Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0D00462g59558630130.0
Kwal_14.241559758713680.0
YOR386W (PHR1)56558512691e-169
KLLA0D05467g75582721.1
KLLA0C07843g79448711.7
Sklu_2075.334597666.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D00462g
         (586 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D00462g 41415..43202 similar to sp|P05066 Saccharomyces cer...  1165   0.0  
Kwal_14.2415                                                          531   0.0  
YOR386W (PHR1) [5159] chr15 (1066835..1068532) Deoxyribodipyrimi...   493   e-169
KLLA0D05467g complement(471053..473320) highly similar to sp|P25...    32   1.1  
KLLA0C07843g complement(688312..690696) similar to sp|P32844 Sac...    32   1.7  
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                30   6.1  

>KLLA0D00462g 41415..43202 similar to sp|P05066 Saccharomyces
           cerevisiae YOR386w PHR1 deoxyribodipyrimidine
           photo-lyase singleton, hypothetical start
          Length = 595

 Score = 1165 bits (3013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/586 (96%), Positives = 563/586 (96%)

Query: 1   MRVGNSNSIKKNVSECLSPNPVYYRNPITFKKANEFNNGKRERPLALLGDSIHADSKNSR 60
           MRVGNSNSIKKNVSECLSPNPVYYRNPITFKKANEFNNGKRERPLALLGDSIHADSKNSR
Sbjct: 1   MRVGNSNSIKKNVSECLSPNPVYYRNPITFKKANEFNNGKRERPLALLGDSIHADSKNSR 60

Query: 61  QQLDDTVDNRLVIHWFRGDLRVRDNTGLAYALNQSKSGSVEALYVINEHDWIAHMESGWK 120
           QQLDDTVDNRLVIHWFRGDLRVRDNTGLAYALNQSKSGSVEALYVINEHDWIAHMESGWK
Sbjct: 61  QQLDDTVDNRLVIHWFRGDLRVRDNTGLAYALNQSKSGSVEALYVINEHDWIAHMESGWK 120

Query: 121 LKFQLDALRSLSRELAKLGVRLHVKYFIPESPCLSNSREYAQWFSHIIEEIAASKNYDGN 180
           LKFQLDALRSLSRELAKLGVRLHVKYFIPESPCLSNSREYAQWFSHIIEEIAASKNYDGN
Sbjct: 121 LKFQLDALRSLSRELAKLGVRLHVKYFIPESPCLSNSREYAQWFSHIIEEIAASKNYDGN 180

Query: 181 SXXXXXXXXXXXEPALKKRKKDNDENQKGGSPNILVTANLQYEVDELYRDLKICRLQTQS 240
           S           EPALKKRKKDNDENQKGGSPNILVTANLQYEVDELYRDLKICRLQTQS
Sbjct: 181 SKDDTKDDTDADEPALKKRKKDNDENQKGGSPNILVTANLQYEVDELYRDLKICRLQTQS 240

Query: 241 SNSANFTLKLFHDMCIIEPGILKTGKGSQYTIFTPWYKKWVSFLEANQKDKHTICIEASI 300
           SNSANFTLKLFHDMCIIEPGILKTGKGSQYTIFTPWYKKWVSFLEANQKDKHTICIEASI
Sbjct: 241 SNSANFTLKLFHDMCIIEPGILKTGKGSQYTIFTPWYKKWVSFLEANQKDKHTICIEASI 300

Query: 301 PQSSNREKVNPEEIKYQLPDKFMSEMPEQTLNIPKADEETALKKLTEFISKRASKYNNDK 360
           PQSSNREKVNPEEIKYQLPDKFMSEMPEQTLNIPKADEETALKKLTEFISKRASKYNNDK
Sbjct: 301 PQSSNREKVNPEEIKYQLPDKFMSEMPEQTLNIPKADEETALKKLTEFISKRASKYNNDK 360

Query: 361 XXXXXXXXXXXXCYVTSGVISARTILNQSYQANNSRLMNKDIKKNNSLETFIKEVAWRDF 420
                       CYVTSGVISARTILNQSYQANNSRLMNKDIKKNNSLETFIKEVAWRDF
Sbjct: 361 DLLDLTGTSLLSCYVTSGVISARTILNQSYQANNSRLMNKDIKKNNSLETFIKEVAWRDF 420

Query: 421 YKHAISYWPFLSMDLPFKFETLNIKWENDVFLFEKWCYGETGIPIVDAIMLKMLKTGYIN 480
           YKHAISYWPFLSMDLPFKFETLNIKWENDVFLFEKWCYGETGIPIVDAIMLKMLKTGYIN
Sbjct: 421 YKHAISYWPFLSMDLPFKFETLNIKWENDVFLFEKWCYGETGIPIVDAIMLKMLKTGYIN 480

Query: 481 NRSRMITASFLAKNLLIDWRWGERWFRKHLIDYDTASNVGGWGFCASTGIDCQPYFRVFN 540
           NRSRMITASFLAKNLLIDWRWGERWFRKHLIDYDTASNVGGWGFCASTGIDCQPYFRVFN
Sbjct: 481 NRSRMITASFLAKNLLIDWRWGERWFRKHLIDYDTASNVGGWGFCASTGIDCQPYFRVFN 540

Query: 541 MKLQSEKYDPEGKFIRHWLENDENDSDNVHEPKPNAIVDLRDSRER 586
           MKLQSEKYDPEGKFIRHWLENDENDSDNVHEPKPNAIVDLRDSRER
Sbjct: 541 MKLQSEKYDPEGKFIRHWLENDENDSDNVHEPKPNAIVDLRDSRER 586

>Kwal_14.2415
          Length = 597

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/587 (47%), Positives = 357/587 (60%), Gaps = 74/587 (12%)

Query: 23  YYRNPITFKKANEFNNGKRERPLALLGDSIHADSKNSRQQLDDTVDNRLVIHWFRGDLRV 82
           YY  PIT+K+A+EFNNGKR +P+ LL D I       +Q L        VIHWFR DLRV
Sbjct: 53  YYPKPITWKQAHEFNNGKRTKPITLLDDYI------KKQALPAGFKVSTVIHWFRTDLRV 106

Query: 83  RDNTGLAYALNQSK-------SGSVEALYVINEHDWIAHMESGWKLKFQLDALRSLSREL 135
            DN GL  A+ Q K          + ALY INEHDW AH++SGWKL F L+A+ SL ++L
Sbjct: 107 HDNVGLYNAVQQVKKAKKSNPQAQLIALYTINEHDWRAHLDSGWKLTFALNAVESLRKKL 166

Query: 136 AKLGVRLHVKYFIPESPCLSNSREYAQWFSHIIEEIAASKNYDGNSXXXXXXXXXXXEPA 195
             + V L ++ F  E P LS S +YA WF      I+                       
Sbjct: 167 ESMNVSLILRVFQSEEPLLSCSAKYADWFKEQCLSISQG--------------------- 205

Query: 196 LKKRKKDNDENQKGGSPNILVTANLQYEVDELYRDLKICRLQTQSSNSANFTLKLFHDMC 255
                            ++LV AN QYE DELYRD K+C+ Q        F  +++HD C
Sbjct: 206 -----------------SVLVAANAQYESDELYRDWKLCKRQDN-----RFQFQVYHDQC 243

Query: 256 IIEPGILKTGKGSQYTIFTPWYKKWVSFLEANQKDKHTICIEASIPQSSNREKVNPEEIK 315
            ++PG L TGKGSQYT+FTPWYKKWV +L  +QK K  + ++  I  S ++    P  ++
Sbjct: 244 TVQPGSLTTGKGSQYTVFTPWYKKWVEYLTTHQKGKDVVKMQ--IIDSDDKINEKPSTLQ 301

Query: 316 ---YQLPDKFMSEMPEQTLNI-PKADEETALKKLTEFISK-RASKYNNDKXXXXXXXXXX 370
              Y L  +F++ +P +   + P A EE A + L +FI K  A +YN  K          
Sbjct: 302 SDDYTLAKEFVANLPAEISELLPPATEENAHQILDDFIKKGDAKQYNEKKDIIPLDSTSH 361

Query: 371 XXCYVTSGVISARTILNQSYQANNSRLMNKDIKKNNSLETFIKEVAWRDFYKHAISYWPF 430
             CY+TSG+IS R ++N+ +  N   LM KDI++NNS+E FIKEVAWRDFYKH    WP+
Sbjct: 362 LSCYITSGLISTRAVVNRGFHENGDSLMRKDIRQNNSMENFIKEVAWRDFYKHVACNWPY 421

Query: 431 LSMDLPFKFETLNIKWENDVFLFEKWCYGETGIPIVDAIMLKMLKTGYINNRSRMITASF 490
           +SM++  KFET++IKW ND  +F KWC GETG+PIVDAIM K+L TGYINNRSRMI ASF
Sbjct: 422 MSMEIAIKFETMDIKWVNDEEMFRKWCMGETGLPIVDAIMRKLLYTGYINNRSRMIVASF 481

Query: 491 LAKNLLIDWRWGERWFRKHLIDYDTASNVGGWGFCASTGIDCQPYFRVFNMKLQSEKYDP 550
           L+KNLL+DWRWGERWFRKHL+D D  SN GGWGFC+STGID QPYFR+FNMKLQSEKYDP
Sbjct: 482 LSKNLLVDWRWGERWFRKHLMDADLTSNSGGWGFCSSTGIDAQPYFRIFNMKLQSEKYDP 541

Query: 551 EGKFIRHWLENDENDSDN-------VHEPK----PNAIVDLRDSRER 586
           +G F++ W+    N +D         ++P     P  IVDL++SRE+
Sbjct: 542 KGAFVKEWIPELRNINDVKILREGLANQPSVNGYPKPIVDLKESREK 588

>YOR386W (PHR1) [5159] chr15 (1066835..1068532)
           Deoxyribodipyrimidine photolyase, involved in
           light-dependent repair of pyrimidine dimers [1698 bp,
           565 aa]
          Length = 565

 Score =  493 bits (1269), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 254/585 (43%), Positives = 355/585 (60%), Gaps = 56/585 (9%)

Query: 9   IKKNVSECLSPNPVYYRNPITFKKANEFNNGKRERPLALLGDSIHADSKNSRQQLDDTVD 68
           I+ +  +  S N  YY  PIT   AN+FNN  R +P+ ++ + +    K S + +     
Sbjct: 21  IEHDFEQYHSLNKKYYPRPITRTGANQFNNKSRAKPMEIV-EKLQKKQKTSFENVST--- 76

Query: 69  NRLVIHWFRGDLRVRDNTGL--AYALNQ-----SKSGSVEALYVINEHDWIAHMESGWKL 121
              V+HWFR DLR+ DN GL  + AL Q     +    + A+YVINE DW AHM+SGWKL
Sbjct: 77  ---VMHWFRNDLRLYDNVGLYKSVALFQQLRQKNAKAKLYAVYVINEDDWRAHMDSGWKL 133

Query: 122 KFQLDALRSLSRELAKLGVRLHVKYFIPESPCLSNSREYAQWFSHIIEEIAASKNYDGNS 181
            F + AL++L + LA+L + L +  F      LSNS+E+ ++F                 
Sbjct: 134 MFIMGALKNLQQSLAELHIPLLLWEFHTPKSTLSNSKEFVEFF----------------- 176

Query: 182 XXXXXXXXXXXEPALKKRKKDNDENQKGGSPNILVTANLQYEVDELYRDLKICRLQTQSS 241
                              K+   N   G+  I +TAN++Y+ DELYRD+++       +
Sbjct: 177 -------------------KEKCMNVSSGTGTI-ITANIEYQTDELYRDIRLLE-----N 211

Query: 242 NSANFTLKLFHDMCIIEPGILKTGKGSQYTIFTPWYKKWVSFLEANQKDKHTICIEASIP 301
                 LK +HD CI+ PG++ T +G+ Y++FTPWYKKWV ++   +K    IC    I 
Sbjct: 212 EDHRLQLKYYHDSCIVAPGLITTDRGTNYSVFTPWYKKWVLYVNNYKKSTSEICHLHIIE 271

Query: 302 QSSNREKVNPEEIKYQLPDKFMSEMPEQTLNIPKADEETALKKLTEFISKRASKYNNDKX 361
                E    +  +Y LPD+F+  +P+    +P   EE AL +L +F+  ++SKYNN+K 
Sbjct: 272 PLKYNETFELKPFQYSLPDEFLQYIPKSKWCLPDVSEEAALSRLKDFLGTKSSKYNNEKD 331

Query: 362 XXXXXXXXXXXCYVTSGVISARTILNQSYQANNSRLMNKDIKKNNSLETFIKEVAWRDFY 421
                       Y+T+G IS R I+NQ++Q+ N ++M+K +K N+S + FIKEVAWRDFY
Sbjct: 332 MLYLGGTSGLSVYITTGRISTRLIVNQAFQSCNGQIMSKALKDNSSTQNFIKEVAWRDFY 391

Query: 422 KHAISYWPFLSMDLPFKFETLNIKWENDVFLFEKWCYGETGIPIVDAIMLKMLKTGYINN 481
           +H +  WP+ SM +P++ +TL+IKWEN+   FEKWC G TGIPIVDAIM K+L TGYINN
Sbjct: 392 RHCMCNWPYTSMGMPYRLDTLDIKWENNPVAFEKWCTGNTGIPIVDAIMRKLLYTGYINN 451

Query: 482 RSRMITASFLAKNLLIDWRWGERWFRKHLIDYDTASNVGGWGFCASTGIDCQPYFRVFNM 541
           RSRMITASFL+KNLLIDWRWGERWF KHLID D++SNVGGWGFC+STGID QPYFRVFNM
Sbjct: 452 RSRMITASFLSKNLLIDWRWGERWFMKHLIDGDSSSNVGGWGFCSSTGIDAQPYFRVFNM 511

Query: 542 KLQSEKYDPEGKFIRHWLENDENDSDNVHEPKPNAIVDLRDSRER 586
            +Q++KYDP+  F++ W+    +  +   E  P  +VDL+ SRER
Sbjct: 512 DIQAKKYDPQMIFVKQWVPELISSENKRPENYPKPLVDLKHSRER 556

>KLLA0D05467g complement(471053..473320) highly similar to sp|P25039
           Saccharomyces cerevisiae YLR069c MEF1 translation
           elongation factor G, mitochondrial, start by similarity
          Length = 755

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 32/82 (39%), Gaps = 14/82 (17%)

Query: 451 FLFEKWCYGETGIPIVDAIMLKMLKTGYINNRSRMITASFLAKNLLIDWRWGERWFRKHL 510
           F  E+  YG+  +  +     KM K GYI N           K + I      R  R H 
Sbjct: 375 FKLEEGKYGQ--LTYIRVYQGKMRKGGYITNVK-------TGKKVKIS-----RLVRMHS 420

Query: 511 IDYDTASNVGGWGFCASTGIDC 532
            D +    VG    CA+ GIDC
Sbjct: 421 NDMEDVDEVGAGEICATFGIDC 442

>KLLA0C07843g complement(688312..690696) similar to sp|P32844
           Saccharomyces cerevisiae YIL068c SEC6 protein transport
           protein singleton, start by similarity
          Length = 794

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 7   NSIKKNVSECLSPNPVYYRNPITFKKANEFNNGKRERPLALLGDSIHA 54
            +I   + +C+  N  Y  NP +F K NEF  G  E  +A+  D + A
Sbjct: 506 QTINDQLEKCIEFNHRYEMNPESFTKENEFPGGLVEYLVAVANDQMKA 553

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 11/97 (11%)

Query: 469 IMLKMLKTGYINNRSRMITASFLAKNLLIDWRWGE-----RWFRKHLIDYDTASNVGGWG 523
           ++ K+  +  +    + +T++ + +   + W WG      RWF++H    DTA N    G
Sbjct: 203 VIKKVYSSNGVRGLYKGLTSTLIFRTNFVFW-WGSYELLTRWFKEHTNMSDTAINFWSGG 261

Query: 524 FCASTGI--DCQPYFRVFNMKLQSEKYDPEGKFIRHW 558
           F AS G      P   +  + L ++KYD  G F R W
Sbjct: 262 FSASFGFWTTAYPSDVIKQVVLCNDKYD--GTF-RSW 295

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,284,002
Number of extensions: 906879
Number of successful extensions: 2538
Number of sequences better than 10.0: 11
Number of HSP's gapped: 2586
Number of HSP's successfully gapped: 13
Length of query: 586
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 479
Effective length of database: 12,891,983
Effective search space: 6175259857
Effective search space used: 6175259857
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)