Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D01639g38137517540.0
YMR272C (SCS7)38437513170.0
Kwal_27.1033237837313011e-180
AAL183W37737212571e-173
Scas_696.3642637812131e-166
CAGL0F03399g38037711831e-162
CAGL0L03828g121701444e-11
Scas_666.12121701444e-11
Kwal_26.8461123751411e-10
KLLA0F27577g172801371e-09
AFL223W165751352e-09
YNL111C (CYB5)120751322e-09
Kwal_47.18167227571372e-09
KLLA0F23672g123751215e-08
Kwal_23.2823560711243e-07
KLLA0D02640g589541234e-07
ADL085C273781205e-07
Sklu_2258.5580481191e-06
KLLA0B14795g556701182e-06
KLLA0A12111g236671152e-06
Sklu_2444.3564711154e-06
Scas_571.1d609511138e-06
YML054C (CYB2)591611074e-05
CAGL0K03069g194721025e-05
Scas_717.14189731025e-05
Kwal_26.8046198761026e-05
CAGL0K10736g593541057e-05
Scas_571.2602631058e-05
Kwal_14.80757848900.004
CAGL0I00418g49072800.063
KLLA0E18535g14881750.096
Scas_563.649774760.22
Sklu_2299.348072740.39
AAR153C47872730.45
Sklu_2348.333292710.80
Kwal_23.569351346691.6
AAL078W59246691.8
YGL055W (OLE1)51074681.9
KLLA0C05566g47772672.4
KLLA0E19569g57359672.6
AFL079W53857672.6
YMR073C20143644.4
KLLA0C10692g52046646.3
Sklu_2032.352246637.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D01639g
         (375 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D01639g complement(146344..147489) similar to sp|Q03529 Sac...   680   0.0  
YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide ...   511   0.0  
Kwal_27.10332                                                         505   e-180
AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH] complement(137...   488   e-173
Scas_696.36                                                           471   e-166
CAGL0F03399g complement(333955..335097) highly similar to sp|Q03...   460   e-162
CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces c...    60   4e-11
Scas_666.12                                                            60   4e-11
Kwal_26.8461                                                           59   1e-10
KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0 P...    57   1e-09
AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH] complement(...    57   2e-09
YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrom...    55   2e-09
Kwal_47.18167                                                          57   2e-09
KLLA0F23672g 2212223..2212594 some similarities with sp|P40312 S...    51   5e-08
Kwal_23.2823                                                           52   3e-07
KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871....    52   4e-07
ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 2...    51   5e-07
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        50   1e-06
KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces...    50   2e-06
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    49   2e-06
Sklu_2444.3 , Contig c2444 10960-12654                                 49   4e-06
Scas_571.1d                                                            48   8e-06
YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrom...    46   4e-05
CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04...    44   5e-05
Scas_717.14                                                            44   5e-05
Kwal_26.8046                                                           44   6e-05
CAGL0K10736g 1045298..1047079 highly similar to sp|P00175 Saccha...    45   7e-05
Scas_571.2                                                             45   8e-05
Kwal_14.807                                                            39   0.004
CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomy...    35   0.063
KLLA0E18535g 1641507..1641953 some similarities with ca|CA1511|I...    33   0.096
Scas_563.6                                                             34   0.22 
Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement         33   0.39 
AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH] (619953..621...    33   0.45 
Sklu_2348.3 YIL122W, Contig c2348 6408-7406 reverse complement         32   0.80 
Kwal_23.5693                                                           31   1.6  
AAL078W [109] [Homologous to ScYGL055W - NSH] complement(209600....    31   1.8  
YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desatur...    31   1.9  
KLLA0C05566g complement(497877..499310) similar to sp|P21147 Sac...    30   2.4  
KLLA0E19569g complement(1730651..1732372) gi|21104522|dbj|BAB931...    30   2.6  
AFL079W [3114] [Homologous to NOHBY] complement(290134..291750) ...    30   2.6  
YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protei...    29   4.4  
KLLA0C10692g complement(916718..918280) weakly similar to sp|P21...    29   6.3  
Sklu_2032.3 , Contig c2032 4286-5854                                   29   7.7  

>KLLA0D01639g complement(146344..147489) similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide singleton, start by similarity
          Length = 381

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/375 (89%), Positives = 336/375 (89%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD
Sbjct: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60

Query: 61  VMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFV 120
           VMKDVLTHEHSESAYEIMDESYLVGYLA          NKDHVVEVNLKGNNEFDSTVFV
Sbjct: 61  VMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTVFV 120

Query: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180
           KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA
Sbjct: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180

Query: 181 PLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240
           PLFGNFLEPLSKT             TYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL
Sbjct: 181 PLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240

Query: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300
           HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL
Sbjct: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300

Query: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMR                GFGVTSWF
Sbjct: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWF 360

Query: 361 WDKVFGTYLGENAPL 375
           WDKVFGTYLGENAPL
Sbjct: 361 WDKVFGTYLGENAPL 375

>YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide
           hydroxylase that hydroxylates the C-26 fatty-acyl moiety
           of inositol-phosphorylceramide [1155 bp, 384 aa]
          Length = 384

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/375 (66%), Positives = 282/375 (75%), Gaps = 1/375 (0%)

Query: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           ++S+ L L+SK  +++HN  NDCWV+   RKIY+VT FL EHPGG E ILDYAG DIT++
Sbjct: 4   NTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63

Query: 62  MKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGN-NEFDSTVFV 120
           MKD   HEHS+SAYEI+++ YL+GYLA          NK+H VEV L  +  EFDST FV
Sbjct: 64  MKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFV 123

Query: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180
           KELP E+KLSIATDY NDYKKHKFLDLN+PLL Q+L   F KDFY+DQ+HRPRHYGKGSA
Sbjct: 124 KELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSA 183

Query: 181 PLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGL 240
           PLFGNFLEPL+KT              YH+  AL NMNQ FA FLF VGVFVWTLIEYGL
Sbjct: 184 PLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGL 243

Query: 241 HRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALL 300
           HRFLFH DD LPE   AF  HFLLHG HHYLPMD++RLVMPPTLFV+LC PFYKLVFALL
Sbjct: 244 HRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALL 303

Query: 301 PYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWF 360
           P YWA AGFAGG+ GYVCYD  H+FLHHS+LPP+MR                GFGVTSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 361 WDKVFGTYLGENAPL 375
           WD+VFGTYLG +APL
Sbjct: 364 WDEVFGTYLGPDAPL 378

>Kwal_27.10332
          Length = 378

 Score =  505 bits (1301), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 243/373 (65%), Positives = 286/373 (76%), Gaps = 2/373 (0%)

Query: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVM 62
            ++ LPLYS + +++HN  +DCWV+L  RKIY+VT+FL++HPGG + I++YAG DIT+VM
Sbjct: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61

Query: 63  KDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFVKE 122
           KD   H HS  AYE++DE Y VGYLA          N  H VEV L+  +E+DSTVFV E
Sbjct: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE--DEYDSTVFVPE 119

Query: 123 LPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPL 182
           +P E+KLSI TDY  DY +HKFLDLN+PLL Q+L   FTK+FYLDQVHRPRHYG+GSAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 183 FGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHR 242
           FGNFLEPLSKT              YHI+TA+ NMN+ FA+FLF VG+FVWTLIEYG+HR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 243 FLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPY 302
           FLFHLD  LP  Q A+T+HFLLHGVHHYLPMDR+RLVMPPTLF++LCTPFYKLVFALLPY
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 303 YWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWD 362
           YWACAGFAGGMLGYVCYDLTHYFLHH++LP  ++                GFGVTSW WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 363 KVFGTYLGENAPL 375
           KVFGTYL ENAPL
Sbjct: 360 KVFGTYLAENAPL 372

>AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH]
           complement(13713..14846) [1134 bp, 377 aa]
          Length = 377

 Score =  488 bits (1257), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/372 (63%), Positives = 273/372 (73%), Gaps = 3/372 (0%)

Query: 4   SRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMK 63
           S+ LPLYSK  L+KH D+  CWVS+  RKIY+V++FLDEHPGG +YILDYAG DIT V+K
Sbjct: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLK 62

Query: 64  DVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTVFVKEL 123
           D L HEH+E+AYEI+DESYLVGYLA          N+ HV+EV        D+T FVKEL
Sbjct: 63  DKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVT---PENLDTTTFVKEL 119

Query: 124 PTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPLF 183
           P E+ LS+ATD+  DY KH FLDLNKPLL QVL G FT+DFY+DQ+HRPRHYGKGSAPLF
Sbjct: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179

Query: 184 GNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHRF 243
           GNFLEPLSKT              Y++  AL NM    A+  FA GVFVWTLIEY LHRF
Sbjct: 180 GNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRF 239

Query: 244 LFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPYY 303
           LFH DD +PE   AFT+HFLLHGVHHYLPMD++RLVMPP LFVVLC PFY+LVF++ P Y
Sbjct: 240 LFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 299

Query: 304 WACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTSWFWDK 363
            AC  FAGG+ GYVCYD+THYFLHH +LPP+MR                GFGVTSW+WDK
Sbjct: 300 CACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDK 359

Query: 364 VFGTYLGENAPL 375
           VFGTYL  N+P+
Sbjct: 360 VFGTYLASNSPV 371

>Scas_696.36
          Length = 426

 Score =  471 bits (1213), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 227/378 (60%), Positives = 275/378 (72%), Gaps = 7/378 (1%)

Query: 1   MSS--SRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDI 58
           MSS  S+ L L+SK  + KHN + DCWV++Y RKIY+V++FL +HP G + IL +AG DI
Sbjct: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106

Query: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNL-KGNNEFDST 117
           T+++KD    E  +   +++D+ YL+GY+A          NKDH VEV L +  N FDST
Sbjct: 107 TELLKD----EKIDQQTDLLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162

Query: 118 VFVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGK 177
            FVK+LPTEDKLSIATDY+ D KKH FLDLNKPLL Q+LFG FTKDFYLDQ+HRPRHYG+
Sbjct: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222

Query: 178 GSAPLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIE 237
            SAPLFGNFLEP +KT              YHI  A  N+N  FAI LF +GV+VWT IE
Sbjct: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282

Query: 238 YGLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVF 297
           Y +HRFLFH D+RLPE  +A+ +HFLLHG HHYLPMD++RLV+PP LF+ LC PFYKLVF
Sbjct: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342

Query: 298 ALLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVT 357
           ALLPYYWACAGFAGGM GY+CYDL HYFLHHS+LPP+MR                G+GVT
Sbjct: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVT 402

Query: 358 SWFWDKVFGTYLGENAPL 375
           SW+WDK FGTYL  ++PL
Sbjct: 403 SWYWDKKFGTYLSPDSPL 420

>CAGL0F03399g complement(333955..335097) highly similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide, hypothetical start
          Length = 380

 Score =  460 bits (1183), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 231/377 (61%), Positives = 268/377 (71%), Gaps = 13/377 (3%)

Query: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYI---LDYA-GTDI 58
           SS+ L L+ ++ L KHN K+DCWVS ++RKIY+V+++L +HP  A+ +   LD   GTDI
Sbjct: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66

Query: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLAXXXXXXXXXXNKDHVVEVNLKGNNEFDSTV 118
           + +    L         + + + YLVGYLA          NK H VEV L  +N FDST 
Sbjct: 67  SQMELTTL---------KFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTT 117

Query: 119 FVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKG 178
           FVK+LPTEDKLSI TDY+ DYKKHKFLDLNKPLL Q+LFG FTKDFYLDQ+HRPRHYGKG
Sbjct: 118 FVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKG 177

Query: 179 SAPLFGNFLEPLSKTXXXXXXXXXXXXXTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEY 238
           SAPLFGNFLE  +KT              Y I TALMNMN   A+FLF +G+FVWTLIEY
Sbjct: 178 SAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEY 237

Query: 239 GLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFA 298
            LHRFLFH D+ LPE    F +HFLLHG HHYLPMD +RLV+PP LFVVLC P YKLVFA
Sbjct: 238 CLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFA 297

Query: 299 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRXXXXXXXXXXXXXXXXGFGVTS 358
            LPYYWACAGFAGGMLGY+CYDL HYFLHHS++PP+MR                GFGVTS
Sbjct: 298 ALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTS 357

Query: 359 WFWDKVFGTYLGENAPL 375
           WFWDKVFGTYLG +APL
Sbjct: 358 WFWDKVFGTYLGPDAPL 374

>CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces
          cerevisiae YNL111c CYB5, start by similarity
          Length = 121

 Score = 60.1 bits (144), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 4/70 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +Y+   + +HN + DCW+ +    +Y+V++FLDEHPGG E I ++ GTD T    D+   
Sbjct: 4  VYTYKQVSEHNKEGDCWI-IIDGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDI--- 59

Query: 69 EHSESAYEIM 78
           HS+ A +I+
Sbjct: 60 GHSDDALKIL 69

>Scas_666.12
          Length = 121

 Score = 60.1 bits (144), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +YS   + +HN  +D W+ + + K+Y+V++FLDEHPGG E I + AG D T+   D+   
Sbjct: 4  VYSYQQIAEHNKPDDAWI-IIEGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDI--- 59

Query: 69 EHSESAYEIM 78
           HS+ A +I+
Sbjct: 60 GHSDDALQIL 69

>Kwal_26.8461
          Length = 123

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          LYS  ++ +HN + D W+ +   K+Y+ T+F+DEHPGG E ++D  G D T    D+   
Sbjct: 4  LYSYKEIAEHNTEKDLWM-IIDGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A +++ + Y+
Sbjct: 60 GHSDDAVKMLADLYV 74

>KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0
          Petunia hybrida Cytochrome b5 DIF-F, hypothetical start
          Length = 172

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 49/80 (61%), Gaps = 3/80 (3%)

Query: 8  PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLT 67
          PL +  ++ +H+ ++DCW  ++  K+Y++T FL +HPGGA+ +L YAG D T +  D + 
Sbjct: 4  PLITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLKYAGKDST-LQFDDIG 61

Query: 68 HEHSESAYEIMDESYLVGYL 87
          H     AY+ +D   L G L
Sbjct: 62 HSMESLAYD-LDPGALKGTL 80

>AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH]
           complement(19601..20098) [498 bp, 165 aa]
          Length = 165

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 4/75 (5%)

Query: 9   LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
           LY+  ++ +HN +ND W+ +   K+Y+ T+F +EHPGG E ++D AG D T+   D+   
Sbjct: 43  LYTYQEIAEHNSENDLWL-IINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADI--- 98

Query: 69  EHSESAYEIMDESYL 83
            HS+ A ++++  Y+
Sbjct: 99  GHSDDAVKMLEGLYV 113

>YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrome
          b5 [363 bp, 120 aa]
          Length = 120

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          +YS  ++ +HN   + W+ +   K+Y+V++F DEHPGG E I+D  G D T+   D+   
Sbjct: 4  VYSYQEVAEHNGPENFWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A  ++   Y+
Sbjct: 60 GHSDEALRLLKGLYI 74

>Kwal_47.18167
          Length = 227

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 3  SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDIT 59
          +S  LP  S  ++  H D +DCW+S++  K+Y+V+ +L +HPGGA+ +L  AG D T
Sbjct: 27 TSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>KLLA0F23672g 2212223..2212594 some similarities with sp|P40312
          Saccharomyces cerevisiae YNL111c CYB5 cytochrome b5
          singleton, hypothetical start
          Length = 123

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 9  LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTH 68
          L +  ++ +H   +D W+ +   K+Y+ T+F+DEHPGG E ++D  G D T   +D+   
Sbjct: 4  LLTYKEVSEHKTVDDLWM-IIDGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDI--- 59

Query: 69 EHSESAYEIMDESYL 83
           HS+ A ++++  Y+
Sbjct: 60 GHSDDAIKLLEPMYV 74

>Kwal_23.2823
          Length = 560

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 6/71 (8%)

Query: 18  HNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEI 77
           HN  NDCW+ L   ++Y+VT F+  HPGG + IL+ AG+D T+    +    HSE     
Sbjct: 89  HNKLNDCWIVLND-EVYDVTSFIAAHPGGVQRILEVAGSDATEKFYQI----HSEDVLNK 143

Query: 78  MDESYL-VGYL 87
           M E  + VG L
Sbjct: 144 MKEKLVYVGKL 154

>KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871.1
           Kluyveromyces lactis cytochrome b2, start by similarity
          Length = 589

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 8   PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           P  S T++ KH+   DCWV + +  +YN+T+F+  HPGG   I + AG D+T +
Sbjct: 88  PKVSPTEVAKHSSPKDCWV-VIEGYVYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 273
           aa]
          Length = 273

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 6   ILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDV 65
           +L   S  ++ +H  ++DCW  ++ R +Y++T  L+ HPGG + +L YAG D T    DV
Sbjct: 89  LLRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDATLPFDDV 147

Query: 66  LTHEHSESAYEIMDESYL 83
             H      Y++   SYL
Sbjct: 148 -GHSMESLIYDMAPGSYL 164

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 14  DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           D+ KHND  DCWV +    +Y++TEF+  HPGG   I + AG D+T +
Sbjct: 85  DVAKHNDPKDCWV-VIDGYVYDLTEFIHSHPGGPTIIENNAGKDVTAI 131

>KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces
           cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
           b2 singleton, start by similarity
          Length = 556

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 5/70 (7%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEH 70
           S  +++ HN  +DCW+ +   ++Y++T+FL +HPGG   ++++AG D T+    +    H
Sbjct: 82  SVKEVKMHNRIDDCWI-VIDNEVYDITKFLSQHPGGVARLMEFAGRDATERFYQM----H 136

Query: 71  SESAYEIMDE 80
           S +  E M E
Sbjct: 137 SSATLEKMKE 146

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 5/67 (7%)

Query: 14  DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSES 73
           +++ HN  +DCW+ +    +Y++T FL +HPGG   ++++AG D T+    +    HS +
Sbjct: 85  EVKSHNRIDDCWI-VIDGDVYDITGFLSKHPGGVTRLMEFAGRDATERFHQM----HSSA 139

Query: 74  AYEIMDE 80
             E M E
Sbjct: 140 MLEKMKE 146

>Sklu_2444.3 , Contig c2444 10960-12654
          Length = 564

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 18  HNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEI 77
           HN+ +DCW+ L    +Y++TEF+  HPGGA  +++ AG D T+    +    HS+   E 
Sbjct: 96  HNNIDDCWIVL-NGDVYDITEFIKIHPGGAARLMEVAGRDATEKFHMI----HSDEVLEK 150

Query: 78  MDE-SYLVGYL 87
           M E   LVG L
Sbjct: 151 MKEYITLVGKL 161

>Scas_571.1d
          Length = 609

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           S  ++ KHN +NDCW+ +   ++Y++T F+  HPGG++ I   AG D++ +
Sbjct: 96  STDEVTKHNSENDCWI-VINGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAI 145

>YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrome
           b2 [L-(+)-lactate cytochrome c oxidoreductase],
           catalyzes the conversion of L-lactate to pyruvate [1776
           bp, 591 aa]
          Length = 591

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60
           M+  +I P     ++ KHN  +DCWV +    +Y++T FL  HPGG + I   AG D+T 
Sbjct: 86  MNKQKISP----AEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTA 140

Query: 61  V 61
           +
Sbjct: 141 I 141

>CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04772
           Saccharomyces cerevisiae YMR073c, hypothetical start
          Length = 194

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 14  DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSES 73
           +L +HN   DCW ++   K+Y+++ +L  HPGGA+ ++D +    + V+       H   
Sbjct: 123 ELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDSTVL---FNRYHRWI 178

Query: 74  AYEIMDESYLVG 85
           + E M E+ LVG
Sbjct: 179 SVEKMLETCLVG 190

>Scas_717.14
          Length = 189

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 45/73 (61%), Gaps = 8/73 (10%)

Query: 15  LEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYIL-DYAGTDITDVMKDVLTHE-HSE 72
           L++H  + DCW ++Y+ K+Y V+++L+ HPGG + I  + AG D T     VL ++ HS 
Sbjct: 118 LQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDST-----VLFNQYHSW 171

Query: 73  SAYEIMDESYLVG 85
              E + E+ L+G
Sbjct: 172 VNAEKLLETCLIG 184

>Kwal_26.8046
          Length = 198

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 11  SKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILD-YAGTDITDVMKDVLTHE 69
           +K  L +H    DCW  + Q K+Y ++ +LD HPGG + ++   AG D T     +    
Sbjct: 124 NKAQLAQHKAPEDCWCVINQ-KVYCISSYLDFHPGGVDILMKGAAGKDCT----SMFNKY 178

Query: 70  HSESAYEIMDESYLVG 85
           H    YE + E+ LVG
Sbjct: 179 HRWVNYEKVLETSLVG 194

>CAGL0K10736g 1045298..1047079 highly similar to sp|P00175
           Saccharomyces cerevisiae YML054c CYB2 lactate
           dehydrogenase cytochrome b2, hypothetical start
          Length = 593

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 8   PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           P  S +++ KHN   DCWV +    +Y++T F+  HPGG + I   AG D+T +
Sbjct: 88  PKISPSEVIKHNTPEDCWV-VIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>Scas_571.2
          Length = 602

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 1   MSSSRILP--LYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDI 58
            + S++ P  +   +++ +HN   DCW+ +    +Y++T F+  HPGGA+ I   AG D+
Sbjct: 78  QNESKLAPKRVIDPSEVARHNTPADCWI-VINGVVYDLTSFIPVHPGGADIIKSNAGKDV 136

Query: 59  TDV 61
           T +
Sbjct: 137 TAI 139

>Kwal_14.807
          Length = 578

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 14  DLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61
           ++ KH+  +DCWV +    +Y++++F+  HPGG   I   AG D++ +
Sbjct: 83  EVAKHSKPDDCWV-VINGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomyces
           cerevisiae YGL055w OLE1 stearoyl-CoA desaturase, start
           by similarity
          Length = 490

 Score = 35.4 bits (80), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP ++K +  + N +ND  V +    +++V+ ++ EHPGG + + +  G D T      +
Sbjct: 386 LPAWTKEEFLEKNRENDGLV-IVGGIVHDVSGYITEHPGGEKLLKNALGKDATKAFSGGV 444

Query: 67  THEHSESAYEIM 78
            + HS +A+  +
Sbjct: 445 -YRHSNAAHNTL 455

>KLLA0E18535g 1641507..1641953 some similarities with
           ca|CA1511|IPF9972.3eoc Candida albicans unknown
           function, 3-prime end, hypothetical start
          Length = 148

 Score = 33.5 bits (75), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

Query: 5   RILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKD 64
           RI P           +K++ W  +  RK+Y +  +L  HPGG   +   AG D+T     
Sbjct: 65  RIQPPLRVNKEALKANKDNFWC-VINRKVYCIKAYLSYHPGGEVILKQCAGKDVT----S 119

Query: 65  VLTHEHSESAYEIMDESYLVG 85
           +    H    YE + E+  +G
Sbjct: 120 LFNKYHRWVNYERLLETCFIG 140

>Scas_563.6
          Length = 497

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K +  +    N   V +    I++++ ++ EHPGG   I    G D T   +  +
Sbjct: 396 LPVWDKKEFVEQAQLNKNLVVI-SGIIHDISNYIPEHPGGESLIKQALGKDATRAFQGGV 454

Query: 67  THEHSESAYEIMDE 80
            + HS +A  ++ E
Sbjct: 455 -YRHSTAAQNVLSE 467

>Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement
          Length = 480

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K +  K    N   V +    +++V+ ++ EHPGG   I   AG D T      +
Sbjct: 379 LPVWDKEEFMKSLKSNPGLV-IVSGIVHDVSGYITEHPGGETLIQAAAGKDATKAFNGGV 437

Query: 67  THEHSESAYEIM 78
            + HS +A+ ++
Sbjct: 438 -YLHSNAAHNVL 448

>AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH]
           (619953..621389) [1437 bp, 478 aa]
          Length = 478

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ +++  + + +N   V +    +++V+ ++ EHPGG   I    G D T      +
Sbjct: 378 LPVWDRSEFVRASRENSGLVVI-SGIVHDVSGYITEHPGGETLIQAALGKDATRAFNGGV 436

Query: 67  THEHSESAYEIM 78
            + HS +A+ I+
Sbjct: 437 -YMHSNAAHNIL 447

>Sklu_2348.3 YIL122W, Contig c2348 6408-7406 reverse complement
          Length = 332

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 34  YNVTEFLDEHPGGAEYI-LDYAGTDITDVMKDVLTHEHSESAYEIMDESYLVGYLAXXXX 92
           YNV +   +  G AE I +DY    + D+  ++      + A E+MDES L+ Y++    
Sbjct: 16  YNVEDVPKDKEGSAETIKMDYKARILEDMGLEI------DDATELMDESLLIEYISFKKE 69

Query: 93  XXXXXXNKDHVVEVNLKGNNEFDSTVFVKELP 124
                   +H+ ++NL   NE  S +     P
Sbjct: 70  QEKRET--EHLKQLNLLKVNEILSKLVQTNFP 99

>Kwal_23.5693
          Length = 513

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 33  IYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEIM 78
           +++VT F+ +HPGG   +    G D T      + + HS++A  ++
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAFNGAV-YSHSQAARNLL 454

>AAL078W [109] [Homologous to ScYGL055W - NSH]
           complement(209600..211378) [1779 bp, 592 aa]
          Length = 592

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 33  IYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEIM 78
           I++VT F+ +HPGG   ++   G D T      + + HS +A  ++
Sbjct: 496 IHDVTPFMHDHPGGMALVVASVGKDATPAFNGAV-YAHSTAARNLL 540

>YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desaturase
           (delta-9 fatty acid desaturase), required for synthesis
           of unsaturated fatty acids [1533 bp, 510 aa]
          Length = 510

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K      + +N   V +    +++V+ ++ EHPGG   I    G D T      +
Sbjct: 409 LPMWDKQTFLAKSKENKGLV-IISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGGV 467

Query: 67  THEHSESAYEIMDE 80
            + HS +A  ++ +
Sbjct: 468 -YRHSNAAQNVLAD 480

>KLLA0C05566g complement(497877..499310) similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, start by similarity
          Length = 477

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 7   LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVL 66
           LP++ K +  +    N+  V +    +++V+ ++ EHPGG   I    G D T      +
Sbjct: 379 LPVWDKDEFMEKLKSNNGLVVI-SGIVHDVSGYITEHPGGETLIQASLGKDATKAFNGGV 437

Query: 67  THEHSESAYEIM 78
            + HS +A+ I+
Sbjct: 438 -YLHSNAAHNIL 448

>KLLA0E19569g complement(1730651..1732372)
          gi|21104522|dbj|BAB93118.1 Kluyveromyces lactis
          putative delta 8-sphingolipid desaturase, start by
          similarity
          Length = 573

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 4  SRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVM 62
          SR+L   S+ D+     K    + +Y+  + N+ +++  HPGG + I    G D TD M
Sbjct: 2  SRVL---SRRDIADRIAKGQT-IVIYEDSVLNLDKWIKFHPGGDKSIYHMIGRDATDEM 56

>AFL079W [3114] [Homologous to NOHBY] complement(290134..291750)
          [1617 bp, 538 aa]
          Length = 538

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 7  LPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMK 63
          + + SK+++E+     +  + +Y+  +  + +++  HPGG + I    G D TD M 
Sbjct: 1  MAVLSKSEVEERIANGEV-IVIYKSAVLKLDKWIKYHPGGDKAIYHMVGRDATDEMN 56

>YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protein
           containing a heme-binding domain, has a region of
           moderate similarity to a region of flavohemoprotein
           b5+b5R (human b5&b5R), which is an NAD(P)H
           oxidoreductase that may act as an oxygen sensor [606 bp,
           201 aa]
          Length = 201

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 11/43 (25%), Positives = 24/43 (55%)

Query: 15  LEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTD 57
           ++KH    D    +   K+Y+++ +L  HPGG + ++ +  +D
Sbjct: 130 VKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

>KLLA0C10692g complement(916718..918280) weakly similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, hypothetical start
          Length = 520

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 33  IYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEIM 78
           +++VT F+ +HPGG   +    G D T      + + HS +A  ++
Sbjct: 417 VHDVTPFIYDHPGGVTLVETSIGKDATQAFNGAV-YRHSNAARNLL 461

>Sklu_2032.3 , Contig c2032 4286-5854
          Length = 522

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 33  IYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLTHEHSESAYEIM 78
           +++VT F+ +HPGG   +    G D T      + + HS +A  ++
Sbjct: 419 VHDVTPFIYDHPGGVTLVETSIGKDATAAFNGAV-YSHSRAARNLL 463

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.142    0.463 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,550,976
Number of extensions: 539032
Number of successful extensions: 1555
Number of sequences better than 10.0: 47
Number of HSP's gapped: 1555
Number of HSP's successfully gapped: 47
Length of query: 375
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 272
Effective length of database: 13,030,455
Effective search space: 3544283760
Effective search space used: 3544283760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)