Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17754g22722411081e-156
YER170W (ADK2)2252027363e-99
CAGL0L11902g2512077201e-96
AGR115C2512097028e-94
Kwal_56.234892252126938e-93
Scas_681.182482116811e-90
Sklu_2123.22282004055e-49
CAGL0K11418g2221983951e-47
YDR226W (ADK1)2221983923e-47
Scas_721.822211983914e-47
AGR187W2771983912e-46
KLLA0F13376g2271963863e-46
Kwal_27.116072271983699e-44
KLLA0E08030g3021972101e-19
Sklu_2380.52892141993e-18
YKL024C (URA6)2041851841e-16
Scas_685.92001881796e-16
Kwal_14.8682822141828e-16
ACR170C2891881731e-14
CAGL0L09867g2601881694e-14
KLLA0F18975g120069710.47
KLLA0D14135g25161632.8
Sklu_2416.640230633.9
Scas_721.4253145617.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17754g
         (224 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces...   431   e-156
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...   288   3e-99
CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces...   281   1e-96
AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH] (959464..96...   275   8e-94
Kwal_56.23489                                                         271   8e-93
Scas_681.18                                                           266   1e-90
Sklu_2123.2 YDR226W, Contig c2123 4210-4896                           160   5e-49
CAGL0K11418g complement(1109653..1110321) highly similar to sp|P...   156   1e-47
YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase (GT...   155   3e-47
Scas_721.82                                                           155   4e-47
AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH] complement(...   155   2e-46
KLLA0F13376g 1234589..1235272 highly similar to sp|P07170 Saccha...   153   3e-46
Kwal_27.11607                                                         146   9e-44
KLLA0E08030g complement(724562..725470) some similarities with s...    86   1e-19
Sklu_2380.5 YKL024C, Contig c2380 11212-12081                          81   3e-18
YKL024C (URA6) [3231] chr11 complement(392169..392783) Uridine-m...    75   1e-16
Scas_685.9                                                             74   6e-16
Kwal_14.868                                                            75   8e-16
ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH] (653511..65...    71   1e-14
CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...    70   4e-14
KLLA0F18975g complement(1739543..1743145) similar to sgd|S000407...    32   0.47 
KLLA0D14135g 1211322..1212077 some similarities with ca|CA3316|I...    29   2.8  
Sklu_2416.6 YOL136C, Contig c2416 10365-11573 reverse complement       29   3.9  
Scas_721.42                                                            28   7.2  

>KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w ADK2 adenylate kinase, mitochondrial,
           start by similarity
          Length = 227

 Score =  431 bits (1108), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/224 (95%), Positives = 215/224 (95%)

Query: 1   MSVXXXXXXXXXGAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYI 60
           MSV         GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYI
Sbjct: 1   MSVLRPLRLLLLGAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYI 60

Query: 61  EKGQLLPDDLITGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLV 120
           EKGQLLPDDLITGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLV
Sbjct: 61  EKGQLLPDDLITGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLV 120

Query: 121 VELDVPHEVILERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGK 180
           VELDVPHEVILERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGK
Sbjct: 121 VELDVPHEVILERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGK 180

Query: 181 RLEQYNKTVTPLKEHYLKQGILSTISGNTSDIIYPKLVSLILQK 224
           RLEQYNKTVTPLKEHYLKQGILSTISGNTSDIIYPKLVSLILQK
Sbjct: 181 RLEQYNKTVTPLKEHYLKQGILSTISGNTSDIIYPKLVSLILQK 224

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score =  288 bits (736), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 139/202 (68%), Positives = 163/202 (80%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           GAPGSGKGTQTS+LLK+   + +ISSGD+LR++I+  + LG  A++YI +G+LLPDDLIT
Sbjct: 21  GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLIT 80

Query: 73  GVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVILE 132
            ++   L + GWL P+A WLLDGFPRT  QA  LD+ L +HDASLNLVVELDVP   ILE
Sbjct: 81  RLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILE 140

Query: 133 RIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTPL 192
           RIENRYVHVPSGRVYNLQYNPPKV G DDITGEPLTKR DDTAEVF KRLE+Y KT  PL
Sbjct: 141 RIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPL 200

Query: 193 KEHYLKQGILSTISGNTSDIIY 214
           K++Y K GI  T+SG TSDII+
Sbjct: 201 KDYYKKSGIFGTVSGETSDIIF 222

>CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w KAD2, hypothetical start
          Length = 251

 Score =  281 bits (720), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 167/207 (80%)

Query: 17  SGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLITGVVC 76
           SGKGTQTSKLLK    +K++SSGD+LR +++ GT LG+ A+ YI +G+L+PD +IT V+ 
Sbjct: 19  SGKGTQTSKLLKVLPELKSVSSGDILRHELKSGTELGVLAAKYIAQGKLIPDKVITQVLI 78

Query: 77  DELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVILERIEN 136
             L    WLNP ++WLLDGFPRT  QA  LD +L E++A LNLVVELDVP EVILERI+N
Sbjct: 79  AHLSKEKWLNPQSSWLLDGFPRTERQAFSLDSTLGENNAKLNLVVELDVPEEVILERIDN 138

Query: 137 RYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTPLKEHY 196
           RY+HV SGRVYNLQYNPPKV GKDD+TGEPL KR DD  +VF KR+++Y KT+ P+KEHY
Sbjct: 139 RYIHVGSGRVYNLQYNPPKVAGKDDVTGEPLVKRSDDNVQVFKKRMKEYKKTLGPIKEHY 198

Query: 197 LKQGILSTISGNTSDIIYPKLVSLILQ 223
            KQGIL+TISG+TSDII+PKL +LI Q
Sbjct: 199 AKQGILATISGDTSDIIFPKLCALINQ 225

>AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH]
           (959464..960219) [756 bp, 251 aa]
          Length = 251

 Score =  275 bits (702), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 123/209 (58%), Positives = 163/209 (77%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           GAPG+GKGTQ  +LL+ F  ++A++SGDLLR++I  G+PLG  A+++I  G+LLPD L++
Sbjct: 37  GAPGAGKGTQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVS 96

Query: 73  GVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVILE 132
             + DEL  R WL+  A+WLLDGFPRTV QA+ LD +L   DA+L LVVE+ VP +VIL+
Sbjct: 97  SAILDELARRRWLHGGASWLLDGFPRTVAQAQELDAALERADAALTLVVEVAVPEDVILD 156

Query: 133 RIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTPL 192
           RI+ R+VHVPSGRVYNL YNPP   G+DD+TGEPL++RPDDT EVF KR+++Y  T  PL
Sbjct: 157 RIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPL 216

Query: 193 KEHYLKQGILSTISGNTSDIIYPKLVSLI 221
           KEHY +QGIL T+ G TSDI++P+L  L+
Sbjct: 217 KEHYARQGILRTVRGPTSDIVFPQLERLV 245

>Kwal_56.23489
          Length = 225

 Score =  271 bits (693), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 141/212 (66%), Positives = 169/212 (79%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           GAPGSGKGTQTSKLL  F  I++ISSGDLLR++I+  T LG  AS YI +G+LLPD L+T
Sbjct: 10  GAPGSGKGTQTSKLLSHFKYIRSISSGDLLRQEIQKKTHLGSLASEYISQGKLLPDSLVT 69

Query: 73  GVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVILE 132
            +V +EL +RG L+ ++++LLDGFPRT+ QA+ L   L  H + LNLVVELDVP  VILE
Sbjct: 70  ELVTNELTARGLLSSDSSFLLDGFPRTLDQAKSLRSKLAPHGSPLNLVVELDVPSSVILE 129

Query: 133 RIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTPL 192
           RIENRYVHVPSGRVYNL YNPP V GKDD+TGEPLTKRPDDTAEVFGKRLE Y +TV PL
Sbjct: 130 RIENRYVHVPSGRVYNLTYNPPLVAGKDDVTGEPLTKRPDDTAEVFGKRLENYAQTVEPL 189

Query: 193 KEHYLKQGILSTISGNTSDIIYPKLVSLILQK 224
           K+ Y   GIL  +SG TSDII+P+L+ L+ +K
Sbjct: 190 KQFYADLGILHKVSGETSDIIFPQLLDLVSKK 221

>Scas_681.18
          Length = 248

 Score =  266 bits (681), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 170/211 (80%), Gaps = 2/211 (0%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           GAPGSGKGTQ S+L++   ++  ISSGD+LR++I+  T LG  AS +I +G+L+PDDLI 
Sbjct: 14  GAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFIAQGKLIPDDLID 73

Query: 73  GVVCDELKSRGWL--NPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVI 130
            ++  +L+ + WL     ++W+LDGFPRT+ QA+  D++L +++ +LNLVVELDVP EVI
Sbjct: 74  KLLISKLQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDVPTEVI 133

Query: 131 LERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVT 190
           LERIENRYVH+PSGR+YNLQ+NPP+V GKDDITGEPL KR DD+A  F KRL++Y++T+ 
Sbjct: 134 LERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEYHETLG 193

Query: 191 PLKEHYLKQGILSTISGNTSDIIYPKLVSLI 221
           PLKE+Y  QG+L TISG TSDII+PKL+++I
Sbjct: 194 PLKEYYQSQGLLQTISGETSDIIFPKLLNMI 224

>Sklu_2123.2 YDR226W, Contig c2123 4210-4896
          Length = 228

 Score =  160 bits (405), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 122/200 (61%), Gaps = 7/200 (3%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           G PG+GKGTQ   L + F +   +++GD+LR Q+   T LGL A   +++G L+ DD++ 
Sbjct: 19  GPPGAGKGTQAPNLKERFCACH-LATGDMLRSQVAKKTALGLEAKKIMDQGGLVSDDIMV 77

Query: 73  GVVCDELKSRGWLNPNAT--WLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVI 130
            ++ +EL +    NP     ++LDGFPRT+ QAE LD+ L E    L   +EL +  E++
Sbjct: 78  NMIKEELAT----NPECKNGFILDGFPRTIPQAEKLDEMLAEQGKPLERAIELKIDDELL 133

Query: 131 LERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVT 190
           + RI  R VH  SGR Y+  +NPPKVD KDD+TGEPL +R DD A+   KRL  Y++   
Sbjct: 134 VARITGRLVHPASGRSYHKLFNPPKVDMKDDVTGEPLVQRSDDNADALKKRLNAYHQQTE 193

Query: 191 PLKEHYLKQGILSTISGNTS 210
           P+ + Y K GI S +  + +
Sbjct: 194 PIVDFYKKTGIWSGVDASQA 213

>CAGL0K11418g complement(1109653..1110321) highly similar to
           sp|P07170 Saccharomyces cerevisiae YDR226w ADK1
           adenylate kinase, start by similarity
          Length = 222

 Score =  156 bits (395), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 119/198 (60%), Gaps = 7/198 (3%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           G PG+GKGTQ   L++ F +   +++GD+LR QI  GT LGL A   +++G L+ DD++ 
Sbjct: 13  GPPGAGKGTQAPNLVERFHAAH-LATGDMLRSQISKGTELGLQAKKIMDQGGLVSDDIMV 71

Query: 73  GVVCDELKSRGWLNPNAT--WLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVI 130
            ++ DEL +    NP     ++LDGFPRT+ QAE LD  L E    L   VEL +  E++
Sbjct: 72  NMIKDELTN----NPACKNGFILDGFPRTIPQAEKLDNMLKERGTPLEKAVELKIDDELL 127

Query: 131 LERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVT 190
           + RI  R +H  SGR Y+  +NPPK D KDD+TGEPL +R DD  +   KRL  Y+    
Sbjct: 128 VARITGRLIHPASGRSYHKLFNPPKEDMKDDVTGEPLVQRSDDNEDALKKRLGAYHDQTE 187

Query: 191 PLKEHYLKQGILSTISGN 208
           P+ + Y K GI + +  +
Sbjct: 188 PIVDFYKKTGIWADVDAS 205

>YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase
           (GTP:AMP phosphotransferase), cytoplasmic and
           mitochondrial [669 bp, 222 aa]
          Length = 222

 Score =  155 bits (392), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 119/198 (60%), Gaps = 7/198 (3%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           G PG+GKGTQ   L + F +   +++GD+LR QI  GT LGL A   +++G L+ DD++ 
Sbjct: 13  GPPGAGKGTQAPNLQERFHAAH-LATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMV 71

Query: 73  GVVCDELKSRGWLNPNAT--WLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVI 130
            ++ DEL +    NP     ++LDGFPRT+ QAE LD+ L E    L   +EL V  E++
Sbjct: 72  NMIKDELTN----NPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELL 127

Query: 131 LERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVT 190
           + RI  R +H  SGR Y+  +NPPK D KDD+TGE L +R DD A+   KRL  Y+    
Sbjct: 128 VARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTE 187

Query: 191 PLKEHYLKQGILSTISGN 208
           P+ + Y K GI + +  +
Sbjct: 188 PIVDFYKKTGIWAGVDAS 205

>Scas_721.82
          Length = 221

 Score =  155 bits (391), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 120/198 (60%), Gaps = 7/198 (3%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           G PG+GKGTQ   L+++F +   +S+GD+LR QI   T LG  A   +++G L+ D+++ 
Sbjct: 12  GPPGAGKGTQAPNLVEKFHACH-LSTGDMLRSQIAKNTELGQEAKKIMDQGGLVSDEIMV 70

Query: 73  GVVCDELKSRGWLNPNAT--WLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVI 130
            ++ DEL +    NP     ++LDGFPRT+ QAE LD+ L E    L   VEL V  +++
Sbjct: 71  NMIKDELTN----NPACKNGFILDGFPRTIPQAEKLDQMLAERGTPLQRAVELQVDDDLL 126

Query: 131 LERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVT 190
           + RI  R +H  SGR Y+  +NPPKVD  DD+TGEPL +R DD A+   KRL  Y+    
Sbjct: 127 VARITGRLIHPASGRSYHKLFNPPKVDMVDDVTGEPLIQRSDDNADALKKRLAGYHAQTE 186

Query: 191 PLKEHYLKQGILSTISGN 208
           P+ + Y K GI S +  +
Sbjct: 187 PIVDFYKKTGIWSGVDAS 204

>AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH]
           complement(1102660..1103493) [834 bp, 277 aa]
          Length = 277

 Score =  155 bits (391), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 123/198 (62%), Gaps = 7/198 (3%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           G PG+GKGTQ  KL ++F  +  +++GD+LR Q+   T LG+ A   +++G L+ D+++ 
Sbjct: 69  GPPGAGKGTQAPKLKEKF-CVCHLATGDMLRSQVAKQTALGVQAKKIMDQGGLVSDEIMV 127

Query: 73  GVVCDELKSRGWLNPNAT--WLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVI 130
            ++ DEL+S    NP     ++LDGFPRT+ QA+ LD+ L+     L+  VEL +  E++
Sbjct: 128 NMIKDELRS----NPECANGFILDGFPRTIPQAQKLDEMLVAQGKPLDRAVELKIDDELL 183

Query: 131 LERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVT 190
           + RI  R VH  SGR Y+  +NPPKV   DD+TG+PL +R DD A+   KRL+ Y+    
Sbjct: 184 VARITGRLVHPASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADALKKRLDAYHAQTE 243

Query: 191 PLKEHYLKQGILSTISGN 208
           P+ + Y K GI + +  +
Sbjct: 244 PIVDFYKKTGIWAGVDAS 261

>KLLA0F13376g 1234589..1235272 highly similar to sp|P07170
           Saccharomyces cerevisiae YDR226w ADK1 adenylate kinase,
           cytosolic, start by similarity
          Length = 227

 Score =  153 bits (386), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 118/196 (60%), Gaps = 3/196 (1%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           G PG+GKGTQ   L + F +   +++GD+LR Q+   TPLG+ A   ++ G+L+ D+++ 
Sbjct: 18  GPPGAGKGTQAPNLTERFCACH-LATGDMLRSQVAKQTPLGIEAKKIMDDGKLVSDEIMI 76

Query: 73  GVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVILE 132
            ++ DEL +    +    ++LDGFPRT+ QAE LD+ L +    L   VEL +  E+++ 
Sbjct: 77  NMIKDELTNNQ--DCKKGFILDGFPRTIPQAEKLDEMLAQQGRPLEKAVELKIDDELLVS 134

Query: 133 RIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTPL 192
           RI  R VH  SGR Y+  +NPPK + KDDITGE L +R DD  E   KRL  Y+K   P+
Sbjct: 135 RITGRLVHPASGRSYHKVFNPPKTEMKDDITGEDLVQRSDDNVEALKKRLTSYHKQTEPI 194

Query: 193 KEHYLKQGILSTISGN 208
            + Y K GI + +  +
Sbjct: 195 VDFYKKTGIWAGVDAS 210

>Kwal_27.11607
          Length = 227

 Score =  146 bits (369), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 117/198 (59%), Gaps = 7/198 (3%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLIT 72
           G PG+GKGTQ   L + F +   +++GD+LR Q+   T LGL A   +++G L+ DD++ 
Sbjct: 18  GPPGAGKGTQAPNLKERFCACH-LATGDMLRSQVAQKTELGLEAKKIMDQGGLVSDDIMV 76

Query: 73  GVVCDELKSRGWLNPNAT--WLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVI 130
            ++  EL +    NP     ++LDGFPRT+ QAE LD+ L E    L   +EL +  E++
Sbjct: 77  KMIKHELIT----NPECKSGFILDGFPRTIPQAEKLDQMLTEQGRPLEKAIELKIDDELL 132

Query: 131 LERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVT 190
           + RI  R VH  SGR Y+  +NPPK +  DD+TGE L +R DD A+   KRL  Y++   
Sbjct: 133 VSRITGRLVHPASGRSYHKIFNPPKKEMTDDVTGEALVQRSDDNADALKKRLGAYHQQTE 192

Query: 191 PLKEHYLKQGILSTISGN 208
           P+ + Y K GI S +  +
Sbjct: 193 PIVDFYKKTGIWSGVDAS 210

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score = 85.5 bits (210), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 99/197 (50%), Gaps = 34/197 (17%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71
           G PG+GKGTQ +KL+K+FG +  +S+GDLLR +Q   G+  G      I+ G+++P ++ 
Sbjct: 119 GGPGAGKGTQCAKLVKDFGFVH-LSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVT 177

Query: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131
             ++ + + S  + + N  +L+DGFPR + QA   ++ ++    +L      D P +++L
Sbjct: 178 VALLKNAITS-NYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLF----FDCPEKIML 232

Query: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191
           ER+  R     SGR+                         DD  E   KR + + +T  P
Sbjct: 233 ERLLQR--GKTSGRI-------------------------DDNIESIQKRFKTFVETSVP 265

Query: 192 LKEHYLKQGILSTISGN 208
           + E++ KQ  +  +S N
Sbjct: 266 VVEYFEKQNKVVKVSCN 282

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score = 81.3 bits (199), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 105/214 (49%), Gaps = 35/214 (16%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71
           G PG+GKGTQ +KL+K++G +  +S+GDLLR +Q   G+  G     YI++G ++P ++ 
Sbjct: 106 GGPGAGKGTQCTKLVKDYGFVH-LSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVT 164

Query: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131
             ++ + ++   + +    +L+DGFPR + QA   +K ++    +L      D P  V+L
Sbjct: 165 VALLQNAIRE-NFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLF----FDCPETVML 219

Query: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191
           ER+  R                    GK        + R DD  E   KR   + +T  P
Sbjct: 220 ERLLER--------------------GK-------TSGRTDDNIESIKKRFRTFIETSMP 252

Query: 192 LKEHYLKQGILSTISGNTS-DIIYPKLVSLILQK 224
           + E++ KQ  +  +S +   D +Y K+ + +  K
Sbjct: 253 VVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAK 286

>YKL024C (URA6) [3231] chr11 complement(392169..392783)
           Uridine-monophosphate kinase (uridylate kinase),
           catalyzes the conversion of ATP and UMP to ADP and UDP
           [615 bp, 204 aa]
          Length = 204

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 91/185 (49%), Gaps = 34/185 (18%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71
           G PG+GKGTQ  KL+K++ S   +S+GDLLR +Q   G+  G    + I++GQ++P ++ 
Sbjct: 23  GGPGAGKGTQCEKLVKDY-SFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEIT 81

Query: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131
             ++ + +      N +  +L+DGFPR + QA   ++ ++E       ++  D P +++L
Sbjct: 82  LALLRNAISDNVKANKH-KFLIDGFPRKMDQAISFERDIVES----KFILFFDCPEDIML 136

Query: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191
           ER+  R                    GK        + R DD  E   KR   + +T  P
Sbjct: 137 ERLLER--------------------GK-------TSGRSDDNIESIKKRFNTFKETSMP 169

Query: 192 LKEHY 196
           + E++
Sbjct: 170 VIEYF 174

>Scas_685.9
          Length = 200

 Score = 73.6 bits (179), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 90/188 (47%), Gaps = 34/188 (18%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71
           G PG+GKGTQ +KL+ ++G +  +S+GDLLR +Q   G+  G     YI +G ++P ++ 
Sbjct: 18  GGPGAGKGTQCAKLVADYGFVH-LSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQEIT 76

Query: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131
             ++ + ++   +      +L+DGFPR + QA     S  E       ++  D P +V+L
Sbjct: 77  LALLKNAIQE-NYDKGMKKFLVDGFPRKMDQA----LSFEEQIVPSKFILFFDCPEDVML 131

Query: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191
           ER+ +R     SGRV                         DD  E   KR + + +T  P
Sbjct: 132 ERLLDR--GKTSGRV-------------------------DDNIESIKKRFKTFEETSMP 164

Query: 192 LKEHYLKQ 199
           + +++  Q
Sbjct: 165 VVKYFEDQ 172

>Kwal_14.868
          Length = 282

 Score = 74.7 bits (182), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 107/214 (50%), Gaps = 35/214 (16%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71
           G PG+GKGTQ + L++++  +  +S+GDLLR +Q   G+  G     YI++G ++P ++ 
Sbjct: 100 GGPGAGKGTQCANLVRDYQFVH-LSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVT 158

Query: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131
             ++   ++   +   +  +L+DGFPR + QA   ++ ++    +L      D P +V+L
Sbjct: 159 VALLQQAIQD-NYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLF----FDCPEKVML 213

Query: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191
           +R+  R                    GK        + R DD  E   KR + + +T  P
Sbjct: 214 QRLLER--------------------GK-------TSGRSDDNVESIKKRFKTFIETSMP 246

Query: 192 LKEHYLKQGILSTISGNTS-DIIYPKLVSLILQK 224
           + E++ KQ  + ++S + S + +Y ++ + + +K
Sbjct: 247 VVEYFEKQDKVVSVSCDHSVEKVYEQVKAAVKEK 280

>ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH]
           (653511..654380) [870 bp, 289 aa]
          Length = 289

 Score = 71.2 bits (173), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 87/188 (46%), Gaps = 34/188 (18%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71
           G PGSGKGTQ S+L++    +  + +GDLLR +Q   G+  G     +I++G ++P ++ 
Sbjct: 105 GGPGSGKGTQCSRLVERMQFVH-VGAGDLLRDEQNRPGSQYGELIKHHIKEGLIVPQEVT 163

Query: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131
             ++   ++   +      +L+DGFPR + QA   +K+++        V+  D P  V+L
Sbjct: 164 VALLRRAIEEH-YRAGRRKFLVDGFPRKMDQAFTFEKTVVPS----KFVLFFDCPERVML 218

Query: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191
           ER+                           +T    + R DD  E   KR   Y +T  P
Sbjct: 219 ERL---------------------------LTRGQTSGRSDDNIESIKKRFRTYVETSMP 251

Query: 192 LKEHYLKQ 199
           + EH+ +Q
Sbjct: 252 VVEHFAQQ 259

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score = 69.7 bits (169), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 88/188 (46%), Gaps = 34/188 (18%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71
           G PG+GKGTQ +KL+ ++  +  +S+GDLLR +Q   G+  G     YI++G ++P ++ 
Sbjct: 77  GGPGAGKGTQCAKLVNDYKFVH-LSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEIT 135

Query: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131
             ++   +K   +      +L+DGFPR + QA   +K ++    +L      + P +V+L
Sbjct: 136 LSLLQKAIKE-NYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTLF----FECPEQVML 190

Query: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191
           ER+  R                    GK        + R DD  E   KR   + +T  P
Sbjct: 191 ERLLER--------------------GKT-------SGRADDNIESIKKRFRTFEETSMP 223

Query: 192 LKEHYLKQ 199
           +  ++  Q
Sbjct: 224 VVRYFDSQ 231

>KLLA0F18975g complement(1739543..1743145) similar to sgd|S0004074
           Saccharomyces cerevisiae YLR084c RAX2, hypothetical
           start
          Length = 1200

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 7/69 (10%)

Query: 16  GSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLITGVV 75
           GS +  Q + LL+EFG+    S  DL   Q +   PL LS+ +    G+ +  D++   +
Sbjct: 209 GSFQEIQNASLLQEFGNATNSSHEDLTSLQFDQSVPLKLSSIT----GENVQSDIL---L 261

Query: 76  CDELKSRGW 84
           C      GW
Sbjct: 262 CPSGGQNGW 270

>KLLA0D14135g 1211322..1212077 some similarities with
           ca|CA3316|IPF8817 Candida albicans putative proteasome
           subunit (by homology), hypothetical start
          Length = 251

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 13  GAPGSGKGTQTSKLLKEFGSIKAISS------GDLLRKQIEHGTPLGLSASSYIEKGQLL 66
           G+P    G QT  L+ +FG++ A++       G L++ +I+    L +  ++ I   QL+
Sbjct: 175 GSPSHDAGLQTDDLIIKFGTVHALNHNNLSNIGKLVQTRIDEEIVLKIKRNNDIVTIQLV 234

Query: 67  P 67
           P
Sbjct: 235 P 235

>Sklu_2416.6 YOL136C, Contig c2416 10365-11573 reverse complement
          Length = 402

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 4/30 (13%)

Query: 178 FGKRLEQYNKTVTPLK----EHYLKQGILS 203
           FGKRL+ Y     PL     EHYL  G LS
Sbjct: 266 FGKRLKHYYSQFVPLNKREFEHYLFDGTLS 295

>Scas_721.42
          Length = 531

 Score = 28.1 bits (61), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 69  DLITGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEH 113
           +L  G  C E+ + G++N N   LLDG      + +VL   +++H
Sbjct: 195 NLFQGGQCREIIAHGYVNSNDLTLLDGDMDVTDEDDVLISGVIDH 239

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,590,782
Number of extensions: 345960
Number of successful extensions: 724
Number of sequences better than 10.0: 31
Number of HSP's gapped: 700
Number of HSP's successfully gapped: 31
Length of query: 224
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 126
Effective length of database: 13,203,545
Effective search space: 1663646670
Effective search space used: 1663646670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)