Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D01661g1121115725e-78
AAL184W1121093626e-46
CAGL0J06666g1121093532e-44
Kwal_27.103281271023245e-40
YML108W1051033173e-39
Sklu_767.199923062e-37
Scas_650.23*1151172811e-33
KLLA0C02255g116238690.14
Kwal_47.1690542051680.18
CAGL0C02805g34765621.0
Kwal_26.867620760592.2
CAGL0M06215g317106583.6
YOR375C (GDH1)45445584.0
Kwal_14.1938196439584.3
Sklu_1988.439929559.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01661g
         (111 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01661g complement(148193..148531) similar to sp|Q03759 Sac...   224   5e-78
AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..132...   144   6e-46
CAGL0J06666g complement(636953..637291) similar to sp|Q03759 Sac...   140   2e-44
Kwal_27.10328                                                         129   5e-40
YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown...   126   3e-39
Sklu_767.1 YML108W, Contig c767 652-951 reverse complement            122   2e-37
Scas_650.23*                                                          112   1e-33
KLLA0C02255g 189083..192571 similar to sp|P53840 Saccharomyces c...    31   0.14 
Kwal_47.16905                                                          31   0.18 
CAGL0C02805g 280107..281150 highly similar to tr|Q08726 Saccharo...    28   1.0  
Kwal_26.8676                                                           27   2.2  
CAGL0M06215g 645200..646153 similar to sp|P38122 Saccharomyces c...    27   3.6  
YOR375C (GDH1) [5150] chr15 complement(1041674..1043038) Glutama...    27   4.0  
Kwal_14.1938                                                           27   4.3  
Sklu_1988.4 YCL044C, Contig c1988 4184-5383 reverse complement         26   9.7  

>KLLA0D01661g complement(148193..148531) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w hypothetical protein
           singleton, start by similarity
          Length = 112

 Score =  224 bits (572), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 111/111 (100%), Positives = 111/111 (100%)

Query: 1   MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDE 60
           MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDE
Sbjct: 1   MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDE 60

Query: 61  KICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKEQD 111
           KICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKEQD
Sbjct: 61  KICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKEQD 111

>AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..13244)
           [339 bp, 112 aa]
          Length = 112

 Score =  144 bits (362), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 86/109 (78%)

Query: 3   ATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKI 62
           AT+N YRM+ILLEEP  + + D +K +NA+H+FVDEL LPIQVD++++LN+WFDKFDE+I
Sbjct: 2   ATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEI 61

Query: 63  CIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKEQD 111
           CIPNEGHIKYEISSDGLIVLILDK I  ++  V  FV  N  + +   D
Sbjct: 62  CIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSSSD 110

>CAGL0J06666g complement(636953..637291) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w, start by similarity
          Length = 112

 Score =  140 bits (353), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 88/109 (80%), Gaps = 3/109 (2%)

Query: 6   NVYRMLILLEEPISE--SAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKIC 63
           N+YRM++LLEEP+ E  +  D+K+++   HEF+DEL LP Q+DE+DLLN WFDKFD++IC
Sbjct: 3   NLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEIC 62

Query: 64  IPNEGHIKYEISSDGLIVLILDKSI-EHIVQEVTSFVEQNVPESEKEQD 111
           IPNEGHIKYEI+SDGLIVLILDK + E  V +V +FVEQN  E E E+D
Sbjct: 63  IPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNVEDEDEED 111

>Kwal_27.10328
          Length = 127

 Score =  129 bits (324), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 63/102 (61%), Positives = 79/102 (77%), Gaps = 6/102 (5%)

Query: 5   ENVYRMLILLEEPI-SESAGDTKKKQN-----ATHEFVDELPLPIQVDEMDLLNSWFDKF 58
           E  YRML+L+E+P+ SE   D +K++N     ATHEFVDEL LP ++D+MD LN WFDKF
Sbjct: 18  ERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFDKF 77

Query: 59  DEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVE 100
           D +ICIPNEG IKYEISSDGL+VL+LD+S E +V EV  FV+
Sbjct: 78  DAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQ 119

>YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown
           function [318 bp, 105 aa]
          Length = 105

 Score =  126 bits (317), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 76/103 (73%), Gaps = 3/103 (2%)

Query: 3   ATENVYRMLILLEEPISESAGD---TKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFD 59
           +  N YRML+LLE+    +  D    K K    HEFVDEL LP  VDE+D LN+WFDKFD
Sbjct: 2   SKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFD 61

Query: 60  EKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
            +ICIPNEGHIKYEISSDGLIVL+LDK IE +V++V  FVE+N
Sbjct: 62  AEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEEN 104

>Sklu_767.1 YML108W, Contig c767 652-951 reverse complement
          Length = 99

 Score =  122 bits (306), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 1/92 (1%)

Query: 12  ILLEEPISESAGDTKKKQNAT-HEFVDELPLPIQVDEMDLLNSWFDKFDEKICIPNEGHI 70
           +LLEE I +S+ +  +    T HEFVDEL LPIQVDEMDLLN WFDKFDE+ICIPNEG+I
Sbjct: 1   MLLEEAIPDSSQENNENTTKTSHEFVDELVLPIQVDEMDLLNDWFDKFDEQICIPNEGYI 60

Query: 71  KYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102
           KYEISSDGLIVLIL+K  E +V +V  FVE++
Sbjct: 61  KYEISSDGLIVLILNKEREEVVDKVRRFVEEH 92

>Scas_650.23*
          Length = 115

 Score =  112 bits (281), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 13/117 (11%)

Query: 3   ATENVYRMLIL----------LEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLN 52
           + +N+YRML+L           +   ++S     KK   THEF++EL LP +V E+D LN
Sbjct: 2   SKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEPKK---THEFIEELLLPFEVSELDALN 58

Query: 53  SWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKE 109
            WFDKFDE+ICIPNEGHIKYEISSDGLIVL+LDK IE+++ EV  F++ N   +E E
Sbjct: 59  KWFDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDNQDLNESE 115

>KLLA0C02255g 189083..192571 similar to sp|P53840 Saccharomyces
           cerevisiae YNL273w TOF1 topoisomerase I interacting
           factor 1 singleton, start by similarity
          Length = 1162

 Score = 31.2 bits (69), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 29  QNATHEFVDELP--LPIQVDEMDLLNSWFDKFDEKICI 64
           QNAT  F  E+   LP+   E  L  SWF KF    CI
Sbjct: 462 QNATDSFTSEIQDQLPLHKIEYMLFISWFVKFQRSRCI 499

>Kwal_47.16905
          Length = 420

 Score = 30.8 bits (68), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 48  MDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSF 98
           + +L S FD   +KI IP  G  K  +S++ L +L +    + ++QE+T +
Sbjct: 310 LAILPSTFDVPTQKIAIPLLGVPKKPLSTNPLTLLFIKNCCDLLIQELTPY 360

>CAGL0C02805g 280107..281150 highly similar to tr|Q08726
           Saccharomyces cerevisiae YOR262w, start by similarity
          Length = 347

 Score = 28.5 bits (62), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 37  DELPLPIQVDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVT 96
           D+LP P  VD  D + +  +   E+   PN G + Y I S       LDKSI+  + ++ 
Sbjct: 43  DKLPYPCAVDIRDFI-TLEEIMSEQQLGPN-GGLMYAIES-------LDKSIDMFILQIK 93

Query: 97  SFVEQ 101
           S VEQ
Sbjct: 94  SLVEQ 98

>Kwal_26.8676
          Length = 207

 Score = 27.3 bits (59), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 52  NSWFDK-FDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKEQ 110
             WF+K F +   +   G I   +S    +  I DK IEH++++V        P  EKE+
Sbjct: 154 GKWFNKQFPKNAALRTWGPIGLGLSVVPALPYIFDKPIEHLLEQVFH------PHHEKEE 207

>CAGL0M06215g 645200..646153 similar to sp|P38122 Saccharomyces
           cerevisiae YBR176w ECM31, hypothetical start
          Length = 317

 Score = 26.9 bits (58), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 10/106 (9%)

Query: 9   RMLILLEEPI------SESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKI 62
           R+  L + P+      S++AG TK   +   ++V+  PL +      +  SW  K D  I
Sbjct: 6   RLKCLGKGPLRFYSVHSDTAGATKTILDLQRKYVERKPLTMCTAYDFITASWVQKADTDI 65

Query: 63  CIPNEGHIKYEISSDGLIVLILDKSIEHI----VQEVTSFVEQNVP 104
            +  +      +  D    L LD+   H+      E  SF+  ++P
Sbjct: 66  LLIGDSMGMTSLGYDSTSSLTLDEFKYHVKSVCRAEGPSFIVSDMP 111

>YOR375C (GDH1) [5150] chr15 complement(1041674..1043038) Glutamate
           dehydrogenase (NADP+), combines ammonia and
           alpha-ketoglutarate to form glutamate, reaction is not
           ATP-driven [1365 bp, 454 aa]
          Length = 454

 Score = 26.9 bits (58), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 59  DEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNV 103
           D K CI +E  I  E  +D     +  KS+E IV E ++F E  V
Sbjct: 248 DSKGCIISETGITSEQVADISSAKVNFKSLEQIVNEYSTFSENKV 292

>Kwal_14.1938
          Length = 1964

 Score = 26.9 bits (58), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 58   FDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVT 96
            F+ K CIP  G  K    SD  + ++++  +EH++Q V+
Sbjct: 1694 FEIKSCIPLSGITKLP-QSDHSLKIMMENGVEHVIQAVS 1731

>Sklu_1988.4 YCL044C, Contig c1988 4184-5383 reverse complement
          Length = 399

 Score = 25.8 bits (55), Expect = 9.7,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 83  ILDKSIEHIVQEVTSFVEQNVPESEKEQD 111
           +L K I H  +E+ S VE NV   +K  D
Sbjct: 279 MLTKKISHSEEELRSLVENNVQNRKKAHD 307

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.133    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,954,946
Number of extensions: 172016
Number of successful extensions: 426
Number of sequences better than 10.0: 30
Number of HSP's gapped: 421
Number of HSP's successfully gapped: 30
Length of query: 111
Length of database: 16,596,109
Length adjustment: 81
Effective length of query: 30
Effective length of database: 13,792,051
Effective search space: 413761530
Effective search space used: 413761530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)