV
Sbjct: 19 TQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRV 65

>CAGL0F03421g complement(336157..338610) similar to sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 817

 Score =  176 bits (447), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 89/97 (91%), Gaps = 1/97 (1%)

Query: 823 PL-PPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRL 881
           PL PPRKLTFADV K D+ N+P++FTDSAFGFPLP LT STVIMFDHRLPIHVERAIYRL
Sbjct: 719 PLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRL 778

Query: 882 SHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQ 918
           SHLKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q
Sbjct: 779 SHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  126 bits (316), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 119/220 (54%), Gaps = 27/220 (12%)

Query: 188 LGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGLKTLRK--R 245
           + QNLLWVRADQHPNVKPENY+ELVQ+ L N+ +       ++T+        TL K  R
Sbjct: 150 VAQNLLWVRADQHPNVKPENYIELVQDALHNIQI-------DKTEEHDKENSDTLDKVSR 202

Query: 246 SMQSGN-------SLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSSRRTVSLKD 298
              S N        L RRPS LR SYTE  E  +              +    +  +LKD
Sbjct: 203 YYNSNNKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKD 262

Query: 299 ITEELTKLSNQAGLTDTDAVTLARTL---WVADESTTDSTGQ------GLSNNLADEEEE 349
           ITEELT++SN+AGLT+ DAVTLARTL    VA+E  TD   +        +    + ++ 
Sbjct: 263 ITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDN 322

Query: 350 FASTMFTKSGFTVPARHS-LRRSKFNTYRIQSSSSKEERI 388
           +ASTM   +   + + HS L+RSK+ TY I++   K+  I
Sbjct: 323 YASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDPTI 361

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (94%)

Query: 11 SEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELE 47
          SEV IAAQSLD+E++ VKNLKRLSIGSMDLLMDPE++
Sbjct: 6  SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMD 42

>CAGL0J06688g complement(637917..640403) similar to sp|P54786
           Saccharomyces cerevisiae YML109w ZDS2 or sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 828

 Score =  166 bits (420), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 86/97 (88%)

Query: 826 PRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSHLK 885
           P+KLTF DV KP+R N+PM+FTDSAFGFPLPPLTISTVIM DHRL I+VERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 886 LSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEE 922
           LS+  R LRQQVLLSNFMYAYLNLV H+L +++ E++
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQD 792

 Score =  165 bits (417), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 141/406 (34%), Positives = 199/406 (49%), Gaps = 73/406 (17%)

Query: 3   MSKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSSRXXXXXXXXX 62
           + K D   SE L AAQSLDQEV++VKNLKRLSIGS+DL+ DPEL   V+           
Sbjct: 13  VQKTDGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTG---------- 62

Query: 63  XXXXPYIAXXXXXXXXXXXXQGEQEYGNDDNQETQLSHSSLSEDDTTTAGAAVEEEDDSY 122
                                 E+E   D + +  LS+ S +E+D TT      + D+  
Sbjct: 63  ---------------------TERE---DTSYDADLSNGSFTEEDDTTTEIDGSDADE-- 96

Query: 123 SFTDDSMDVTNAEYL--------------DKDAQANMINNNYRHEPLPRRRVLXXXXXXX 168
             T  S+D T  EYL                 A+   +N NY         +        
Sbjct: 97  --TSASIDRTRVEYLTSYDNTQESSNESPKGVARTRSLNLNYHANSNSDISIKERTLRGS 154

Query: 169 XXXXXXXXDGNDESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTL---ENMNLGGRS 225
                     N+E    +S+   L WV A+QHPNVKPENYLELV+ TL    ++N  G+ 
Sbjct: 155 RSLSNLKKPKNEE----QSVSDKLFWVPANQHPNVKPENYLELVKETLNKIRDINTDGKE 210

Query: 226 PTANETQAQSLSGLKTLRKRSMQSGNSLARRPSRLRTSYTELSEDD---EDKGMTDQPLA 282
            +      + +S  + + +     G S+ RRPS+LR SYTE S +D    DK +++  + 
Sbjct: 211 KSE-NNSEEEVSNKENINENGRLRG-SIVRRPSKLRKSYTEFSSEDLELLDKALSNNRII 268

Query: 283 AAAPTMSSRRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADESTT-DSTGQGLSN 341
           +   T +S+R +SLK+IT EL K SN+AGLTD +AVTLARTL +A   T  + TG+   +
Sbjct: 269 STRNTTNSKR-LSLKEITNELVKHSNKAGLTDDNAVTLARTLSIASSVTNQNETGRNDQS 327

Query: 342 NLADEEEE-------FASTMFTKSGFTVPARHSLRRSKFNTYRIQS 380
           N   +++        FA+ +   S        SLRRSKFNTYR+++
Sbjct: 328 NTEQQKQSEDADDDTFATAVVGNSHSLASNTSSLRRSKFNTYRVKA 373

>Scas_631.22
          Length = 641

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 245 RSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLA 282
           R +Q    + R+P  L +SY + +E+DED  M D PL+
Sbjct: 28  RGLQKPPPIKRKPIELTSSYNDENEEDEDGSMVDVPLS 65

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 7/64 (10%)

Query: 451  EVSSELETTDKQR-------INETSKSWRWSQSPTTSNDYQQAQYVPKENIAPLKINHSR 503
            E+ +ELE  D  R        NE  + W W + P T           K +     INH+R
Sbjct: 1427 EIFAELEQRDAVRKKLEFGAFNELKQGWTWQRDPPTIKRLMNKAIGNKSDTFDGVINHTR 1486

Query: 504  NRHN 507
            +R N
Sbjct: 1487 SRKN 1490

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.124    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,813,161
Number of extensions: 945702
Number of successful extensions: 4560
Number of sequences better than 10.0: 111
Number of HSP's gapped: 4635
Number of HSP's successfully gapped: 136
Length of query: 930
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 819
Effective length of database: 12,753,511
Effective search space: 10445125509
Effective search space used: 10445125509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)