Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17732g1194117657780.0
AGR116W116795735350.0
Scas_636.17118498635190.0
Kwal_56.23445132998134860.0
YDR097C (MSH6)124298334810.0
CAGL0G08129g121697932910.0
Sklu_2128.210609065761e-60
Kwal_56.226139567685473e-57
YCR092C (MSH3)10479475468e-57
KLLA0C18590g10293795154e-53
CAGL0I07733g9573295021e-51
ADR168C10323904923e-50
YOL090W (MSH2)9642844806e-49
CAGL0E00473g10253844817e-49
Scas_628.39593554781e-48
AFR603C9562704673e-47
KLLA0F02706g9563094602e-46
Kwal_23.646610374024575e-46
Scas_720.10210385954513e-45
KLLA0F24156g9403213559e-34
YHR120W (MSH1)9592113182e-29
ABR137W9552103155e-29
Kwal_33.147389632203155e-29
CAGL0L13002g9491903155e-29
Scas_697.279482053146e-29
Scas_544.28743192994e-27
Sklu_1903.38993442985e-27
CAGL0I03586g8672942887e-26
KLLA0C16423g9342832861e-25
YDL154W (MSH5)9012192744e-24
KLLA0F11022g8882792672e-23
Scas_707.288812942654e-23
CAGL0F02167g8951552512e-21
YFL003C (MSH4)8781852422e-20
Kwal_14.169773460770.71
CAGL0L10252g845113741.8
Kwal_47.17390801212687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17732g
         (1176 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17732g complement(1572115..1575699) similar to sp|Q03834 S...  2230   0.0  
AGR116W [4427] [Homologous to ScYDR097C (MSH6) - SH] complement(...  1366   0.0  
Scas_636.17                                                          1360   0.0  
Kwal_56.23445                                                        1347   0.0  
YDR097C (MSH6) [947] chr4 complement(640103..643831) Component w...  1345   0.0  
CAGL0G08129g complement(770779..774429) similar to sp|Q03834 Sac...  1272   0.0  
Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement         226   1e-60
Kwal_56.22613                                                         215   3e-57
YCR092C (MSH3) [615] chr3 complement(276760..279903) Component o...   214   8e-57
KLLA0C18590g complement(1642291..1645380) similar to sp|P25336 S...   202   4e-53
CAGL0I07733g 742340..745213 highly similar to sp|P25847 Saccharo...   197   1e-51
ADR168C [1910] [Homologous to ScYCR092C (MSH3) - SH] (997371..10...   194   3e-50
YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3...   189   6e-49
CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces cer...   189   7e-49
Scas_628.3                                                            188   1e-48
AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH] (1524851..1...   184   3e-47
KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1...   181   2e-46
Kwal_23.6466                                                          180   5e-46
Scas_720.102                                                          178   3e-45
KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces...   141   9e-34
YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in ...   127   2e-29
ABR137W [729] [Homologous to ScYHR120W (MSH1) - SH] complement(6...   125   5e-29
Kwal_33.14738                                                         125   5e-29
CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces...   125   5e-29
Scas_697.27                                                           125   6e-29
Scas_544.2                                                            119   4e-27
Sklu_1903.3 YFL003C, Contig c1903 4902-7601                           119   5e-27
CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces c...   115   7e-26
KLLA0C16423g complement(1437001..1439805) similar to sp|Q12175 S...   114   1e-25
YDL154W (MSH5) [716] chr4 (178335..181040) Meiosis-specific prot...   110   4e-24
KLLA0F11022g complement(1016214..1018880) similar to sp|P40965 S...   107   2e-23
Scas_707.28                                                           106   4e-23
CAGL0F02167g complement(216080..218767) similar to sp|P40965 Sac...   101   2e-21
YFL003C (MSH4) [1678] chr6 complement(134516..137152) Meiosis-sp...    98   2e-20
Kwal_14.1697                                                           34   0.71 
CAGL0L10252g complement(1100014..1102551) similar to sp|P50275 S...    33   1.8  
Kwal_47.17390                                                          31   7.8  

>KLLA0C17732g complement(1572115..1575699) similar to sp|Q03834
            Saccharomyces cerevisiae YDR097c MSH6 DNA mismatch repair
            protein, start by similarity
          Length = 1194

 Score = 2230 bits (5778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1083/1176 (92%), Positives = 1083/1176 (92%)

Query: 1    MTVETPKSLKKVTTMPGSSGKKKYKQATISSFFKKREKPVESESNDTSPLKEKSETDAKK 60
            MTVETPKSLKKVTTMPGSSGKKKYKQATISSFFKKREKPVESESNDTSPLKEKSETDAKK
Sbjct: 1    MTVETPKSLKKVTTMPGSSGKKKYKQATISSFFKKREKPVESESNDTSPLKEKSETDAKK 60

Query: 61   KDTTSKGPLQFKHQPEVVEKEPATKTEPSKPEATKTVETVTSLRGRKRKNVSLRESXXXX 120
            KDTTSKGPLQFKHQPEVVEKEPATKTEPSKPEATKTVETVTSLRGRKRKNVSLRES    
Sbjct: 61   KDTTSKGPLQFKHQPEVVEKEPATKTEPSKPEATKTVETVTSLRGRKRKNVSLRESDDDN 120

Query: 121  XXXXXXISMSKRSRNRSKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSLNPQLSNGSXX 180
                  ISMSKRSRNRSKI                            TSLNPQLSNGS  
Sbjct: 121  DDDDGDISMSKRSRNRSKIEDDDSEDEYKDDGDDDEEEEDNDEGVEDTSLNPQLSNGSDD 180

Query: 181  XXXXXXXXXXXXXXXXXXXXXXXPARKPLAYNPNRSLPATPKSQGKHTKFNKTNGERYQW 240
                                   PARKPLAYNPNRSLPATPKSQGKHTKFNKTNGERYQW
Sbjct: 181  DDDDEDLLALASKKSTKKAVVSTPARKPLAYNPNRSLPATPKSQGKHTKFNKTNGERYQW 240

Query: 241  LVHERDAEGRDKSDPDYDPRTLYIPGDAWSKFTPFEKQYWEIKSKMWDCILFFKKGKFFE 300
            LVHERDAEGRDKSDPDYDPRTLYIPGDAWSKFTPFEKQYWEIKSKMWDCILFFKKGKFFE
Sbjct: 241  LVHERDAEGRDKSDPDYDPRTLYIPGDAWSKFTPFEKQYWEIKSKMWDCILFFKKGKFFE 300

Query: 301  LYEKDAHLGHHLFDLKIAGGGRANMQLAGVPEMSFDYWASQFIQYGYKVAKVDQKESMLA 360
            LYEKDAHLGHHLFDLKIAGGGRANMQLAGVPEMSFDYWASQFIQYGYKVAKVDQKESMLA
Sbjct: 301  LYEKDAHLGHHLFDLKIAGGGRANMQLAGVPEMSFDYWASQFIQYGYKVAKVDQKESMLA 360

Query: 361  KEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYCVAVREEPITYYDEEILALPKTG 420
            KEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYCVAVREEPITYYDEEILALPKTG
Sbjct: 361  KEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYCVAVREEPITYYDEEILALPKTG 420

Query: 421  KYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNA 480
            KYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNA
Sbjct: 421  KYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNA 480

Query: 481  QPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLS 540
            QPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLS
Sbjct: 481  QPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLS 540

Query: 541  YLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINR 600
            YLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINR
Sbjct: 541  YLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINR 600

Query: 601  AITPMGKRKLRKWVMHPLLKIEDINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRMLSR 660
            AITPMGKRKLRKWVMHPLLKIEDIN                              RMLSR
Sbjct: 601  AITPMGKRKLRKWVMHPLLKIEDINSRLDSVDLLLSDMNLRDLLENELLKLPDLERMLSR 660

Query: 661  VHSCSLKIQYFNKVLCGFEDILALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAF 720
            VHSCSLKIQYFNKVLCGFEDILALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAF
Sbjct: 661  VHSCSLKIQYFNKVLCGFEDILALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAF 720

Query: 721  DRNLAVKDGVIVPNRGVEPEFDESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEI 780
            DRNLAVKDGVIVPNRGVEPEFDESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEI
Sbjct: 721  DRNLAVKDGVIVPNRGVEPEFDESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEI 780

Query: 781  YTIEVPMAATRNVPHEWTQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLY 840
            YTIEVPMAATRNVPHEWTQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLY
Sbjct: 781  YTIEVPMAATRNVPHEWTQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLY 840

Query: 841  KKFTNHYNAVWLPTIQAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIR 900
            KKFTNHYNAVWLPTIQAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIR
Sbjct: 841  KKFTNHYNAVWLPTIQAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIR 900

Query: 901  FKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQL 960
            FKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQL
Sbjct: 901  FKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQL 960

Query: 961  GCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELG 1020
            GCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELG
Sbjct: 961  GCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELG 1020

Query: 1021 RGGSSSDGFAIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESR 1080
            RGGSSSDGFAIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESR
Sbjct: 1021 RGGSSSDGFAIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESR 1080

Query: 1081 NVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASIAAENLEHTSKLIKERKNLHQSIN 1140
            NVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASIAAENLEHTSKLIKERKNLHQSIN
Sbjct: 1081 NVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASIAAENLEHTSKLIKERKNLHQSIN 1140

Query: 1141 PVPLGLQSDVVRLVYGDGLTNSKGGTGEGVRVYDNN 1176
            PVPLGLQSDVVRLVYGDGLTNSKGGTGEGVRVYDNN
Sbjct: 1141 PVPLGLQSDVVRLVYGDGLTNSKGGTGEGVRVYDNN 1176

>AGR116W [4427] [Homologous to ScYDR097C (MSH6) - SH]
            complement(960587..964090) [3504 bp, 1167 aa]
          Length = 1167

 Score = 1366 bits (3535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/957 (65%), Positives = 773/957 (80%), Gaps = 6/957 (0%)

Query: 223  SQGKHTKFNKTNGERYQWLVHERDAEGRDKSDPDYDPRTLYIPGDAWSKFTPFEKQYWEI 282
            S GKH+ F+K N ERYQWLV ERDA GR  SDP+YDPRTL+IP  AW++FTPFEKQYW+I
Sbjct: 191  SPGKHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQI 250

Query: 283  KSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRANMQLAGVPEMSFDYWASQF 342
            KSKMWDCI+FFKKGKFFELYEKDAHL + LFDLKIAGGGRANMQLAG+PEMSFDYWASQF
Sbjct: 251  KSKMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPEMSFDYWASQF 310

Query: 343  IQYGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYCVAVR 402
            IQ+GYKVAKVDQKESMLAKEMREG+KGIVERELQCVL+ GTLTD +ML SD +TYC+++ 
Sbjct: 311  IQHGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIH 370

Query: 403  EEPITYYD-EEILALP----KTGKYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFK 457
            E P+  Y  E   A+P    + G+ FG A IDTATG I LLEFEDD EC+QLDT+M+Q +
Sbjct: 371  EAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVR 430

Query: 458  PTEVIMEKSNVCSLAQKIIKFNAQPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWP 517
            P EV+MEK N+  +A KI+KFN+QP+ I N RTS EFYD+ +TFDE+    YF  MD WP
Sbjct: 431  PKEVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWP 490

Query: 518  TVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQ 577
             +LK YY+ GKKVGF AFGGLLSYLQWLKLD SL++MG VEEYNP+++QT L LDGITLQ
Sbjct: 491  AILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQ 550

Query: 578  NLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDINXXXXXXXXXXXX 637
            NLEIFAN++DGTD+G+LFKL+NRAITPMGKR++R WVMHPLL+ E I             
Sbjct: 551  NLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNE 610

Query: 638  XXXXXXXXXXXXXXXXXXRMLSRVHSCSLKIQYFNKVLCGFEDILALVEKLSIFADLKGS 697
                              R+L+RVHS +L I+ F+KV+CGFE+I+ L+  L+ + +L GS
Sbjct: 611  MPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISSLNEY-ELSGS 669

Query: 698  LKSYLTEIPSSLTTVLEAWSNAFDRNLAVKDGVIVPNRGVEPEFDESMDRIQGIEDQLQE 757
            L  +L +IPS+L + +E+W+  +DRN+AV +G +VPN GVEP+FD S+ +++ +E++L  
Sbjct: 670  LSRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDA 729

Query: 758  CLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQMAANKSFKRYYSADVQRL 817
             L++YK+  K S IQ+KDSGKE+YTIE+P++  ++VP  WTQ+ ANKS KRYYS  VQ+L
Sbjct: 730  VLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKL 789

Query: 818  ARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNIDCIISLARTSESLGFP 877
            AR MAEARE+HK+LE+ LK RLY+KF  +++  W PTI+AISNIDCI+SLARTSESLGFP
Sbjct: 790  ARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGFP 849

Query: 878  ACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLT 937
            ACRP   + + P T  KLNGY+ FKELRHPC+N G + A EFIPNDV LGK   Q+ LLT
Sbjct: 850  ACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLT 909

Query: 938  GANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVE 997
            GANAAGKST+LRMTC+AVI+AQLGCY+PCE+AE +P+DRIMTRLGA+DNIMQGKSTFFVE
Sbjct: 910  GANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVE 969

Query: 998  LSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQSLGFFATHYAALG 1057
            LSET+KILD+ TNR+L+V+DELGRGGSSSDGFAIAE VLHH++TH+QSLGFFATHY  LG
Sbjct: 970  LSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLG 1029

Query: 1058 SSFTNHPNVQPLKMAILVDEESRNVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASI 1117
             SFT+HP V+PL+MAILVDE S+ VTFLYKL++G+S+GSFGMHVA+MCGIPRSVV+NA  
Sbjct: 1030 QSFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAER 1089

Query: 1118 AAENLEHTSKLIKERKNLHQSINPVPLGLQSDVVRLVYGDGLTNSKGGTGEGVRVYD 1174
            AAE+ EHTS+++KERK      + VPLGLQSD VRLV+GDGL  +  G+GEGV+ YD
Sbjct: 1090 AAESFEHTSRILKERKRYINDEHVVPLGLQSDFVRLVFGDGLKKTALGSGEGVKYYD 1146

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 1  MTVETPKSLKKVTTMPGSSGKKKYKQATISSFFKK 35
          M   TP+  KKV  M  + GKK+ KQAT+ SFFKK
Sbjct: 1  MPPSTPQQSKKVMQM--TPGKKRLKQATLMSFFKK 33

>Scas_636.17
          Length = 1184

 Score = 1360 bits (3519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/986 (66%), Positives = 785/986 (79%), Gaps = 16/986 (1%)

Query: 204  PARKPLAYNPNRSLPATPKSQGKHTKFNKTNGERYQWLVHERDAEGRDKSDPDYDPRTLY 263
            P RK     P R+  + P +Q K  KFNK N ERY WLV+E+DA+GR  +DP+YDPRTL+
Sbjct: 186  PMRKLPVPKPKRT--SQPATQPKAQKFNKQNEERYHWLVNEKDAQGRAPTDPEYDPRTLH 243

Query: 264  IPGDAWSKFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRA 323
            IP  AW KFT FEKQYWEIKSKMWDC++FFKKGKF+ELYEKDA L + LFD K+AGGGRA
Sbjct: 244  IPSSAWGKFTAFEKQYWEIKSKMWDCVVFFKKGKFYELYEKDAFLANSLFDWKLAGGGRA 303

Query: 324  NMQLAGVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGT 383
            NMQLAGVPEMSF+YWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIV+REL+CVLTSGT
Sbjct: 304  NMQLAGVPEMSFEYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVKRELECVLTSGT 363

Query: 384  LTDSEMLKSDLATYCVAVREEPITYYDEE--ILALPKTG------KYFGFAAIDTATGHI 435
            LTD +ML SDLAT+C+AVREEP  +Y +E        TG      K FG A IDT+TG +
Sbjct: 364  LTDGDMLHSDLATFCLAVREEPRDFYIDEQTTFTTDSTGPSSIGKKLFGIAFIDTSTGEL 423

Query: 436  DLLEFEDDEECSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQ-RTSKEF 494
             LLEFEDD EC++LDTIMSQ KP E+IMEK+N+ SLA KI+KFNA P AI N  +  +EF
Sbjct: 424  QLLEFEDDSECTKLDTIMSQVKPKEIIMEKNNLSSLANKIVKFNAAPNAIFNNIKPDQEF 483

Query: 495  YDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTM 554
            Y+FEKT+DELIT  YF+   +WP  LK+YY+ GKK+GF  FGGLL YL+WLKLD +L+++
Sbjct: 484  YNFEKTYDELITGNYFEDESKWPETLKNYYKEGKKIGFSTFGGLLYYLKWLKLDQNLISL 543

Query: 555  GQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWV 614
            G ++EYNP+ SQ  L LDG+TLQNLEIF+N++DGTD+G+LFKL NRAITPMGKR ++KW+
Sbjct: 544  GNIKEYNPIESQNSLILDGVTLQNLEIFSNSFDGTDKGTLFKLFNRAITPMGKRMMKKWL 603

Query: 615  MHPLLKIEDINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRMLSRVHSCSLKIQYFNKV 674
            MHPLL  +DI                               RML+R+HS +LK++ F++V
Sbjct: 604  MHPLLHKKDIEKRLDSIETLMNNVELRDTIESTFTKLPDVERMLARIHSGTLKVKDFDRV 663

Query: 675  LCGFEDILALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAFDRNLAVKDGVIVPN 734
            +  FEDI+ L   +  F DLKG+L  Y ++IP SL   +E W+NAFDR  AV++ +I+P+
Sbjct: 664  IQAFEDIVTLQNSIKDF-DLKGALSVYFSQIPKSLIDDVENWTNAFDRIKAVEENIIIPH 722

Query: 735  RGVEPEFDESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVP 794
            RG+EPEFD+S+D IQ +EDQLQ+ L  YKK  K+SNIQ+KDSGKEIYTIEVP++ T+ +P
Sbjct: 723  RGIEPEFDKSLDDIQELEDQLQDQLNLYKKRFKNSNIQYKDSGKEIYTIEVPVSITKQIP 782

Query: 795  HEWTQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPT 854
             +WTQMAANKS KRYYS +V+ LAR MAEARE+HK LE++LK RL KKF  HYN  W+PT
Sbjct: 783  SDWTQMAANKSTKRYYSEEVRVLARSMAEARELHKALENELKIRLCKKFDAHYNTTWMPT 842

Query: 855  IQAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSS 914
            +  ISNIDC+++L RTSESLG+PACRP L + ++ ET  KLNGY++F  LRHPCFN+GSS
Sbjct: 843  VHVISNIDCLLALTRTSESLGYPACRPVLRDEVNLETGTKLNGYLKFTSLRHPCFNLGSS 902

Query: 915  SAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPV 974
            S K+FIPNDV LGKD+PQLGLLTGANAAGKSTVLRMTC+AVI+AQ+GCY+PCE AE T  
Sbjct: 903  STKDFIPNDVELGKDSPQLGLLTGANAAGKSTVLRMTCIAVIMAQMGCYVPCESAELTSF 962

Query: 975  DRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEA 1034
            DRIMTRLGA+DNIMQGKSTFFVELSETKKILDL TNRSLLV+DELGRGGSS+DGFAIAE+
Sbjct: 963  DRIMTRLGANDNIMQGKSTFFVELSETKKILDLATNRSLLVLDELGRGGSSNDGFAIAES 1022

Query: 1035 VLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESRNVTFLYKLVDGKSD 1094
            VLHHVATHIQSLGFFATHYA+LG SF  HP V+P+KM+ILVD+E+RNVTFLYKLV G+S+
Sbjct: 1023 VLHHVATHIQSLGFFATHYASLGLSFKGHPQVKPMKMSILVDDETRNVTFLYKLVPGQSE 1082

Query: 1095 GSFGMHVASMCGIPRSVVDNASIAAENLEHTSKLIKERKNLHQSIN----PVPLGLQSDV 1150
            GSFGMHVASMCGIP  +VDNA +AA+ LEHTS+L+KERK L+  +N     VP+GLQSD 
Sbjct: 1083 GSFGMHVASMCGIPSEIVDNAQVAADTLEHTSRLMKERKMLNGGLNEDIITVPMGLQSDF 1142

Query: 1151 VRLVYGDGLTNSKGGTGEGVRVYDNN 1176
            VRLVYGDGL N+  G GEGV  YD N
Sbjct: 1143 VRLVYGDGLRNTSKGAGEGVLNYDWN 1168

>Kwal_56.23445
          Length = 1329

 Score = 1347 bits (3486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/981 (65%), Positives = 779/981 (79%), Gaps = 14/981 (1%)

Query: 205  ARKPLAYNPNRSLPATPKSQGKHTKFNKTNGERYQWLVHERDAEGRDKSDPDYDPRTLYI 264
            AR+P   +P     ++   +GKH+ F K N +RYQWLV+ERDA+GR   D DYDPRTLYI
Sbjct: 337  ARRP---SPTHK-ASSSAGKGKHSNFAKENEDRYQWLVNERDAQGRATDDSDYDPRTLYI 392

Query: 265  PGDAWSKFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRAN 324
            P  AW+KFTPFEKQYWEIKS+MWDCI+FFKKGKFFELYEKDA LG+HLFDLKIAGGGRAN
Sbjct: 393  PPSAWTKFTPFEKQYWEIKSRMWDCIVFFKKGKFFELYEKDALLGNHLFDLKIAGGGRAN 452

Query: 325  MQLAGVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTL 384
            MQLAG+PEMSFDYWA QFIQ+GYKVAKVDQ+ESMLAKEMREG+KGIV+RELQ VLTSGTL
Sbjct: 453  MQLAGIPEMSFDYWAMQFIQHGYKVAKVDQRESMLAKEMREGNKGIVKRELQHVLTSGTL 512

Query: 385  TDSEMLKSDLATYCVAVREEPITYYD---EEILALPKTGKYFGFAAIDTATGHIDLLEFE 441
            TDS ML+SD AT+C+AVREE  +YYD   E      K+ K +G A IDTATG I+LLEFE
Sbjct: 513  TDSGMLQSDHATFCLAVREEDGSYYDAGEESNGTSQKSAKVYGVAFIDTATGEIELLEFE 572

Query: 442  DDEECSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQ-RTSKEFYDFEKT 500
            DD+ECS+LDT+MSQ +P E+IMEK N+C+LA KI+K+NAQ +AI N  +  +EFYDF +T
Sbjct: 573  DDDECSKLDTLMSQVRPKEIIMEKGNLCNLAHKIVKYNAQSQAIFNYLKPQEEFYDFNRT 632

Query: 501  FDELITHE--YFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQVE 558
            FDEL + +  YF  MD+WP +L  YYE G+KVGF AFGGLL YL+WLKLD ++++MG ++
Sbjct: 633  FDELTSSDAKYFSGMDQWPEILTKYYEKGRKVGFSAFGGLLYYLKWLKLDEAMISMGNIK 692

Query: 559  EYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPL 618
            EYNPVRSQT L LDG+TLQNLEIF N+YD TD+G+LFKL+NRAITPMGKR L+KWV+ PL
Sbjct: 693  EYNPVRSQTSLVLDGVTLQNLEIFGNSYDNTDKGTLFKLVNRAITPMGKRMLKKWVIQPL 752

Query: 619  LKIEDINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRMLSRVHSCSLKIQYFNKVLCGF 678
            L+ +DI                               R L+R+HS +LKI+ FN+V+ GF
Sbjct: 753  LQKKDIEQRLDSVDLLLTDCDLRETLEETFSGLPDLERFLARIHSGNLKIKDFNRVIEGF 812

Query: 679  EDILALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAFDRNLAVKDGVIVPNRGVE 738
            E IL L+EKL  +  L GSLK +L ++P  L   +++WS AFDR  AV +GVIVP  GVE
Sbjct: 813  EAILQLLEKLQKY-QLTGSLKYFLEQVPQKLAECVKSWSGAFDRKKAVNEGVIVPEPGVE 871

Query: 739  PEFDESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWT 798
            PEFD+S+  I+ ++D+L+E L+ YKK  K S+IQ+KDSGKEIYTIEVPM+ATR +P +W 
Sbjct: 872  PEFDQSLQGIKELKDELEEYLSSYKKRFKCSSIQYKDSGKEIYTIEVPMSATRQIPSDWI 931

Query: 799  QMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAI 858
            QM ANKS KRYYS +V +LAR MAE +EMHK+LE+ LK+RLY KF  HY  VW+PT+ AI
Sbjct: 932  QMGANKSNKRYYSPEVAKLARSMAEGKEMHKILEEGLKSRLYNKFDTHYKDVWMPTLTAI 991

Query: 859  SNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKE 918
            S IDCI+SLARTSESLGFP CRPK V+ + P T  KLNG+I F+ELRHPCFN+G++++++
Sbjct: 992  SQIDCILSLARTSESLGFPCCRPKFVDDVDPVTGHKLNGFINFQELRHPCFNLGTTTSRD 1051

Query: 919  FIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIM 978
            FIPND+ LG D+ Q+GLLTGANAAGKSTVLRMTC+AVI+AQ+GCYIP E A  +P+DRIM
Sbjct: 1052 FIPNDISLGGDSHQIGLLTGANAAGKSTVLRMTCIAVIMAQIGCYIPAESATLSPIDRIM 1111

Query: 979  TRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHH 1038
            TRLGA+DNIMQGKSTFFVELSETKKILD  TNRSLLV+DELGRGGSSSDGFAIAE VLHH
Sbjct: 1112 TRLGANDNIMQGKSTFFVELSETKKILDTATNRSLLVLDELGRGGSSSDGFAIAEGVLHH 1171

Query: 1039 VATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESRNVTFLYKLVDGKSDGSFG 1098
            VATHIQSLGFFATHY  LG  F +HP VQPLKM ILVDEESR +TFLYKLV G+S+GSFG
Sbjct: 1172 VATHIQSLGFFATHYGGLGLGFKHHPKVQPLKMNILVDEESREITFLYKLVKGQSEGSFG 1231

Query: 1099 MHVASMCGIPRSVVDNASIAAENLEHTSKLIKERKNLHQSINP---VPLGLQSDVVRLVY 1155
            MHVASMCGI + +V+NA  AAEN EHTS LIKER+   + ++    +PLGLQSD+VRL +
Sbjct: 1232 MHVASMCGIGKEIVNNAQQAAENREHTSLLIKERQAADKGVSEEKMIPLGLQSDLVRLRH 1291

Query: 1156 GDGLTNSKGGTGEGVRVYDNN 1176
            GDGL+  K G GEGV  YDNN
Sbjct: 1292 GDGLSTQKLGCGEGVSFYDNN 1312

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 8/52 (15%)

Query: 5   TPK--SLKKVTTMPGSSGKKKYKQATISSFFKKREKPVESESNDTSPLKEKS 54
           TPK  S ++    P SSGKK +KQA++ SFF K       +++ ++PLKEK+
Sbjct: 62  TPKHNSKRRFAGSPQSSGKKNFKQASVLSFFSKH------KASASTPLKEKN 107

>YDR097C (MSH6) [947] chr4 complement(640103..643831) Component with
            Msh2p of DNA mismatch binding factor, involved in repair
            of single base mismatches [3729 bp, 1242 aa]
          Length = 1242

 Score = 1345 bits (3481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/983 (63%), Positives = 786/983 (79%), Gaps = 17/983 (1%)

Query: 204  PARKPLAYNPNRSLPATPKSQGKHTKFNKTNGERYQWLVHERDAEGRDKSDPDYDPRTLY 263
            P+R   +YNP+ S P+   +  K +KFNK N ERYQWLV ERDA+ R KSDP+YDPRTLY
Sbjct: 249  PSR---SYNPSHSQPS---ATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRTLY 302

Query: 264  IPGDAWSKFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRA 323
            IP  AW+KFTPFEKQYWEIKSKMWDCI+FFKKGKFFELYEKDA L + LFDLKIAGGGRA
Sbjct: 303  IPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRA 362

Query: 324  NMQLAGVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGT 383
            NMQLAG+PEMSF+YWA+QFIQ GYKVAKVDQ+ESMLAKEMREGSKGIV+RELQC+LTSGT
Sbjct: 363  NMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGT 422

Query: 384  LTDSEMLKSDLATYCVAVREEPITYYDE-----EILALPKTGKYFGFAAIDTATGHIDLL 438
            LTD +ML SDLAT+C+A+REEP  +Y+E       +      K FG A IDTATG + +L
Sbjct: 423  LTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQML 482

Query: 439  EFEDDEECSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQ-RTSKEFYDF 497
            EFEDD EC++LDT+MSQ +P EV+ME++N+ +LA KI+KFN+ P AI N+ +  +EFYD 
Sbjct: 483  EFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDC 542

Query: 498  EKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQV 557
            +KT+ E+I+ EYF + + WP VLKSYY+TGKKVGF AFGGLL YL+WLKLD +L++M  +
Sbjct: 543  DKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGLLYYLKWLKLDKNLISMKNI 602

Query: 558  EEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHP 617
            +EY+ V+SQ  + LDGITLQNLEIF+N++DG+D+G+LFKL NRAITPMGKR ++KW+MHP
Sbjct: 603  KEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHP 662

Query: 618  LLKIEDINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRMLSRVHSCSLKIQYFNKVLCG 677
            LL+  DI                               RML+R+HS ++K++ F KV+  
Sbjct: 663  LLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITA 722

Query: 678  FEDILALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAFDRNLAVKDGVIVPNRGV 737
            FE I+ L + L    DLKG +  Y++  P  L   +++W+NAF+R  A+ + +IVP RG 
Sbjct: 723  FETIIELQDSLK-NNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGF 781

Query: 738  EPEFDESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEW 797
            + EFD+SMDRIQ +ED+L E L  Y+K  K SNIQ+KDSGKEIYTIE+P++AT+NVP  W
Sbjct: 782  DIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNW 841

Query: 798  TQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQA 857
             QMAANK++KRYYS +V+ LAR MAEA+E+HK LE+DLKNRL +KF  HYN +W+PTIQA
Sbjct: 842  VQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQA 901

Query: 858  ISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAK 917
            ISNIDC++++ RTSE LG P+CRP +V+ +  +TN +LNG+++FK LRHPCFN+G+++AK
Sbjct: 902  ISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAK 961

Query: 918  EFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRI 977
            +FIPND+ LGK+ P+LGLLTGANAAGKST+LRM C+AVI+AQ+GCY+PCE A  TP+DRI
Sbjct: 962  DFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRI 1021

Query: 978  MTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLH 1037
            MTRLGA+DNIMQGKSTFFVEL+ETKKILD+ TNRSLLVVDELGRGGSSSDGFAIAE+VLH
Sbjct: 1022 MTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLH 1081

Query: 1038 HVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESRNVTFLYKLVDGKSDGSF 1097
            HVATHIQSLGFFATHY  L SSF +HP V+PLKM+ILVDE +RNVTFLYK+++G+S+GSF
Sbjct: 1082 HVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSF 1141

Query: 1098 GMHVASMCGIPRSVVDNASIAAENLEHTSKLIKER----KNLHQSINPVPLGLQSDVVRL 1153
            GMHVASMCGI + ++DNA IAA+NLEHTS+L+KER     NL+  +  VP GLQSD VR+
Sbjct: 1142 GMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVRI 1201

Query: 1154 VYGDGLTNSKGGTGEGVRVYDNN 1176
             YGDGL N+K G+GEGV  YD N
Sbjct: 1202 AYGDGLKNTKLGSGEGVLNYDWN 1224

>CAGL0G08129g complement(770779..774429) similar to sp|Q03834
            Saccharomyces cerevisiae YDR097c MSH6 DNA mismatch repair
            protein, start by similarity
          Length = 1216

 Score = 1272 bits (3291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/979 (63%), Positives = 762/979 (77%), Gaps = 17/979 (1%)

Query: 208  PLAYNPNRSLPATPKSQGKHTKFNKTNGERYQWLVHERDAEGRDKSDPDYDPRTLYIPGD 267
            P A  P  ++  T     K+  FNK N ERYQWLV ERDA+ R K DP+YDPRTLYIP  
Sbjct: 227  PPAAKPKFTMATTGP---KNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSS 283

Query: 268  AWSKFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRANMQL 327
            AW+KFTPFEKQYWEIKSKMWDCI+FFKKGKFFELYEKDA L + LFD K+AGGGRANMQL
Sbjct: 284  AWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQL 343

Query: 328  AGVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTLTDS 387
            AG+PEMSF++WASQFIQ GYKVAKVDQ+ESMLAKEMREGSKGIV+RELQCVLTSGTL D 
Sbjct: 344  AGIPEMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDG 403

Query: 388  EMLKSDLATYCVAVREEPITYYDEEILALPKTGKY---FGFAAIDTATGHIDLLEFEDDE 444
            +M+ SDLATYC+AVREEP  +YD   +  P +  Y   FG A IDT+TG + + EF DDE
Sbjct: 404  DMIHSDLATYCLAVREEPSNFYD---ITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDE 460

Query: 445  ECSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQ-RTSKEFYDFEKTFDE 503
            ECS+LDT+MSQ +P EVI+EK N+C+LA KI+KF A P A+ N  +  +EFYDFEKT +E
Sbjct: 461  ECSRLDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNE 520

Query: 504  LITHE--YFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQVEEYN 561
            L+ +E  YF + D WP+VLK+YY++ KKVGF AFGGLL YL+WLKLD SL++M    EYN
Sbjct: 521  LLANEEAYFGTADGWPSVLKNYYDSNKKVGFSAFGGLLYYLKWLKLDESLISMKNFTEYN 580

Query: 562  PVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKI 621
             V+SQ  + LDGI+LQNLEIF+N++DG+D+G+LFKL N +ITPMGKR +RKW+M+PLL  
Sbjct: 581  FVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLK 640

Query: 622  EDINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRMLSRVHSCSLKIQYFNKVLCGFEDI 681
            EDI                               R+LSR+H+ SLK++ F+KV+  FE+I
Sbjct: 641  EDIEKRQDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENI 700

Query: 682  LALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAFDRNLAVKDGVIVPNRGVEPEF 741
            L + +++    +L G+LKSY  +IP  L   ++ W +AFDR  AV++GVI+P  GVEP+F
Sbjct: 701  LQMTKEIES-NELHGALKSYFIQIPKQLENEVQHWESAFDRRKAVEEGVIIPEVGVEPDF 759

Query: 742  DESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQMA 801
            D+S+++++G+E++L   L  Y KLLK+SN+Q+KDSGKEIYTIEVP++AT+ VP  W QM 
Sbjct: 760  DKSLEKLEGLENELNLLLKSYMKLLKTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMG 819

Query: 802  ANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNI 861
            ANK+ KRYYS +V+ LAR +AEARE+HK LE+DL  RL +KF   Y+ VW+PT+  ++NI
Sbjct: 820  ANKNTKRYYSDEVRVLARSVAEARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANI 879

Query: 862  DCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIP 921
            DC++ L RTSESLG P+CRP + + + P T  K  G++ FK LRHPCFN+ S   K+FIP
Sbjct: 880  DCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIP 939

Query: 922  NDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRL 981
            NDV LG  +P +GLLTGANAAGKSTVLRMTC+AVI+AQLGCY+P E A  TP+DRIMTRL
Sbjct: 940  NDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRL 999

Query: 982  GASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVAT 1041
            GA+DNIMQGKSTFFVELSETK+ILDL TNRSLLV+DELGRGGSS+DGF+IAE+VLHHVAT
Sbjct: 1000 GANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVAT 1059

Query: 1042 HIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESRNVTFLYKLVDGKSDGSFGMHV 1101
            HIQSLGFFATHY +LG SF +HP ++P+KM+ILVDE +RNVTFLYKLVDG+S+GSFGMHV
Sbjct: 1060 HIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHV 1119

Query: 1102 ASMCGIPRSVVDNASIAAENLEHTSKLIKERKN-LHQSINP---VPLGLQSDVVRLVYGD 1157
            ASMCGI +S+VDNA  AA+NLEHTS+LIKERK  L    +P   VPLGLQSD  RL +GD
Sbjct: 1120 ASMCGIAKSIVDNAQSAADNLEHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGD 1179

Query: 1158 GLTNSKGGTGEGVRVYDNN 1176
            GL N   GTGEGV VYDNN
Sbjct: 1180 GLNNKSVGTGEGVLVYDNN 1198

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 53/101 (52%), Gaps = 13/101 (12%)

Query: 5   TPKSLKKVTTMPGSSGKKKYKQATISSFFKKREKPVESESNDT---SPLKEKSETDAKKK 61
           TPK+ KK     GSS +KK KQ+T+ SFF K+  P  S+S      SP   +SE + +K 
Sbjct: 6   TPKANKKKVGNTGSS-QKKLKQSTLLSFFSKQTSPSVSKSKTKVFPSPKSRESEKEDQKS 64

Query: 62  ----DTTSKGPLQFKHQPEVVEKEPATKTEPSKPEATKTVE 98
               D  +K     ++  EV + EPAT+   + P A+  VE
Sbjct: 65  LFVTDEDTK-----ENVSEVAQPEPATEISKASPVASVAVE 100

>Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement
          Length = 1060

 Score =  226 bits (576), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 226/906 (24%), Positives = 402/906 (44%), Gaps = 127/906 (14%)

Query: 270  SKFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHL-GHHLFDLKIAGG-------- 320
            +  TP ++QY ++K K  D IL  + G  ++ + +DA +    L ++ I G         
Sbjct: 178  NNLTPLDQQYKDLKLKNMDKILAVRVGYKYKFFAQDAVIVTQILHNMLIPGKLTIDDSDP 237

Query: 321  -GRANMQLA--GVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVERELQC 377
              +   Q A   +P+   +    + I Y  K+  V+Q E+   K+   G   + ERE+  
Sbjct: 238  QDKLYKQFAYCSIPDNRLNIHLQKLIHYNLKIGVVEQVETSAVKKNNGGGSSVFEREVTN 297

Query: 378  VLTSGTLTDSEMLKSDLATYCVAVREEPITYYDEEILALPKTGKYFGFAAIDTATGHIDL 437
            V T  T   +E   S        V  E  T +     +  K   Y+   ++   +G +  
Sbjct: 298  VFTRATYGINENFGSSEK----HVIGESNTIWGLHFESESKYKNYW-LISVKVNSGEVTY 352

Query: 438  LEFEDDEECS-QLDTIMSQFKPTEVIMEKS---NVCSLAQKIIKFNAQPEAIINQRTSKE 493
             EF+++   + QL+T +   +P EV+ +     +VC + ++       P+    Q   + 
Sbjct: 353  DEFKEEVALNEQLETRLKYLEPIEVVSKNELPHDVCKIFRR-----ENPDIKFYQSDPEN 407

Query: 494  FYDFEKTF-DELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLV 552
                EK   D+L   E  + + +                      L  YL+   ++  L 
Sbjct: 408  DSCLEKVLVDKLGLSERLRQVTQI---------------------LYRYLKTYSIENVLK 446

Query: 553  TMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRK 612
              G  + ++   S+T + L   TL++LEIF N  D   +GSL  +++   T  G ++L+ 
Sbjct: 447  ITGNFKAFS---SKTHMTLSAGTLESLEIFNNHTDKGVKGSLIWVLDHTRTAFGFQQLKD 503

Query: 613  WVMHPLLKIEDINXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXRMLSRV---HSCSLK 667
            W+  PL+ ++DI                                 R+L+R+    +   +
Sbjct: 504  WIAKPLIHLKDIEDRLDAIECITTEVNMIFVESLNNMLKDTPDLLRILNRITYGKTSRKE 563

Query: 668  IQYFNKVLCGFEDILA----------------LVEKLSIFADLKGSLKSYLTE--IPSSL 709
            + +F K +  F  + A                +  K  +  +L   L +YL E  IP  L
Sbjct: 564  VYFFLKHINLFVKLFADHYKYLEEHIYSKIGRVATKSILLTELFKELDTYLKECQIPKLL 623

Query: 710  TTVLEAWSNAFDRNLAVKDGVIVP----NRGVEPEFDESMDR-IQGIEDQLQECLTQYKK 764
            + +  A     D+N   ++   V     N    PE   S  R I  +  +L E L + ++
Sbjct: 624  SMINVAA--VMDKN---QEAACVEFFNLNNYDNPERIISRQRNIDEVRTELDEELQKIRR 678

Query: 765  LLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQMAANKSFKRYYSADVQRLARQMAEA 824
            +LK   + +KD     + IEV     +NVP  W ++ + K   R+ + +  +L  ++   
Sbjct: 679  ILKRPMLNYKDDID--FLIEVRNTQVKNVPVSWVKINSTKMVSRFRTPETTKLVEKLQYH 736

Query: 825  REMH-KVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNIDCIISLARTSESLGFPACRPKL 883
            +E+  KV E++  + L +   N+ +      IQ ++  DCI+SLA TS ++ +   RP  
Sbjct: 737  KELLIKVAEEEYLDFLKRIGENYMDLK--KAIQNLATYDCILSLAATSSNVNY--VRP-- 790

Query: 884  VEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAG 943
                   T +    +++ K  R+P      S    ++PND+ + +   ++ ++TG N  G
Sbjct: 791  -------TFKAEKQHLKIKNGRNPII---ESLDVNYVPNDIEMTQKMNKVMVITGPNMGG 840

Query: 944  KSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKK 1003
            KS+ +R   + VI++Q+G ++P E AE +  D I TR+GA+DNI++G+STF+VE+ E  +
Sbjct: 841  KSSYIRQVAIIVIMSQVGAFVPAESAELSLCDAIYTRIGATDNILRGESTFYVEMLEMLQ 900

Query: 1004 ILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQS--LGFFATHYAALGSSFT 1061
            IL   T  SLL++DE+GRG  ++DG AI  ++L       +   L  F THY  LG+   
Sbjct: 901  ILKSCTENSLLLLDEVGRGTGTTDGIAITYSILKFFLELQEKCPLILFTTHYPVLGT--- 957

Query: 1062 NHPNVQPLKMAILVD------EESR------NVTFLYKLVDGKSDGSFGMHVASMCGIPR 1109
                   +K  +L +      EE R      +V FLYKL  G +  S+G++VA +  +P 
Sbjct: 958  -------IKSKLLGNYHMSYIEEKRPNENWPSVVFLYKLRKGLAHNSYGLNVARLANVPT 1010

Query: 1110 SVVDNA 1115
            S+++ A
Sbjct: 1011 SIINRA 1016

>Kwal_56.22613
          Length = 956

 Score =  215 bits (547), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 199/768 (25%), Positives = 342/768 (44%), Gaps = 94/768 (12%)

Query: 423  FGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIM----EKSNVCSLAQKIIKF 478
             G + ID+++  I +L+  D+E  S L++ + Q    E ++       NV S  +K++  
Sbjct: 157  LGVSFIDSSSYKIGMLDIVDNEVYSNLESFLIQMGVRECLLPELRSNENVASELKKMVSV 216

Query: 479  NAQPEAIINQRTSKEFY--DFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFG 536
              +   +     + EF   D E+   +L+  E   S+ ++  +              A G
Sbjct: 217  LDRCGCVSTFVKNSEFAPKDVEQDLIKLVGDELSMSLMKFSNL--------------ALG 262

Query: 537  GLLSYLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIF-------------- 582
               + L +L+L  S   +G+ E      ++  + LD   L+ L IF              
Sbjct: 263  SCNALLNYLQLMNSESQLGRYELVQHSLTE-FMKLDASALKALNIFPVGPATTSGPPVAH 321

Query: 583  ANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDINXXXXXXXXXXXXXXXXX 642
             NT       S+F+L+N+  T  G R L +W+  PL  +E I                  
Sbjct: 322  GNTSSTGKISSIFQLLNKCKTNAGIRLLNEWLKQPLTDLEAIQKRHDLVEFLIDQLELRQ 381

Query: 643  XXXXXXXXXXXXXRMLSRVHSCSLKIQYFNKVLCGFEDILALVEKLSIFADLKGSLKSYL 702
                         R L++           NK     ED+L + +      ++   L+ YL
Sbjct: 382  VLQTDYLPAVPDVRRLTK---------KLNKN-GNLEDVLKIYQFAQKVPEVSKVLEEYL 431

Query: 703  TEIPSSL---TTVLEAWSNAFDRNLAVKDGV--IVPNR------------GVEPEFDESM 745
             ++       + V+E W    + ++A  D    +V                ++ +F+E +
Sbjct: 432  KDVSDDSHIKSLVMETWHQPLNAHIAPLDKFQEMVETTVDLDAYEDTNEFMIKVDFNEDL 491

Query: 746  DRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEI-----YTIEVPMAATRN------VP 794
             +I+G  D L+E +     L  + ++ F D  K++     +     M  TRN        
Sbjct: 492  AKIRGELDVLKENIKSIH-LDAAEDLGF-DPEKKLKLENHHMHGWCMRLTRNDGKALRQH 549

Query: 795  HEWTQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPT 854
             ++ +++  K+   + + +++++A Q A  ++ +  L+ DL   + +  T  Y  V    
Sbjct: 550  KKYLELSTVKAGIYFSTKELKQIAEQTAALQKEYDRLQSDLVKEIVQ-ITLTYTPVLEKL 608

Query: 855  IQAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSS 914
               ++N+D + S A  S     P  RP L+ GL  +   +L G       RHP   +   
Sbjct: 609  SIVLANLDVLSSFAHVSSYAPIPYVRP-LMHGLGTQRKTELIGS------RHPVLEVLDD 661

Query: 915  SAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPV 974
                FI NDV L K   +  ++TG N  GKST +R   V  ++AQ+GC++PC+ AE   V
Sbjct: 662  VT--FISNDVKLEKGKNEFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCDTAEIAVV 719

Query: 975  DRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEA 1034
            D ++ R+GA D+ ++G STF VE+ ET  IL   T  SL++VDELGRG S+ DGF +A +
Sbjct: 720  DAVLCRVGAGDSQLKGVSTFMVEMLETASILKNATENSLIIVDELGRGTSTYDGFGLAWS 779

Query: 1035 VLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDE------ESRNVTFLYKL 1088
            +  H+A+ I+    FATH+  L S     P V+ + +   +++       S ++T LYK+
Sbjct: 780  ISEHIASKIKCFALFATHFHELTSLADQIPTVKNMHVIAHIEDAEKSNHNSEDITLLYKV 839

Query: 1089 VDGKSDGSFGMHVASMCGIPRSVVDNASIAA---ENLEHTSKLIKERK 1133
              G SD SFG+HVA +   PR +V  A   A   E L+H S+ +K++K
Sbjct: 840  EPGISDQSFGIHVAEVVQFPRKIVSMAKRKAAELEELKHDSQTLKKQK 887

>YCR092C (MSH3) [615] chr3 complement(276760..279903) Component of DNA
            mismatch binding factor along with Msh2p, involved in
            mismatch repair involving microsatellite (short repeat)
            sequences [3144 bp, 1047 aa]
          Length = 1047

 Score =  214 bits (546), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 226/947 (23%), Positives = 411/947 (43%), Gaps = 128/947 (13%)

Query: 270  SKFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGG--------- 320
            +K TP +KQ  ++K    D +L  + G  ++ + +DA     +  +K+  G         
Sbjct: 159  AKLTPLDKQVKDLKMHHRDKVLVIRVGYKYKCFAEDAVTVSRILHIKLVPGKLTIDESNP 218

Query: 321  ---GRANMQLAGVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSK--GIVEREL 375
                         P++  +    + + +  KVA V+Q E+   K+   G+    + ER++
Sbjct: 219  QDCNHRQFAYCSFPDVRLNVHLERLVHHNLKVAVVEQAETSAIKKHDPGASKSSVFERKI 278

Query: 376  QCVLTSGTLTDSEMLKSDLATYCVAVREEPITYYDEEILALP------KTGKYFGFAAID 429
              V T  T                 +R + I      I AL       K  KY    +++
Sbjct: 279  SNVFTKATFG---------VNSTFVLRGKRILGDTNSIWALSRDVHQGKVAKY-SLISVN 328

Query: 430  TATGHIDLLEFEDDEECSQ-LDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQ 488
               G +   EFE+     + L   +   +P EV++   ++     K  K  + P      
Sbjct: 329  LNNGEVVYDEFEEPNLADEKLQIRIKYLQPIEVLVNTDDLPLHVAKFFKDISCP------ 382

Query: 489  RTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYL-QWLKL 547
               K+ YD E   D ++  +  K M+    +  S      K+  H    ++ Y  + + L
Sbjct: 383  LIHKQEYDLE---DHVV--QAIKVMNEKIQLSPSLIRLVSKLYSH----MVEYNNEQVML 433

Query: 548  DTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGK 607
              S+        Y+P  S+  + LD  +LQ+L+IF  T+DG  +GSLF L++   T  G 
Sbjct: 434  IPSI--------YSPFASKIHMLLDPNSLQSLDIF--THDG-GKGSLFWLLDHTRTSFGL 482

Query: 608  RKLRKWVMHPLL---KIEDINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRMLSRVH-- 662
            R LR+W++ PL+   +IE+                                R L+R+   
Sbjct: 483  RMLREWILKPLVDVHQIEERLDAIECITSEINNSIFFESLNQMLNHTPDLLRTLNRIMYG 542

Query: 663  -SCSLKIQYFNKVLCGFEDILALVEK--------------------LSIFADLKGSLKSY 701
             +   ++ ++ K +  F D   + +                       +F++L   L + 
Sbjct: 543  TTSRKEVYFYLKQITSFVDHFKMHQSYLSEHFKSSDGRIGKQSPLLFRLFSELNELLST- 601

Query: 702  LTEIPSSLTTVLEAWSNAFDRNLAVKDGVIVPNRGVEPEFDESMDRIQGIEDQLQECLTQ 761
             T++P  LT +  +     + +  V D   + N        +     + +  QL+E L +
Sbjct: 602  -TQLPHFLTMINVSAVMEKNSDKQVMDFFNLNNYDCSEGIIKIQRESESVRSQLKEELAE 660

Query: 762  YKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQMAANKSFKRYYSADVQRLARQM 821
             +K LK   + F+D     Y IEV  +  +++P +W ++   K   R+ +   Q+L +++
Sbjct: 661  IRKYLKRPYLNFRDEVD--YLIEVKNSQIKDLPDDWIKVNNTKMVSRFTTPRTQKLTQKL 718

Query: 822  AEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNI---DCIISLARTSESLGFPA 878
               +++  + E +L+   YK+F N   A +    +   N+   DCI+SLA TS ++ +  
Sbjct: 719  EYYKDL-LIRESELQ---YKEFLNKITAEYTELRKITLNLAQYDCILSLAATSCNVNY-- 772

Query: 879  CRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTG 938
             RP  V G            I  K  R+P      S    ++PND+++  +  ++ ++TG
Sbjct: 773  VRPTFVNGQQA---------IIAKNARNPII---ESLDVHYVPNDIMMSPENGKINIITG 820

Query: 939  ANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVEL 998
             N  GKS+ +R   +  I+AQ+G ++P EE   +  + ++TR+GA D+I+ G STF VE+
Sbjct: 821  PNMGGKSSYIRQVALLTIMAQIGSFVPAEEIRLSIFENVLTRIGAHDDIINGDSTFKVEM 880

Query: 999  SETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQS-LGFFATHYAALG 1057
             +   IL     RSLL++DE+GRG  + DG AI+ A++ + +      L  F TH+  LG
Sbjct: 881  LDILHILKNCNKRSLLLLDEVGRGTGTHDGIAISYALIKYFSELSDCPLILFTTHFPMLG 940

Query: 1058 SSFTNHPNVQPLKMAILVDEES----RNVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVD 1113
                  P ++   M  + ++++     +V FLYKL  G +  S+GM+VA +  + + +++
Sbjct: 941  E--IKSPLIRNYHMDYVEEQKTGEDWMSVIFLYKLKKGLTYNSYGMNVAKLARLDKDIIN 998

Query: 1114 NASIAAENLEHTSKLIKERKNLHQSINPVPLGLQSDVVRLVYGDGLT 1160
             A   +E L         RK   +SIN   L L S + R++  D +T
Sbjct: 999  RAFSISEEL---------RK---ESINEDALKLFSSLKRILKSDNIT 1033

>KLLA0C18590g complement(1642291..1645380) similar to sp|P25336
            Saccharomyces cerevisiae YCR092c MSH3 DNA mismatch repair
            protein, hypothetical start
          Length = 1029

 Score =  202 bits (515), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 208/379 (54%), Gaps = 25/379 (6%)

Query: 748  IQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQMAANKSFK 807
            I+ ++ +L + L   K++LK   + +KD+    Y IEV     + VP  W ++ + K+  
Sbjct: 629  IEEVKTELDDELQNIKRVLKRPTLSYKDTKD--YLIEVRNTQAKTVPSNWVKVNSTKAVS 686

Query: 808  RYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNIDCIISL 867
            R+ +   + L  ++    ++  +L +D   R  ++  + Y  +    I  ++  DCI+SL
Sbjct: 687  RFRTPKTEELVGKLLYHNDLLNLLAEDEFKRFLQRIVDRYAEIK-TCINNLATYDCILSL 745

Query: 868  ARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIPNDVVLG 927
            A TS ++ +   +PKL E LH +        ++ K  R+P      S    ++PNDV++ 
Sbjct: 746  AATSSNVNY--VKPKLTE-LHQK--------VKVKNGRNPII---ESLDVNYVPNDVLMS 791

Query: 928  KDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNI 987
             ++ ++ ++TG N  GKS+ +R   + VI+ Q+GCYIP + AE +  DRI TR+G+ D++
Sbjct: 792  SNSGKINIITGPNMGGKSSYIRQVALLVIMTQIGCYIPADSAEMSICDRIFTRIGSHDDL 851

Query: 988  MQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQS-- 1045
            +  KSTF VE+SE   IL+  T RSLL++DE+GRG  + DG +I+ A+L++      +  
Sbjct: 852  LNAKSTFQVEMSEVLHILNSSTPRSLLLLDEVGRGTGTHDGLSISFAILNYFVYLADNCP 911

Query: 1046 LGFFATHYAALGSSFTNHPNVQPLKMAILVD----EESRNVTFLYKLVDGKSDGSFGMHV 1101
            L  F THY+AL     +   +    M+ +      E+  NV FLYKLV G++  S+G +V
Sbjct: 912  LVLFITHYSALCQ--IDSKLIANYHMSYIEKHQPGEKWTNVIFLYKLVLGQAHNSYGFNV 969

Query: 1102 ASMCGIPRSVVDNASIAAE 1120
            A +  IP  +++ A   +E
Sbjct: 970  AKLSNIPTEIINRAFEVSE 988

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 85/383 (22%), Positives = 148/383 (38%), Gaps = 77/383 (20%)

Query: 271 KFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRA------- 323
           K T  ++Q+ E+K K  D IL  + G  ++ + KDA +  ++  +K+  G +        
Sbjct: 148 KLTELDQQFKELKLKHMDTILCVRVGYKYKFFAKDAEIVSNILQIKLVPGKKTLDESDPN 207

Query: 324 -----NMQLAGVPEMSFDYWASQFIQYGYKVAKVDQKE-SMLAKEMREGSKGIVERELQC 377
                  Q   +P+        + + + YKVA V+Q E S L K    GS  +  RE++ 
Sbjct: 208 DRNYRKFQYCSIPDTRLHVHLQRLVFFNYKVAVVEQTETSALKKNNNSGS--LFTREIKN 265

Query: 378 VLT------SGTLTDSE--MLKSDLATYCVAVREEPITYYDEEILALPKTGKYFGFAAID 429
           + T      + T   SE  +L    + + +++ E                 +     ++ 
Sbjct: 266 IFTKVSYGINETFDKSEDRILGDLTSVWAISINE-------------TSKMRKVNLISVQ 312

Query: 430 TATGHIDLLEFEDDEECS-QLDTIMSQFKPTEVIME-------KSNVCSLAQKIIKFNAQ 481
             +G I   +F DD   +  L+  +    PTE+I E       ++    L Q I  + + 
Sbjct: 313 LNSGEIVHDQFSDDILLNVNLEARIRYLNPTEIITEEELPPSIRTIFTKLNQDIQFYQSH 372

Query: 482 PEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSY 541
            EA  N             FD L   +    + R  +VL SY  T +      F      
Sbjct: 373 KEACPN------------LFDALQGLDLNNELKRLLSVLHSYLSTFENTKVLYFAS---- 416

Query: 542 LQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRA 601
                             Y+   ++  + L   T+++LEIF N+      GSL  +++  
Sbjct: 417 -----------------NYSSFTAKNFMVLPRNTIESLEIFENSTTNKTNGSLLWVMDHT 459

Query: 602 ITPMGKRKLRKWVMHPLLKIEDI 624
            T  G R LRKW+  PL+ ++ I
Sbjct: 460 RTQFGYRLLRKWISKPLIDLKSI 482

>CAGL0I07733g 742340..745213 highly similar to sp|P25847 Saccharomyces
            cerevisiae YOL090w MSH2 DNA mismatch repair protein,
            start by similarity
          Length = 957

 Score =  197 bits (502), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 118/329 (35%), Positives = 179/329 (54%), Gaps = 23/329 (6%)

Query: 819  RQMAEAREMHKVLEDD---LKNRLYKKF---TNHYNAVWLPTIQAISNIDCIISLARTSE 872
            R+M E  +   VL+ D   L++ L K+    T  Y  ++      I+++D + S A  S 
Sbjct: 569  RKMKEIAQETVVLQKDYERLQSSLVKEIVSITLTYTPIFEKLSLVIAHLDVLCSFAHASS 628

Query: 873  SLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQ 932
                P  RP +    HP ++++     +    RHP   +       FI NDV + KD  +
Sbjct: 629  YAPIPYVRPTM----HPLSSDR---RTKLMNSRHPVLEVQDDVT--FIANDVDMAKDVSE 679

Query: 933  LGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGKS 992
              ++TG N  GKST +R   V  ++AQ+GC++PC+ AE + VD I+ R+GA D+ ++G S
Sbjct: 680  FQIITGPNMGGKSTYIRQVGVITLMAQIGCFVPCDNAEISIVDAILCRVGAGDSQLKGVS 739

Query: 993  TFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQSLGFFATH 1052
            TF VE+ ET  IL   T+ SL++VDELGRG S+ DGF +A A+  H+A  I+    FATH
Sbjct: 740  TFMVEMLETASILKNATSNSLIIVDELGRGTSTYDGFGLAWAIAEHIAKEIRCFALFATH 799

Query: 1053 YAALGSSFTNHPNVQPLKMAILVDE-----ESRNVTFLYKLVDGKSDGSFGMHVASMCGI 1107
            +  L +     PNV+ + +   +DE      S ++T LYK+  G SD SFG+HVA +   
Sbjct: 800  FHELTNLSEQLPNVKNMHVIAHIDESEKALNSNDITLLYKVEPGISDRSFGIHVAEVVQF 859

Query: 1108 PRSVVDNASIAA---ENLEHTSKLIKERK 1133
            P+ +V  A   A   E L++TS  +K  K
Sbjct: 860  PKKIVSMAKRKANELEELKNTSNDLKRAK 888

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 83/213 (38%), Gaps = 27/213 (12%)

Query: 423 FGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIM----EKSNVCSLAQKIIKF 478
            G   IDT+   I +++  D+E  S L++ + Q    E ++    +  +     +KI   
Sbjct: 157 LGLTFIDTSNYKIGMMDIIDNEAYSNLESFLIQLGIRECLVPDLSQNGSTNPELKKITNV 216

Query: 479 NAQPEAIINQRTSKEFY--DFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFG 536
             +  +++    + EF   D E    +L+ ++   ++           +   ++   A  
Sbjct: 217 IDRCGSVVTIVPNSEFSNKDVEVDLAKLLGNDLTLTLP----------QNVSQLALGACN 266

Query: 537 GLLSYLQWLKLDTSL----VTMGQVEEYNPVRSQTCLALDGITLQNLEIF-------ANT 585
            LL+YLQ L     L    +    +E    + S    AL+     N   F         +
Sbjct: 267 ALLNYLQLLSEQEMLGKYELIQHSLESIMKLDSSAIKALNLFPQNNATFFTPMQSGTVGS 326

Query: 586 YDGTDRGSLFKLINRAITPMGKRKLRKWVMHPL 618
             GT   SLF+L+N   T  G R L +W+  PL
Sbjct: 327 NGGTKVASLFQLLNNCKTNSGVRLLNEWLKQPL 359

>ADR168C [1910] [Homologous to ScYCR092C (MSH3) - SH]
            (997371..1000469) [3099 bp, 1032 aa]
          Length = 1032

 Score =  194 bits (492), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 213/390 (54%), Gaps = 38/390 (9%)

Query: 738  EPEFDESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEI-YTIEVPMAATRNVPHE 796
            EP   +  D I+ +  +L++ L   + +LK   + +KD   EI + +E+      +VP +
Sbjct: 614  EPLISKQQD-IEAVIGELRDELKNIRVILKRPMLNYKD---EIDFLVEIRNTQVSSVPVD 669

Query: 797  WTQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQ 856
            W ++A+ K+  R+ +    +L  ++    + HK L  DL  + Y+ F       +    +
Sbjct: 670  WVKVASTKAVSRFQTPGTAKLVAKL----QYHKELLQDLALQEYESFIKRITGEYTSLRK 725

Query: 857  AI---SNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGS 913
            AI   S  DCI+SLA TS ++ +   RPK      P+    +NG       R+P      
Sbjct: 726  AILHLSTYDCILSLAATSCNVDY--VRPKF--NTAPQCINVING-------RNPII---E 771

Query: 914  SSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTP 973
            S    ++PNDV L ++  ++ ++TG N  GKS+ +R   + VI+AQ+GCY+P +EAEF+ 
Sbjct: 772  SLDVRYMPNDVNLNREGKKIMIITGPNMGGKSSYIRQVALLVIMAQIGCYVPAQEAEFSI 831

Query: 974  VDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAE 1033
             D+I TR+GA DN+++  STF +E++E  +IL   T  SLL++DE+GRG  + DG +I+ 
Sbjct: 832  FDQIFTRIGAYDNLLRNDSTFKIEMTEMVQILRSSTENSLLLLDEVGRGTGTHDGISISY 891

Query: 1034 AVLHH-VATHIQS-LGFFATHYAALGSSFTNHPNVQPLKMAILVDEESR------NVTFL 1085
            A+L + +  H    L  F THYA+LGS     P +    M+ +  EE R      +V FL
Sbjct: 892  ALLRYFIELHNACPLILFITHYASLGS--IRSPILGNYHMSYI--EEKRPGENWPSVVFL 947

Query: 1086 YKLVDGKSDGSFGMHVASMCGIPRSVVDNA 1115
            YKL +G++  S+G++VA +  I   +++ A
Sbjct: 948  YKLKEGRAHNSYGLNVAKLADIQTGIINRA 977

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/411 (18%), Positives = 163/411 (39%), Gaps = 58/411 (14%)

Query: 235 GERYQWLVHERDAEGRDKSDPDYDPRTLYIPGDAWSKFTPFEKQYWEIKSKMWDCILFFK 294
            ER Q ++  R+    ++ + + D           ++ T  ++Q+ ++K +  D +L  +
Sbjct: 103 AERLQRIMERREGGCVEEDETELDNEAPRSKRAKPNRLTELDQQFKDLKLQHMDKVLAVR 162

Query: 295 KGKFFELYEKDAHLGHHLFDLKIAGGG------------RANMQLAGVPEMSFDYWASQF 342
            G  ++ + +DA +   +  +K+  G                     +P+   +    + 
Sbjct: 163 VGYKYKFFAEDAVMVSRVLQIKLVPGKLTVHETDPADHKHKKFAYCTIPDTRLEVHLQRL 222

Query: 343 IQYGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTL--------TDSEMLKSDL 394
           + +  KV  V+Q E+   K+    S  +  RE+  + T  T          D  +L    
Sbjct: 223 MHHNLKVGVVEQTETSAVKKNSGTSSSVFSREVTNIFTRATYGINETFGTKDRRVLGDSA 282

Query: 395 ATYCVAVREEPITYYDEEILALPKTGKYFGFAAIDTATGHIDLLEFEDDEECSQ-LDTIM 453
           + + +  + +P               +YF   +++  +G +   +F+++   ++ L+T +
Sbjct: 283 SVWGLVCKRQP------------SYTRYF-LVSVNLNSGEVIFDDFKEERFLTEALETRI 329

Query: 454 SQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQRTSKEFYDFEKTFDELITHEYFKSM 513
               P+EV++       L  +I K     ++ I     +    +E+ F E   H  FK  
Sbjct: 330 KYTNPSEVVVGDG----LGSEIEKVFHTSDSDITLNRIELVGLYEEIFSE--PHPAFKGN 383

Query: 514 DRWPTVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDG 573
               T L   +                YL   K ++ L      E + P  S+T + L  
Sbjct: 384 VPLQTALMLVH---------------GYLTNFKNESLLFFK---ENFKPFCSKTHMILPS 425

Query: 574 ITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDI 624
             +++L+IF N+ D + +GSL  +++   T  G R L+ W+  PL+ I+ I
Sbjct: 426 SAIESLDIFENSTDRSSKGSLLWVLDHTRTNYGLRNLKNWIAKPLINIDQI 476

>YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3p and
            Msh6p of DNA mismatch binding factor, involved in repair
            of single base mismatches and short insertions/deletions
            [2895 bp, 964 aa]
          Length = 964

 Score =  189 bits (480), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 107/284 (37%), Positives = 152/284 (53%), Gaps = 16/284 (5%)

Query: 847  YNAVWLPTIQAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRH 906
            Y  V+      ++++D I S A TS     P  RPKL    HP  +E+    I     RH
Sbjct: 606  YTPVFEKLSLVLAHLDVIASFAHTSSYAPIPYIRPKL----HPMDSERRTHLISS---RH 658

Query: 907  PCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPC 966
            P   M    +  FI NDV L        ++TG N  GKST +R   V  ++AQ+GC++PC
Sbjct: 659  PVLEMQDDIS--FISNDVTLESGKGDFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPC 716

Query: 967  EEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSS 1026
            EEAE   VD I+ R+GA D+ ++G STF VE+ ET  IL   +  SL++VDELGRG S+ 
Sbjct: 717  EEAEIAIVDAILCRVGAGDSQLKGVSTFMVEILETASILKNASKNSLIIVDELGRGTSTY 776

Query: 1027 DGFAIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDE-------ES 1079
            DGF +A A+  H+A+ I     FATH+  L       PNV+ + +   +++       + 
Sbjct: 777  DGFGLAWAIAEHIASKIGCFALFATHFHELTELSEKLPNVKNMHVVAHIEKNLKEQKHDD 836

Query: 1080 RNVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASIAAENLE 1123
             ++T LYK+  G SD SFG+HVA +   P  +V  A   A  L+
Sbjct: 837  EDITLLYKVEPGISDQSFGIHVAEVVQFPEKIVKMAKRKANELD 880

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 91/229 (39%), Gaps = 42/229 (18%)

Query: 423 FGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIME----KSNVCSLAQKIIKF 478
            G A IDT    + +L+  D+E  S L++ + Q    E +++     SN  +  QK+I  
Sbjct: 157 IGVAFIDTTAYKVGMLDIVDNEVYSNLESFLIQLGVKECLVQDLTSNSNSNAEMQKVINV 216

Query: 479 NAQPEAIINQRTSKEFY--DFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFG 536
             +   ++    + EF   D E    +L+        D     L   Y    K+   A  
Sbjct: 217 IDRCGCVVTLLKNSEFSEKDVELDLTKLLG-------DDLALSLPQKY---SKLSMGACN 266

Query: 537 GLLSYLQWLKLDTSLVTMGQVEEYNPV--RSQTCLALDGITLQNLEIF----ANTYDGTD 590
            L+ YLQ L          QV +Y  V  + +  + LD   ++ L +F     N +   +
Sbjct: 267 ALIGYLQLLS------EQDQVGKYELVEHKLKEFMKLDASAIKALNLFPQGPQNPFGSNN 320

Query: 591 RG--------------SLFKLINRAITPMGKRKLRKWVMHPLLKIEDIN 625
                           SLF+L+N   T  G R L +W+  PL  I++IN
Sbjct: 321 LAVSGFTSAGNSGKVTSLFQLLNHCKTNAGVRLLNEWLKQPLTNIDEIN 369

>CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces
            cerevisiae YCR092c DNA mismatch repair protein,
            hypothetical start
          Length = 1025

 Score =  189 bits (481), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 123/384 (32%), Positives = 209/384 (54%), Gaps = 37/384 (9%)

Query: 748  IQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQMAANKSFK 807
            I  ++ QL + L   KK+LK  ++ +KD     + IEV     + +P +W ++   K   
Sbjct: 626  IDSVKAQLHDELQNIKKILKRPHLAYKDEVD--FLIEVRNTQVKGIPSDWVKVNNTKMIS 683

Query: 808  RYYSADVQRLARQMAEAREMHKVLEDDLKNRL---YKKFTN----HYNAVWLPTIQAISN 860
            R+       L  +  E  E+ +   D L N +   Y +F N    +YN V    I  ++ 
Sbjct: 684  RF-------LTPRTKELVELLEYQNDLLYNEISKEYDQFLNRIASYYNEVK-TFIMNLAE 735

Query: 861  IDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFI 920
             DC++SLA  S ++G+   RP     +  ++NE+L   I  K+ R+P      S   +++
Sbjct: 736  YDCLLSLAAVSCNVGY--TRP-----VFTDSNEQL---IIAKQARNPII---ESLGVDYV 782

Query: 921  PNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTR 980
            PND+ + KD+ ++ ++TG N  GKS+ +R   + VI+AQ+G Y+P E  + +  D ++TR
Sbjct: 783  PNDIEMEKDSGRVLVITGPNMGGKSSYIRQIALMVIMAQIGSYVPAESLKLSVFDNVLTR 842

Query: 981  LGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVA 1040
            +G+ DNI+QG+STF VELSET +I++  T+++LL++DE+GRG S+ DG AIA A++ +  
Sbjct: 843  IGSQDNILQGQSTFKVELSETVEIINSCTSKTLLLLDEVGRGTSTRDGNAIAWALIKYFV 902

Query: 1041 THIQS-LGFFATHYAALGSSFTNHPNVQPLKMAILV----DEESRNVTFLYKLVDGKSDG 1095
               Q     F TH+  + +     P ++   M  +     +E    V FLY+L  G +D 
Sbjct: 903  EEEQCPFILFTTHFTIVTT--VKSPLLKSYHMNYVQHKNENENWTTVVFLYQLKAGVTDS 960

Query: 1096 SFGMHVASMCGIPRSVVDNASIAA 1119
            S+G++VA + GI   +++ A   A
Sbjct: 961  SYGLNVAKLAGIDTHIINRAHDVA 984

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/373 (20%), Positives = 148/373 (39%), Gaps = 69/373 (18%)

Query: 271 KFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRA------- 323
           + TP ++Q  ++K    D +L  + G  ++++ +DA +   +  L++  G          
Sbjct: 147 QLTPLDRQVKDLKLGNMDKVLVIRVGYKYKIFAQDAIIASTILHLQLIPGKVTIDDSNPN 206

Query: 324 -----NMQLAGVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEM--REGSKGIVERELQ 376
                       P++       + ++ G KVA V+Q E+   K+    +    + ER++ 
Sbjct: 207 DSKYKQFAYCSFPDVRLKVHLERLVRSGLKVAVVEQSETATTKKFDNSKAKTSVFERKI- 265

Query: 377 CVLTSGTLTDSEMLKSDLATYC-VAVREEPITYYDEEILALP-----KTGKYFGFAAIDT 430
               +GT +     K+  AT C   V  E I   +  I AL         KY+ ++ I  
Sbjct: 266 ----TGTYS-----KATYATNCEFEVNHENILGTNNSIWALDIEVSDSIYKYYLWS-IQL 315

Query: 431 ATGHIDLLEFEDDEE-CSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQR 489
           + G +    FE+ ++  S+++T M    P+E++    +   +  K               
Sbjct: 316 SNGEVIYDSFEESKDNFSKVETRMKYLNPSEIVSPVVDSFPIKLK--------------- 360

Query: 490 TSKEFYDFE---KTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYLQWLK 546
             K F D +   K +D L         +     L   +             L  YL+   
Sbjct: 361 --KRFLDLQLCQKNYDILAEDLNIPKKELLNNRLIELWHI-----------LYRYLKEYS 407

Query: 547 LDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMG 606
            +  L+ +G    Y     +  + L   T+ NL++ +N      +G+LF +++   TP G
Sbjct: 408 -NEKLLNIGS--NYRHFSQKISIQLQAQTINNLDLISN---DDSKGTLFWILDHTRTPFG 461

Query: 607 KRKLRKWVMHPLL 619
           KR L++W++ PLL
Sbjct: 462 KRLLKEWLLRPLL 474

>Scas_628.3
          Length = 959

 Score =  188 bits (478), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 183/355 (51%), Gaps = 27/355 (7%)

Query: 787  MAATRNVPHE------WTQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLY 840
            M  TRN   E      + +++  K+   + + +++ +A++  + ++ +    D L++ L 
Sbjct: 538  MRLTRNDAKELRKHRNYLELSTVKAGIFFSTKELKEIAQETIKLQKDY----DRLQSALV 593

Query: 841  KKF---TNHYNAVWLPTIQAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNG 897
            K+    T  Y  V     Q ++++D + S A  S     P  RPK+    HP  + +   
Sbjct: 594  KEIVGITVTYTPVLEKLSQVLAHLDVLCSFAHVSSYAPIPYVRPKM----HPFDSTRRTH 649

Query: 898  YIRFKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVIL 957
             +     RHP   M       FI NDV L        ++TG N  GKST +R   V  ++
Sbjct: 650  LVGS---RHPVLEMQDDLT--FISNDVDLVDGEGDFLIITGPNMGGKSTYIRQVGVISLM 704

Query: 958  AQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVD 1017
            AQ+GC++PCEEAE   VD I+ R+GA D+ ++G STF VE+ ET  IL   T  SL++VD
Sbjct: 705  AQIGCFVPCEEAEIAIVDAILCRVGAGDSQLKGVSTFMVEMLETASILKNATKNSLIIVD 764

Query: 1018 ELGRGGSSSDGFAIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDE 1077
            ELGRG S+ DGF +A A+  H+A+ I     FATH+  L S      NV+ + +   +++
Sbjct: 765  ELGRGTSTYDGFGLAWAIAEHIASKIGCFALFATHFHELTSLSDKFSNVKNMHVVAYIEK 824

Query: 1078 -----ESRNVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASIAAENLEHTSK 1127
                 ES ++T LYK+  G SD SFG+HVA +   P  +V  A   A  LE   K
Sbjct: 825  GTDQLESDDITLLYKVEPGISDQSFGIHVAEVVQFPDKIVKMAKRKASELEDLKK 879

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 84/217 (38%), Gaps = 35/217 (16%)

Query: 423 FGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIME----KSNVCSLAQKIIKF 478
            G A IDT+   I +L+  D+E  S L++ + Q    E I++      N     +KII  
Sbjct: 157 LGVAFIDTSNYKIGMLDIVDNEVYSNLESFLIQLGVRECIVQDLTNNENTSREFKKIIGV 216

Query: 479 NAQPEAIINQRTSKEFY--DFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFG 536
             +  +++    + EF   D E    +LI +E   S+       K Y      +   A  
Sbjct: 217 IDRCGSVVTLVKNSEFSEKDVEMDLTKLINNELSLSLP------KKY----SNLAMGACN 266

Query: 537 GLLSYLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFAN------------ 584
            LL YL+ L     L     +E       Q  + LD   ++ L +F              
Sbjct: 267 ALLGYLELLNEQDQLGKFELIEH----SLQEFMKLDASAIKALNLFPQGPVQPFGPTPTA 322

Query: 585 ---TYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPL 618
              T  G    SLF+L+N   T  G R L +W+  PL
Sbjct: 323 SFGTASGGKIASLFQLLNNCKTNAGIRLLNEWLKQPL 359

>AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH]
            (1524851..1527721) [2871 bp, 956 aa]
          Length = 956

 Score =  184 bits (467), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 149/270 (55%), Gaps = 11/270 (4%)

Query: 857  AISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSA 916
             ++N+D + S A  S     P  RP + + +H    +     +     RHP     +   
Sbjct: 610  VLANLDVLCSFAHVSSYAPIPYVRPVMYD-MHAGQRK-----MELLASRHPLVE--AQDE 661

Query: 917  KEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDR 976
              FI NDVVL  D+    ++TG N  GKST +R   V  +LAQ+GC++PC+ AE T VD 
Sbjct: 662  VTFISNDVVLEADSSGFAIITGPNMGGKSTYIRQVGVICLLAQIGCFVPCDAAEITIVDA 721

Query: 977  IMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVL 1036
            I+ R+GA D+ ++G STF  E+ ET  IL   T  SL+++DELGRG S+ DGF +A ++ 
Sbjct: 722  ILCRVGAGDSQLKGVSTFMAEMLETASILRNATKNSLIIIDELGRGTSTYDGFGLAWSIS 781

Query: 1037 HHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESR---NVTFLYKLVDGKS 1093
             H+A +I     FATH+  L +   + PNV  L +   V+E+S    ++T LYK+  G S
Sbjct: 782  EHIAKNIGCFALFATHFHELTALADDCPNVTNLHVVAHVEEKSHKSDDITLLYKVEPGIS 841

Query: 1094 DGSFGMHVASMCGIPRSVVDNASIAAENLE 1123
            D SFG+HVA +   P  +V  A   A  L+
Sbjct: 842  DQSFGIHVAEVVQFPSKIVKMAKRKATELD 871

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 86/211 (40%), Gaps = 26/211 (12%)

Query: 423 FGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIM-EKSNVCSLAQKIIKFNAQ 481
            G + +D+ +  I +L+  D+E  S  ++ + Q    E ++ +  N  S + ++ K    
Sbjct: 157 LGVSYVDSNSYKIGMLDIVDNEVYSNFESFLIQLGVKECLLPDLRNNESFSAELKKVTGV 216

Query: 482 PE---AIINQRTSKEFY--DFEKTFDELITHEYFKSMDRWPTV-------LKSYYETGKK 529
            E    ++    + EF   D E    +L   E   S+ R+  +       L  Y +    
Sbjct: 217 IERCGCVVTFVKNSEFNNKDVEADLAKLCGDELATSLPRFSKLALASCNALIGYQQLLNN 276

Query: 530 VGFHAFGGLLSYL--QWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYD 587
            G      ++ Y   +++KLD S V    +    P  +Q+ +A  G    N +I      
Sbjct: 277 AGNEGSYQIVEYSLSEFMKLDASAVKALSIFPQGP-STQSGMATSGKFGGNGKI------ 329

Query: 588 GTDRGSLFKLINRAITPMGKRKLRKWVMHPL 618
                SL +L+N+  T  G R L +W+  PL
Sbjct: 330 ----TSLLQLLNKCKTNAGVRLLNEWLKQPL 356

>KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1
            Kluyveromyces lactis mismatch repair protein Msh2p, start
            by similarity
          Length = 956

 Score =  181 bits (460), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/309 (35%), Positives = 164/309 (53%), Gaps = 22/309 (7%)

Query: 851  WLPTIQAIS----NIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKEL-- 904
            + P ++ +S     +D + S A+ S     P  RPK+    +P     LN   R  EL  
Sbjct: 599  YTPVLEKLSVVTAQLDILCSFAQVSSYAPIPYVRPKM----YP-----LNDQNRTTELIA 649

Query: 905  -RHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCY 963
             RHP   M       FI NDV L +   +  ++TG N  GKST +R   V  ++AQ+GC+
Sbjct: 650  SRHPIVEMQDDVT--FISNDVKLVQGDSEFIVITGPNMGGKSTYIRQIGVICLMAQIGCF 707

Query: 964  IPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGG 1023
            +PC+EA+   VD I+ R+GA D+ ++G STF +E+ ET  IL   T+ SL++VDELGRG 
Sbjct: 708  VPCDEAKIAAVDAILCRVGAGDSQLKGVSTFMMEMLETASILKNATHNSLVIVDELGRGT 767

Query: 1024 SSSDGFAIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDE----ES 1079
            S+ DGF +A ++  H+AT+I     FATH+  L +      NV  + +   +++     S
Sbjct: 768  STYDGFGLAWSISEHIATNINCFTLFATHFHELTTLADKLDNVSNMHVVAHIEDNGSHNS 827

Query: 1080 RNVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASIAAENLEHTSKLIKERKNLHQSI 1139
             ++T LYK+  G SD SFG+HVA +   P  +V+ A   A  LE   K     K    S 
Sbjct: 828  DDITLLYKVEAGSSDQSFGIHVAEVVQFPSKIVNMAKRKAAELEDLKKDNDSLKKAKLSP 887

Query: 1140 NPVPLGLQS 1148
              + LG +S
Sbjct: 888  EDIVLGTES 896

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 83/218 (38%), Gaps = 31/218 (14%)

Query: 423 FGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIM----EKSNVCSLAQKIIKF 478
            G + +D     I L +  D+E  S L++ + Q    E ++    +  ++ +  +KI+  
Sbjct: 160 IGVSFVDNTNYRIGLFDLLDNEVFSNLESCLIQLGIKECLIPDLRDNPSMANDLKKILSV 219

Query: 479 NAQPEAIINQRTSKEFY--DFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFG 536
             +   + +     +F   D E    +L   E   S+ ++                +  G
Sbjct: 220 IDRCSCVASFVKPSDFNGKDVEADLAKLCGDELSLSVSKFSA--------------NCLG 265

Query: 537 GLLSYLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDR----- 591
                L +L +  +   +G  E  +   SQ  + LD   ++ L +F     G        
Sbjct: 266 ACSVLLNYLNIMNNEANVGNFEVVDHSLSQF-VKLDASAIKALNVFPTGSQGNTALLSVG 324

Query: 592 -----GSLFKLINRAITPMGKRKLRKWVMHPLLKIEDI 624
                 SLF+L+NR  T  G R L +W+  PL  I+ I
Sbjct: 325 SPQKCSSLFQLLNRCKTNSGVRLLNEWLKQPLTDIDQI 362

>Kwal_23.6466
          Length = 1037

 Score =  180 bits (457), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 206/402 (51%), Gaps = 45/402 (11%)

Query: 748  IQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQMAANKSFK 807
            I+ ++++LQ  L   ++LLK     +KD  +  + IEV       +P +W ++ + K   
Sbjct: 635  IESVKEELQIELGNIRRLLKRPRFCYKDEIE--FLIEVRNTQLTGLPTDWIKVGSTKMVS 692

Query: 808  RYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNI---DCI 864
            R+ +    +L  Q+    + HK L   + +  +K+F  + ++ +L   + I N+   DC+
Sbjct: 693  RFKTPKTTKLIDQL----DYHKNLLVIICDEQFKRFLANISSQYLLLKEVIENLATFDCM 748

Query: 865  ISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIPNDV 924
            +SLA TS +  +   RP+  EG            ++ +  R+P      S    ++ NDV
Sbjct: 749  LSLAATSFNRQY--VRPQFCEGRRE---------MKIRNGRNPII---ESLDVNYVANDV 794

Query: 925  VLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGAS 984
             + +D  +L ++TG N  GKS+ +R   +  ILAQ+G ++P E A       I TR+GA 
Sbjct: 795  YMKEDQSKLLIITGPNMGGKSSFIRQVALISILAQVGSFVPAESANLPIFSNIFTRIGAH 854

Query: 985  DNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQ 1044
            DN+++G STF VE+ E   IL      SLL++DE+GRG  ++DG +I++A +++     +
Sbjct: 855  DNLIKGDSTFKVEMLEMLDILKNSDENSLLLLDEVGRGTGTTDGISISDATINYFIDMDK 914

Query: 1045 SLGF--FATHYAALGSSFTNHPNVQPLKMAILVDEESR------NVTFLYKLVDGKSDGS 1096
               F  F THY  LGS     P ++   M  +  EE R         FLYKL  G +  S
Sbjct: 915  KCPFILFITHYPILGS--IKSPLIENYHMGFM--EERRAGEKWPTAVFLYKLTQGIATDS 970

Query: 1097 FGMHVASMCGIPRSVVDNASI----------AAENLEHTSKL 1128
            +G++VA +  +P S+++NA +          AA+NL  TSKL
Sbjct: 971  YGLNVARLANLPMSIINNAYVVSEGVKAEMEAAKNLRFTSKL 1012

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 86/371 (23%), Positives = 160/371 (43%), Gaps = 48/371 (12%)

Query: 271 KFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGG---------- 320
           K TP ++Q  ++K +  D +L  + G  ++ +  DA +   +  + + GG          
Sbjct: 151 KLTPLDQQVKDLKLQHMDKVLAVRVGYKYKFFAMDAVIVSKILQIMLIGGKLTLDNSHPG 210

Query: 321 GRANMQLA--GVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVERELQCV 378
            RA  QLA   +P+        + + +  KV  V+Q E+   K+    S G+  R++  V
Sbjct: 211 DRAYKQLAYCSIPDNRLQVHIQRLLHHNLKVGVVEQTETQAIKKANGSSSGVFRRQVDKV 270

Query: 379 LTSGTLTDSEMLKSDLATYCVAVREEPITYYDEEILALPKTGKYFGF--AAIDTATGHID 436
            T  T + +E    + +   +   EE  T +    L + +  +++ F   ++  ++G + 
Sbjct: 271 FTKATFSINE----NFSRTQINPSEEINTIW---ALRVDEDDQFYHFWLFSVQLSSGEVI 323

Query: 437 LLEFEDDEECS--QLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQRTSKEF 494
             +F D+++    +L+  +S  +P E++  K  +  L    I+   QP+         +F
Sbjct: 324 YDQFSDNKKLVKLELEKRISYLQPIEIV-SKGTLSPLISTFIR-KRQPDV--------QF 373

Query: 495 YDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTM 554
           +D+    D L+           P V +     G  +         +  ++L+   +   M
Sbjct: 374 HDY----DSLL-----------PDVCEDDQVGGLNLEKELLELRNTLRRYLENYNTEKVM 418

Query: 555 GQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWV 614
                Y P  S+T + L   TL++LEIF N  DG  RGSL  L++   T  G R LR+W+
Sbjct: 419 DIPHNYKPFHSKTNMILSSNTLESLEIFENQTDGNSRGSLMWLLDHTRTSFGYRLLREWI 478

Query: 615 MHPLLKIEDIN 625
             PL   + IN
Sbjct: 479 SRPLTDKDSIN 489

>Scas_720.102
          Length = 1038

 Score =  178 bits (451), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 152/595 (25%), Positives = 279/595 (46%), Gaps = 72/595 (12%)

Query: 569  LALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDINXXX 628
            + L   TL+ L+I  N  DG ++GSL  L++   T  G RKLR WV+HPL  I+ I    
Sbjct: 440  MTLSDSTLEGLDILRN--DG-EKGSLLWLLDHTRTSFGLRKLRDWVLHPLRTIDKIEERL 496

Query: 629  XXXXXXXXXXXXXXXXXXXXXXXXX--XXRMLSRV---HSCSLKIQYFNKVLCGFEDIL- 682
                                         R L+R+   H+   ++ +F K +C   D   
Sbjct: 497  DAIECILKEINCIFLESFNQLLKGLPDLLRTLNRIAYGHTSKKEVYFFLKQMCSIGDHFK 556

Query: 683  ---ALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAFDRN-----LAVKDGVIVPN 734
               + +++  +  D + + +S L      LT++L+   N +         A+ +   V N
Sbjct: 557  THSSYIKEQVLSPDGRINKQSQL------LTSILKDIENNYQETHLPQLFAMINVAAVMN 610

Query: 735  RGVEPEFDESMD---------------RIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKE 779
            + +E +  E  +                I+ ++  L   L   +K+L    + +KD  + 
Sbjct: 611  KNLENQKTEFFNLNNYDNPDGIIKIQRDIEDVKSDLSAELKHIRKVLGRPYLNYKDEIE- 669

Query: 780  IYTIEVPMAATRNVPHEWTQMAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRL 839
             Y IEV      N+P +W ++       R+ +    +L  ++    + HK L      + 
Sbjct: 670  -YLIEVKNTQVTNLPSDWIKINNTLKISRFATPTTTKLVEKL----QFHKDLLVQEVEKE 724

Query: 840  YKKFTNHYNAVWLPTIQAISNI---DCIISLARTSESLGFPACRPKLVEGLHPETNEKLN 896
            Y++F +  N  ++     I NI   DC++SL+  S ++ +   RP         +NEK  
Sbjct: 725  YQRFLSKINDEYIRLRNIIENIATYDCLLSLSAVSCNIKY--TRPIF-------SNEK-- 773

Query: 897  GYIRFKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVI 956
              I+ K  R+P      S    ++PND  + +    + +++G N  GKS+ +R   + +I
Sbjct: 774  QVIKLKGARNPII---ESLDINYVPNDTDMNRKDGLINIISGPNMGGKSSYIRQVALLII 830

Query: 957  LAQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVV 1016
            LAQ+G ++P +  E +  D I+TR+GA D++++G+STF  E+ +  ++L+  T  SL+++
Sbjct: 831  LAQIGSFVPADYMEVSIFDNILTRIGAHDDLLRGESTFKKEMLDVLQVLENCTKDSLVLL 890

Query: 1017 DELGRGGSSSDGFAIAEAVLHHVATHIQS-LGFFATHYAALGSSFTNHPNVQPLKMAILV 1075
            DE+GRG  + DG AI+ +++++        L  F +H+  LG+     P V+   M  + 
Sbjct: 891  DEVGRGTGTLDGKAISYSLINYFMEETDCPLILFTSHFPILGT--IKSPLVKCYHMDYV- 947

Query: 1076 DEESR------NVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASIAAENLEH 1124
             EE R      +VTFLYKL  G +  S+G++VA +  I + +++ A   +E++++
Sbjct: 948  -EEKRPGENWSSVTFLYKLKSGFTTNSYGLNVAKLASIDKDIINEAYEISESMKN 1001

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 72/180 (40%), Gaps = 14/180 (7%)

Query: 218 PATPKSQGKHTKFNKTNGERYQWLVHERDAEGRDKSDPDYDPRTLYIPGDAWSKFTPFEK 277
           P T +   K T+    N    + L    + E R   + D  P        + SK TP ++
Sbjct: 99  PETTREASKSTRKRSRNNVAAKSLEENVEPEQRVPENDDVRPSRKKKAKISKSKLTPLDQ 158

Query: 278 QYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGG----------GRANMQL 327
           Q  E+KS   + +L  + G  ++ + +DA +   +  +K+  G           + + Q 
Sbjct: 159 QIQELKSIHKNKLLVVRVGYKYKCFAEDAIIASKILKIKLVPGKLTIDESNPADKDHKQF 218

Query: 328 A--GVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSKG--IVERELQCVLTSGT 383
           A    P+   +    + I    KV  V+Q E+   K+  + S    + ER++  + +  T
Sbjct: 219 AYCSFPDTRLNVHLERLIYNNCKVGVVEQAETSAIKKNSQTSNKSQVFERKITGIFSKAT 278

>KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces
            cerevisiae YHR120w MSH1 DNA mismatch repair protein,
            mitochondrial, hypothetical start
          Length = 940

 Score =  141 bits (355), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 100/321 (31%), Positives = 160/321 (49%), Gaps = 34/321 (10%)

Query: 815  QRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISN----IDCIISLART 870
            + L+R++     + K  E+ L N+  K F +       P I+++S     +D + S A+ 
Sbjct: 641  ETLSREIEVVGALIKNEEERLINQFQKDFIS-----LSPMIRSLSQTLDYMDVLTSFAKL 695

Query: 871  SESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCF--NMGSSSAKEFIPNDVVLGK 928
            +  +      PK+ +G            +  K  RH     ++   S + F PND  +  
Sbjct: 696  A--IEQRLVLPKVTQGTE----------LNIKGGRHLVVEASISQKSLESFTPNDCQI-- 741

Query: 929  DAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNIM 988
            ++ +L ++TG N  GKST LR   + VILAQ+G ++PCE A    VD+I +R+G++D++ 
Sbjct: 742  NSGELWVITGPNMGGKSTFLRQNAIIVILAQIGSFVPCESAVIGLVDKIFSRVGSADDLY 801

Query: 989  QGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQSLGF 1048
               STF VE+ ET  IL   TNRS+ ++DE+GRG S S+G AIA A L ++ T+      
Sbjct: 802  NEMSTFMVEMIETSYILKGATNRSMAILDEIGRGTSRSEGVAIAYATLKYLTTNNACRAL 861

Query: 1049 FATHYAALGSSFTNHP-------NVQPLKMAILVDEESRNVTFLYKLVDGKSDGSFGMHV 1101
            FATH+    +S  N         N+   K  I+ D  + N  + +KL  G    S  + V
Sbjct: 862  FATHFGTELASTINSTSNEEFINNISFFKTGIIGD--NSNFYYDHKLKPGICSKSDAIKV 919

Query: 1102 ASMCGIPRSVVDNASIAAENL 1122
            A + G P   ++ AS   E +
Sbjct: 920  AKLAGFPEEALEIASTLLEEI 940

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 75/354 (21%), Positives = 137/354 (38%), Gaps = 56/354 (15%)

Query: 290 ILFFKKGKFFELYEKDAHLGHHLFDLKIAGGG--RANMQLAGVPEMSFDYWASQFI-QYG 346
           ++  + G F+ELY + A +   + ++ +         +  AG P    +      + QYG
Sbjct: 87  VVLTQIGSFYELYFEHATIYAPILNITLTSKSIVSGKVPFAGFPLNQLNRHLKVLVKQYG 146

Query: 347 YKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYCVAVREEPI 406
           Y VA  DQ +    + + +  K    R +  ++T GT  D          Y + V     
Sbjct: 147 YSVAVCDQFKH---ETLVDNDKNKFMRRVTRIVTPGTFIDEAFENFQENQYLLTVHFSEN 203

Query: 407 TYYDEEILALPKTGKYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIMEKS 466
                  L +P      G +  D +TG I    F        L + +++ +P EV++++ 
Sbjct: 204 CMKRAADLNIP-----VGLSWCDISTGEI----FVQQVYLKDLVSSITRIRPMEVLLDE- 253

Query: 467 NVCSLAQKIIKFNAQPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYY-- 524
                          P  I N    KE  + +K F   I ++   S  R P  ++S++  
Sbjct: 254 ------------EIMPVEITNGEWYKELTELKKYF---IKYQKMPSKHR-P--IQSFFKL 295

Query: 525 ------ETGKKVG------FHAFGGLLSYLQ--WLKLDTSLVTMGQVEEYNPVRSQTCLA 570
                 + G+ +G        A   LL Y++     ++T+L  + Q +    +     + 
Sbjct: 296 FSNAEGDIGRSLGNFTQKEIAALRNLLLYIEEHLPDINTNL-ELPQKQLITDI-----MQ 349

Query: 571 LDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDI 624
           +D  T   LE+ +       +GSL   I R +T  G R L +W+  P + I +I
Sbjct: 350 IDSRTSTALELHSTMRKHHKKGSLLSTIRRTVTTSGTRLLTQWLSAPSMDINEI 403

>YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in
            mitochondrial DNA repair, homolog of E. coli MutS [2880
            bp, 959 aa]
          Length = 959

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 111/211 (52%), Gaps = 8/211 (3%)

Query: 911  MGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAE 970
            + + S + F  N+  L KD   L ++TG N  GKST LR   + VILAQ+GC++PC +A 
Sbjct: 746  LSARSLETFTANNCELAKD--NLWVITGPNMGGKSTFLRQNAIIVILAQIGCFVPCSKAR 803

Query: 971  FTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFA 1030
               VD++ +R+G++D++    STF VE+ ET  IL   T RSL ++DE+GRG S  +G +
Sbjct: 804  VGIVDKLFSRVGSADDLYNEMSTFMVEMIETSFILQGATERSLAILDEIGRGTSGKEGIS 863

Query: 1031 IAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAI------LVDEESRNVTF 1084
            IA A L ++  + Q    FATH+        ++   + +   +      + D    N  +
Sbjct: 864  IAYATLKYLLENNQCRTLFATHFGQELKQIIDNKCSKGMSEKVKFYQSGITDLGGNNFCY 923

Query: 1085 LYKLVDGKSDGSFGMHVASMCGIPRSVVDNA 1115
             +KL  G    S  + VA + G P   +  A
Sbjct: 924  NHKLKPGICTKSDAIRVAELAGFPMEALKEA 954

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 75/354 (21%), Positives = 141/354 (39%), Gaps = 47/354 (13%)

Query: 288 DCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRA----NMQLAGVPEMSFDYWASQFI 343
           D ++  + G F+ELY + A    +  +L I+   RA     +  AG P           +
Sbjct: 95  DHVVLTQMGSFYELYFEQAI--RYAPELNISLTNRAYSHGKVPFAGFPVHQLSRHLKMLV 152

Query: 344 Q-YGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYCVAVR 402
              GY V   +Q +    K++ +       R +  ++T GT  D         TY +   
Sbjct: 153 NNCGYSVTIAEQFKK---KDVADNEANKFYRRVTRIVTPGTFIDEAFENLRENTYLL--- 206

Query: 403 EEPITYYDEEILALPKTGKYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVI 462
              I + +  +  +  T    G    D +TG I    F        L + +++ +P E++
Sbjct: 207 --NIEFPENCMSQVADTSLKVGICWCDVSTGEI----FVQQVYLRDLVSAITRIQPKEIL 260

Query: 463 MEKSNVCSLAQKIIKFNAQ-----PEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWP 517
           ++        +++++F+ +     PE +      K F  ++K   +  T E F  +  + 
Sbjct: 261 LD--------ERLLEFHIESGTWYPELV---ELKKFFIKYQKMPSQHRTIESFYGL--FN 307

Query: 518 TVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQVEEYN-----PVR--SQTCLA 570
              K   E   K+ F  F      L  L+ +T +     + +++     P R  +   + 
Sbjct: 308 LGGKEATERQLKIQFQTFTQ--KELAALR-NTLIYVSNHLPDFSINFQIPQRQLATAIMQ 364

Query: 571 LDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDI 624
           +D  T   LE+ +   D   +GSL   I R +TP G R L +W+  P L +++I
Sbjct: 365 IDSRTSTALELHSTVRDNNKKGSLLSSIRRTVTPSGTRLLSQWLSGPSLDLKEI 418

>ABR137W [729] [Homologous to ScYHR120W (MSH1) - SH]
            complement(653115..655982) [2868 bp, 955 aa]
          Length = 955

 Score =  125 bits (315), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 108/210 (51%), Gaps = 7/210 (3%)

Query: 911  MGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAE 970
            + S +   F  ND  L      + ++TG N  GKST LR T + VILAQ+GCY+PC  A 
Sbjct: 740  LQSRAPGNFTANDCSLQNG--DIWIVTGPNMGGKSTFLRQTAIIVILAQIGCYVPCASAH 797

Query: 971  FTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFA 1030
               VD+I +R+G++D++    STF VE+ E+  +L   T RSL ++DE+GRG ++ DG  
Sbjct: 798  IGLVDKIFSRVGSADDLYNDMSTFMVEMLESSFMLKGATKRSLAILDEIGRGTNAEDGVG 857

Query: 1031 IAEAVLHHVATHIQSLGFFATHYA-ALGSSFTNHPNVQPLKMAIL----VDEESRNVTFL 1085
            IA   LHH+ T  +    FA+H+   L      H      K        V E +    + 
Sbjct: 858  IAYTTLHHMLTKNRCRALFASHFGRELSELVEQHLPPGARKRVHFYRTNVREHNGRSFYD 917

Query: 1086 YKLVDGKSDGSFGMHVASMCGIPRSVVDNA 1115
            +K+  G    S  + VA M G P+  +D A
Sbjct: 918  HKITPGICLSSDAIRVAQMAGFPQEALDVA 947

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 82/357 (22%), Positives = 138/357 (38%), Gaps = 39/357 (10%)

Query: 281 EIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGR----ANMQLAGVPEMSFD 336
           ++  K  D +L  + G F+ELY +  H   +   L I    R      +  AG P     
Sbjct: 82  DMMDKYPDYVLLTQMGSFYELYYE--HAEKYAPKLNITLTRREYSHGKVPFAGFPLEQLS 139

Query: 337 YWASQFI-QYGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLA 395
                 + +YGY VA V+Q       ++ +  +    R +  V+T GT  D         
Sbjct: 140 RHLKVLVKEYGYSVAVVEQ---FRKDDIADNERYKFNRRVTRVVTPGTFIDEAFENLQEN 196

Query: 396 TYCVAVREEPITYYDEEILALPKTGKYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQ 455
            + ++V      + D  +  L       G +  D +TG +    F    +   L + +++
Sbjct: 197 QFLLSVE-----FPDRCMEKLSDPSIKVGLSWCDISTGEL----FVQQVQLKGLISAITK 247

Query: 456 FKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDR 515
            KP E+++ +     LA +I   N  PE +      K F  + KT     T E F  +  
Sbjct: 248 IKPREILLSED---LLAYQIQNGNWYPELV---EFKKYFIKYYKTPSRHRTMETFSHLFA 301

Query: 516 WPTVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQ------VEEYNPVRSQTC- 568
           +     +  +    +  H+    LS  +   L  +L  + Q           P RS T  
Sbjct: 302 FGA--NNASKRNLDIVLHS----LSQKETAALRANLTYIEQHLPEMLANLAFPKRSLTTD 355

Query: 569 -LALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDI 624
            + +D  T   LE+     D   RGSL   I R +TP G R L +W+  P + +++I
Sbjct: 356 SMQIDSRTSAALELHNTFRDNLKRGSLLSAIRRTVTPSGTRLLTQWLSAPSMHLDEI 412

>Kwal_33.14738
          Length = 963

 Score =  125 bits (315), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 114/220 (51%), Gaps = 12/220 (5%)

Query: 905  RHPCFNMG--SSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGC 962
            RH     G  S S  +F  ND  L      L +++G N  GKST LR   + VI+AQ+G 
Sbjct: 738  RHIVVEDGLMSKSLDKFTSNDCSL--QGGTLWVVSGPNMGGKSTFLRQNAIIVIMAQVGS 795

Query: 963  YIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRG 1022
            ++PC  A    VD+I +R+G++D++    STF VE+ ET  IL   T RSL ++DE+GRG
Sbjct: 796  FVPCASARIGLVDKIFSRIGSADDLYNEMSTFMVEMIETSYILKGATERSLAILDEIGRG 855

Query: 1023 GSSSDGFAIAEAVLHHVATHIQSLGFFATHYAA-------LGSSFTNHPNVQPLKMAILV 1075
             S  +G +IA A L H+ +  +    FATH+A        L S+ T   NV   K  +  
Sbjct: 856  TSGKEGISIAYATLKHLVSRNRCRSLFATHFAKELEQLLNLQSNCTFQRNVSYYKSGV-Y 914

Query: 1076 DEESRNVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNA 1115
            D    + T+ ++L  G    S  + VAS  G P   + +A
Sbjct: 915  DIGKGDYTYNHRLTPGICTKSDAIRVASKAGFPDEALSDA 954

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 77/355 (21%), Positives = 145/355 (40%), Gaps = 43/355 (12%)

Query: 285 KMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAG----GGRANMQLAGVPEMSFDYWAS 340
           K  D ++  + G F+ELY + A +     +L +       G+ +     VP++S  +   
Sbjct: 96  KYQDYVVLTQMGSFYELYFEHAEIYAPKLNLTLTSREYVHGKVSFAGFPVPQIS-RHLKV 154

Query: 341 QFIQYGYKVAKVDQ--KESMLAKEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYC 398
               YG+ VA  DQ  K+++++ +          R +  ++T GT  D         T+ 
Sbjct: 155 LVKDYGHSVAIADQFKKDNIISNDTSR-----FLRRVTRIVTPGTFIDEAFENLQENTFL 209

Query: 399 VAVREEPITYYDEEILALPKTGKYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKP 458
           +++      + +  +  +       G    D +TG I    F        + + +++  P
Sbjct: 210 LSLE-----FPENCMRKVADIDTKVGLCWCDISTGEI----FVQQVLLKDVVSAITRIAP 260

Query: 459 TEVIMEKSNVCSLAQKIIKFNAQPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRW-- 516
            E+++++     LA KI      PE +      K F  ++K      +H   +S  R   
Sbjct: 261 CEILLDEE---ILAFKIESGEWYPEFV---ELKKFFIKYQKIPS---SHRAIRSFHRLFS 311

Query: 517 PTVLKSYYETGKKVGFHAF-----GGLLSYLQWLKLDTSLVTMGQVEEYNPVR--SQTCL 569
           P  ++  + +   +  H F       L + L  L L+  L  M +V    P R  + + +
Sbjct: 312 PADMEGKF-SPFDIALHNFSQKETAALRNTL--LYLEEHLPDM-EVNLQVPKRQITSSIM 367

Query: 570 ALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDI 624
            +D  T   LE+ +     T +GSL   I R +TP G R L +W+  P + I++I
Sbjct: 368 QIDSRTCSALELSSTMRTNTRKGSLLSAIRRTVTPSGSRLLSQWLSAPSMDIKEI 422

>CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces
            cerevisiae YHR120w MSH1, hypothetical start
          Length = 949

 Score =  125 bits (315), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 105/190 (55%), Gaps = 6/190 (3%)

Query: 935  LLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTF 994
            +++G N  GKST LR   +  ILAQ+GC++PC +A    VD+I +R+G++D++    STF
Sbjct: 750  VISGPNMGGKSTFLRQNAIIAILAQIGCFVPCRKAHIGLVDKIYSRVGSADDLYNDMSTF 809

Query: 995  FVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQSLGFFATHYA 1054
             VE+ ET  IL+  T+RSL ++DE+GRG S  +G A+A   L H+  + +    FATHYA
Sbjct: 810  MVEMVETSLILNGATDRSLAILDEIGRGTSGKEGVAVAYGTLKHLLQNNKCRSLFATHYA 869

Query: 1055 ALGSSFTNHP------NVQPLKMAILVDEESRNVTFLYKLVDGKSDGSFGMHVASMCGIP 1108
                   +         +   + +I    +     + +K+  G S  S  + VA + G P
Sbjct: 870  QELKQVADQDLSEDTHRIHYFQTSIRETNDPNKFYYDHKMRPGISQKSDALKVARIAGFP 929

Query: 1109 RSVVDNASIA 1118
            +  +++AS A
Sbjct: 930  QDALNDASTA 939

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 86/359 (23%), Positives = 137/359 (38%), Gaps = 49/359 (13%)

Query: 284 SKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGG--RANMQLAGVPEMSFDYWASQ 341
           S+  D ++  + G FFELY   A     L ++ +         +  AG P          
Sbjct: 73  SQYPDHVVLTQMGSFFELYFDHASTYAPLLNIALTQRTYTHGKVPFAGFPVPQLSRHLKA 132

Query: 342 FIQ-YGYKVAKVDQ--KESMLAKEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYC 398
            +Q YGY V   +Q  K+     E          R +  ++T GT  D  +      T+ 
Sbjct: 133 LVQDYGYSVVVAEQFKKDGYATNENNR-----FYRRVTRIVTPGTFIDEALDNYSENTFL 187

Query: 399 VAVR--EEPITYYDEEILALPKTGKYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQF 456
           + +   E    Y  E+ L +       G +  D +TG I + E         L   +++ 
Sbjct: 188 LTIEFPENFTNYVAEDNLRI-------GISWCDISTGEIYIQELP----LKDLMNAITRI 236

Query: 457 KPTEVIMEKSNVCSLAQKIIKFNAQPEA------IINQRTSKEFYDFEKTFDELITHEYF 510
           KP E+++   N   L+  II  N  P+        IN  T+   Y    T+ ++      
Sbjct: 237 KPKEILL---NARELSDDIISGNWYPQLAELKRYFINYYTTTTRYRTLDTYFDMFAATRA 293

Query: 511 KSM-DRWPTVLKSYY--ETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQVEEYNPVRSQT 567
             M  R    L  Y   ET       A   LLSY+         +    +    P R  T
Sbjct: 294 SGMRQRLRMELNEYSIKETA------ALRNLLSYV------AEHLPECAINFQFPKRQIT 341

Query: 568 --CLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDI 624
              L +D  T + LE+ +   D + RG+L   + R +TPMG R L +W+  P + I++I
Sbjct: 342 TDILQIDSRTTKALELHSTIRDNSKRGTLLNTMRRTVTPMGTRLLSQWLSGPSMNIKEI 400

>Scas_697.27
          Length = 948

 Score =  125 bits (314), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 113/205 (55%), Gaps = 8/205 (3%)

Query: 910  NMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEA 969
            ++  +S ++F+ ND  L  ++ +L ++TG N  GKST LR   + VILAQ+G ++PC+ A
Sbjct: 734  SLAINSLEKFVGNDCNL--ESGKLWVITGPNMGGKSTFLRQNAIIVILAQIGSFVPCDSA 791

Query: 970  EFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGF 1029
                VD+I +R+G++D++    STF VE+ ET  IL   T+RSL ++DE+GRG S  +G 
Sbjct: 792  RIGLVDKIFSRVGSADDLYNEMSTFMVEMVETSCILRGATDRSLAILDEIGRGTSGKEGI 851

Query: 1030 AIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAI------LVDEESRNVT 1083
            +IA A L ++    +    FATH+        N  + Q  K  I      +++  + N  
Sbjct: 852  SIAFATLKYLIKRNRCRSLFATHFGQELQVIVNEKDEQEAKDNIEFYQSGIIELGNENFV 911

Query: 1084 FLYKLVDGKSDGSFGMHVASMCGIP 1108
            + +KL  G    S  + VA   G P
Sbjct: 912  YDHKLKPGICKSSDAIKVARTAGFP 936

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 76/356 (21%), Positives = 141/356 (39%), Gaps = 55/356 (15%)

Query: 290 ILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRAN--MQLAGVPEMSFDYWASQFIQ-YG 346
           ++  + G F+ELY + A     + ++ +     A+  +  AG P           +  +G
Sbjct: 91  VVLTQIGSFYELYFEQAVKYAPILNISLTNRTYAHGKVPFAGFPVPQLGRHLKILVNDFG 150

Query: 347 YKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYCVAVREEPI 406
           Y V   +Q +     ++ E  +    R +  ++T GT  D         +Y +++     
Sbjct: 151 YNVVIAEQFKK---NDVAENEQYKFIRRVTRIVTPGTFIDEAFENFQENSYLLSIE---- 203

Query: 407 TYYDEEILALPKTGKY-FGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIME- 464
             + E  +     G    G +  D +TG +    F        L + +++ +P E+I+  
Sbjct: 204 --FPENCMKRIALGDLKLGLSWCDVSTGEV----FVQQMFLKDLISSITRIRPKEIILNE 257

Query: 465 ---KSNVCS---------LAQKIIKFNAQPEAIINQRTSKEFYDFEKTFDELITHEYFKS 512
              K+N+ S         L +  + +   P      RT + FYD       L T     S
Sbjct: 258 DLYKNNIVSGEWYPELVALKKYFLNYQRMPS---QHRTIESFYD-------LFTSGNTDS 307

Query: 513 MDRWPTVLKSYYETGKKVGFHAFGGLLSYL--QWLKLDTSLVTMGQVEEYNPVRSQT--C 568
           + R    LK  ++T  +    A   +L Y+      + T+L    Q+    P R  T   
Sbjct: 308 VIRQ---LKLQFQTFTQKELAALRNILIYISDHLPNISTNL----QI----PQREITTSI 356

Query: 569 LALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDI 624
           + +D  T   LE+ +   + + +G+L   I R ITP G R L +W+  P L +++I
Sbjct: 357 MQIDSRTSSALELHSTVRNNSKKGTLLSSIRRTITPSGTRLLTQWLSGPSLDLKEI 412

>Scas_544.2
          Length = 874

 Score =  119 bits (299), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 91/319 (28%), Positives = 156/319 (48%), Gaps = 50/319 (15%)

Query: 823  EAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNIDCIISLARTSESLGFPACRPK 882
            E   +H + E  +K RL  K   ++        Q  + ++ ++S A  S+  G+   RP+
Sbjct: 505  EVEVLHSLQECVIKERL--KLMEYF--------QLFAQLEVLVSFAYISQRNGY--VRPE 552

Query: 883  LVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIPNDV-VLG----------KDAP 931
            L E             +  K  RHP +    +    +IPND+ +LG          +   
Sbjct: 553  LSED---------ECVLDIKSGRHPLY---ENIVDTYIPNDLELLGGSFDDTSWSREGNK 600

Query: 932  QLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGK 991
            ++G++TGANA+GKS  L  T + V LA +GC++PC+ A    VDRI+TR    D +   K
Sbjct: 601  RIGIITGANASGKSVFLIQTGLIVYLAHIGCFVPCDSARIGLVDRILTRTRTQDTVSLLK 660

Query: 992  STFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQSLGFFA- 1050
            S+F ++  +  + L  ++ +SL+++DE G+G    DG ++  A++  +A         A 
Sbjct: 661  SSFELDSLQMARCLSQMSKKSLILIDEFGKGTDIIDGPSLFGAIIQQLAESKDCPRVLAC 720

Query: 1051 THYAALGSSFT---NHPNVQPLKMAILVDE----ESRN-------VTFLYKLVDGKSDGS 1096
            TH+  L ++       P V      +L+++     SR+       +TFLY++ +G S  S
Sbjct: 721  THFHELFNTDVLDEAFPGVNYYMTQVLLNQAHISSSRDTLCKNVGITFLYRIKEGISRQS 780

Query: 1097 FGMHVASMCGIPRSVVDNA 1115
            FG++ A +CGI  S+V  A
Sbjct: 781  FGVYCAKICGIKESIVKRA 799

>Sklu_1903.3 YFL003C, Contig c1903 4902-7601
          Length = 899

 Score =  119 bits (298), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 95/344 (27%), Positives = 166/344 (48%), Gaps = 32/344 (9%)

Query: 804  KSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNIDC 863
            K++  + +  + +L  ++ E      ++ + +   L K      + +++   +A+S +D 
Sbjct: 539  KNYVEFTTLQITKLNARLDEVMSEIMLISEQIVQELLKAIVKKISVLFMIA-EAVSILDL 597

Query: 864  IISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIPND 923
            +   A  S    +  C P+             +  + FK  RHP         K+FIPND
Sbjct: 598  LSCFAYNSAENNY--CIPEF------------SNKMVFKSARHPILE---KFLKKFIPND 640

Query: 924  VVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGA 983
             V  K++  + ++TG NA+GKS  L+   +  I+AQ+G  +P + A F   +R+  R+  
Sbjct: 641  TVSIKESSAIQIITGCNASGKSVYLKQIAILNIMAQMGSPVPADYACFPIFNRLHARV-C 699

Query: 984  SDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHI 1043
            +D I    STF  E+ E    L  + + +L+V+DELGRG S  DGFA++ A+  H+ +  
Sbjct: 700  NDTIEVNSSTFSSEMKEMAYFLHDIDSNTLMVLDELGRGSSIGDGFAVSLAITEHLVS-T 758

Query: 1044 QSLGFFATHYAALGSSFTNHPNVQPLKM-AILVDEESRNVTFLYKLVDGKSD-GSFGMHV 1101
            +   F +TH+  +    T+ P+V  L+M A +VD   +++T  YK+    S   ++G+ V
Sbjct: 759  KCTAFISTHFRDIPEILTSKPSVVHLQMTAEVVD---KSLTMHYKVSRTTSGIKNYGLRV 815

Query: 1102 ASMCGIPRSVVDNASIAAENLEHTSK------LIKERKNLHQSI 1139
                  PR ++DNA      L+ + K      L KE K  H  I
Sbjct: 816  VQNL-FPREIMDNAYEIGSLLKSSKKKMSNANLSKEHKEEHHRI 858

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 96/210 (45%), Gaps = 20/210 (9%)

Query: 419 TGKYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIMEKS----NVCSLAQK 474
           T    G   I+ +TG + + +F D +   +    +   +PTE+++  S    N+  LA  
Sbjct: 136 TDSRIGLCVINYSTGEMIISDFMDSQIFIRTVHKIQIHQPTEILLPSSSFLPNISKLAT- 194

Query: 475 IIKFNAQPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHA 534
           IIKFN      + + + K  Y+ ++    +  +  F   ++  TV K      KK    A
Sbjct: 195 IIKFNVSGSVKVIEASLKH-YNSQEGLTAIEEYGLFIGNEKNLTVEKF---VDKKFALCA 250

Query: 535 FGGLLSYLQWLKLDTSLVTMGQVEEYNPVR-----SQTCLALDGITLQNLEIFANTYDGT 589
               + + +  ++ TS ++  +   +  +R     ++  + +D  T + LE+  N  +  
Sbjct: 251 VSAAIKHTK--RISTSRIS-NESYSFQNLRIKYEGTENTMLIDPRTSKGLELVENALE-- 305

Query: 590 DRG-SLFKLINRAITPMGKRKLRKWVMHPL 618
            +G SLFK ++  +T MGKR LR  ++ PL
Sbjct: 306 KKGMSLFKFLDSTVTKMGKRALRNNILQPL 335

>CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces
            cerevisiae YDL154w MSH5 meiosis-specific protein,
            hypothetical start
          Length = 867

 Score =  115 bits (288), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 144/294 (48%), Gaps = 43/294 (14%)

Query: 861  IDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFI 920
            ++ +IS A  +    +  C+P L         +K    ++  + RHP     S +   FI
Sbjct: 530  LEVLISFAILANERNY--CKPIL---------KKDKSVVKITQGRHPLLETLSDN---FI 575

Query: 921  PNDVVLG----KDA-------PQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEA 969
            PND++L     KD         ++ ++TGANA+GK+  L    + V +A +GCY+P + A
Sbjct: 576  PNDIILDGGMLKDINWFSSGRQRIAVVTGANASGKTIFLEQIALIVYMAHIGCYVPADTA 635

Query: 970  EFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGF 1029
            E   VD I+T+  + D+I    S+F  +  +  KI+ L T RS++ +DE G+G  +  G 
Sbjct: 636  EIGLVDMILTKFKSFDSISTSMSSFERDSKQLSKIMSLATKRSIIFIDEYGKGTDTISGP 695

Query: 1030 AIAEAVLHHVATHIQSLG----FFATHYAAL--GSSFTNH-PNVQPLKMAILVDE----- 1077
            ++  A++   +   Q  G      +TH+  +   SS   H  +++ L   I+++      
Sbjct: 696  SLLAAIIQRYS---QLPGAPRLLISTHFYEIFQKSSLLKHRGSIKFLTTKIVLNNCEVEN 752

Query: 1078 ---ESRNVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASIAAENLEHTSKL 1128
               E+  + F Y++V+G  D S G++ A +CGI + +++ A +  +      KL
Sbjct: 753  LVTENEGIVFFYQIVEGICDSSLGIYCAKICGIKKEIINMAELVHKQFSLGQKL 806

>KLLA0C16423g complement(1437001..1439805) similar to sp|Q12175
            Saccharomyces cerevisiae YDL154w MSH5 meiosis-specific
            protein, start by similarity
          Length = 934

 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 144/283 (50%), Gaps = 37/283 (13%)

Query: 856  QAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSS 915
            +  + ++ ++S A+T+ S  +          + P   EK    I  +  RHP +    + 
Sbjct: 595  KCFAELEVLVSFAKTAISQNY----------VQPVIEEK-ECVIEIENGRHPLY---ETL 640

Query: 916  AKEFIPNDV-VLG---------KDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIP 965
               +IPND+ +LG          +  ++ ++TGANA+GKS  L    + V LA +GC++P
Sbjct: 641  VDTYIPNDLRMLGGTFDNDTWNNNFKRISVITGANASGKSVFLTQNGLIVFLAHIGCFVP 700

Query: 966  CEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSS 1025
             + A    VD+I+TR+   +++ + +STF ++ ++  K L L T RSLL++DE G+G   
Sbjct: 701  ADNARIGLVDKILTRVVTRESVAKTQSTFEIDANQMSKCLSLATPRSLLLIDEFGKGTDV 760

Query: 1026 SDGFAIAEAVLHHVATHIQSLGFFA-THYAALGSS--FTNHPN-VQPLKMAILV---DEE 1078
             DG ++  A++   +         A THY  + S    T+  N V   K  IL+   ++E
Sbjct: 761  IDGLSMFGAIIKDFSRSSSCPRVIASTHYNEVFSPNILTSEINGVVFYKTEILLQVMEKE 820

Query: 1079 SRN------VTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNA 1115
            ++       +TFLYKL  G +  SFG+  A  CG+ +S+V  A
Sbjct: 821  NKGNARDEMITFLYKLSTGIATNSFGIFCAKNCGLRQSIVQRA 863

>YDL154W (MSH5) [716] chr4 (178335..181040) Meiosis-specific protein
            involved in reciprocal recombination, not involved in
            mismatch repair [2706 bp, 901 aa]
          Length = 901

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 118/219 (53%), Gaps = 18/219 (8%)

Query: 935  LLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTF 994
            ++TGANA+GKS  L    + V LAQ+GC++P E A     D+I+TR+   + + + +S+F
Sbjct: 640  VVTGANASGKSVYLTQNGLIVYLAQIGCFVPAERARIGIADKILTRIRTQETVYKTQSSF 699

Query: 995  FVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQSLGFFA-THY 1053
             ++  +  K L L T +SL+++DE G+G    DG ++  +++ +++   +     A TH+
Sbjct: 700  LLDSQQMAKSLSLATEKSLILIDEYGKGTDILDGPSLFGSIMLNMSKSEKCPRIIACTHF 759

Query: 1054 AALGSSFTNHPNVQPLK---MAILV--------------DEESRNVTFLYKLVDGKSDGS 1096
              L +      N++ +K     IL+              D ES  +TFL+K+ +G S  S
Sbjct: 760  HELFNENVLTENIKGIKHYCTDILISQKYNLLETAHVGEDHESEGITFLFKVKEGISKQS 819

Query: 1097 FGMHVASMCGIPRSVVDNASIAAENLEHTSKLIKERKNL 1135
            FG++ A +CG+ R +V+ A   +  +     ++++  NL
Sbjct: 820  FGIYCAKVCGLSRDIVERAEELSRMINRGDDVVQQCGNL 858

>KLLA0F11022g complement(1016214..1018880) similar to sp|P40965
            Saccharomyces cerevisiae YFL003c MSH4 meiosis-specific
            protein, start by similarity
          Length = 888

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 137/279 (49%), Gaps = 26/279 (9%)

Query: 804  KSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNIDC 863
            K+   + + ++ ++  +++E       L +   + L    ++H   +++ + +AIS +D 
Sbjct: 526  KTAYEFTTLNLMKMNTRLSELTCEMIALSEQTVSELLSNISSHIATLFMIS-EAISVLDL 584

Query: 864  IISLARTSESLGFPACRPKLVEGLHPETN---EKLNGYIRFKELRHPCFNMGSSSAKEFI 920
            + SLA T               GL  E N        ++     RHP      ++   F+
Sbjct: 585  LCSLATT---------------GL--ENNWILASFGNHLSLSGARHPIL---ENTLTNFV 624

Query: 921  PNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTR 980
             NDV    +     ++TG N +GKS  L+   +  ILAQ+GC +PC  A F    ++  R
Sbjct: 625  ANDVEAIPNLSSFQIVTGCNMSGKSIYLKQVAMLTILAQIGCPVPCTSASFPLYQKLHAR 684

Query: 981  LGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVA 1040
            +  +D+I    STF  E+ +    +D +T+++L+++DELGRG S +DGF+IA A+  ++ 
Sbjct: 685  V-CNDDIEAYSSTFSAEMKDMAYFIDDITDKTLMILDELGRGSSIADGFSIALAISEYLL 743

Query: 1041 THIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEES 1079
            +   ++ F +TH+  +       P V  L+M   +D+ES
Sbjct: 744  SKNATV-FLSTHFRDIPKILAPKPRVLHLEMKTEIDQES 781

>Scas_707.28
          Length = 881

 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 138/294 (46%), Gaps = 34/294 (11%)

Query: 793  VPHEWTQMAANKSFKRYYSADVQRLARQMAEA-REMHKVLED---DLKNRLYKKFTNHYN 848
            +P+E+    + K+F    + ++ ++  ++ E   E+  + E    +L N + K     Y 
Sbjct: 508  LPNEFINKISKKNFIECCTLNIMKMNVRLKEIILEISSISEQVVLELLNEVVK-----YL 562

Query: 849  AVWLPTIQAISNIDCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPC 908
            ++     +A+S +D + S A  S    +  C PK    L              ++ RHP 
Sbjct: 563  SILFMISEAVSILDLLCSFAFKSFKENY--CFPKFSTNLF------------LRQSRHPI 608

Query: 909  FNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEE 968
                 +  K F+PND+V  K +  + ++TG N +GKS  L+   +  I++Q+G  +P E 
Sbjct: 609  L---ETLIKGFVPNDIVSTKTSSAVQIITGCNRSGKSVYLKQLPLLCIMSQIGSPVPAES 665

Query: 969  AEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDG 1028
            A      ++  R+  +D +    STF  E+ E    LD     +LL++DELGRG S  DG
Sbjct: 666  AIVPIYKKVHARV-CNDTMEMNSSTFSFEMKEMAYFLDDTDQDTLLIIDELGRGSSIGDG 724

Query: 1029 FAIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESRNV 1082
            F+I+ A+  H+    +     +TH+ A+ S     PNV  L M      +SRN+
Sbjct: 725  FSISLAITEHL-IGTKGTVLLSTHFEAIPSILVTRPNVLHLHM------QSRNL 771

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 84/210 (40%), Gaps = 31/210 (14%)

Query: 424 GFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIMEKSNVCSLAQK---IIKFNA 480
           G   +   TG + L EF D +   +    +  ++PTE+I+  S++     K   IIK N 
Sbjct: 122 GLCFLKYTTGEMILSEFMDSQIFIRTMHKIHIYQPTEIILPSSSLFPTVSKLATIIKLNI 181

Query: 481 QPEAIINQRTSKEF-----------YDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKK 529
                I++ +SK F           Y  +K  ++ I  E             S   T   
Sbjct: 182 SETVKISEASSKYFNSQDGISVIKNYVIDKDREKTIIEELIDKSYALSASAASIAYTDDL 241

Query: 530 VGFHAFGGLLSYLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQNLEIFANTYDGT 589
           +   +   L ++ + L++            Y    ++  + +D  T+  LE+  N  D  
Sbjct: 242 IAKSSNDALFNF-RKLRI-----------RYEG--TENTMLIDPKTINGLELVENIIDK- 286

Query: 590 DRG-SLFKLINRAITPMGKRKLRKWVMHPL 618
            RG S +K +N   T MG+R LR  ++ PL
Sbjct: 287 -RGMSFWKFLNTTCTKMGERSLRNNILQPL 315

>CAGL0F02167g complement(216080..218767) similar to sp|P40965
            Saccharomyces cerevisiae YFL003c MSH4 meiosis-specific
            protein, start by similarity
          Length = 895

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 2/155 (1%)

Query: 917  KEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDR 976
            K +I ND+     + +L ++TGAN  GK+  LR   +  I+AQ+G  IP E A     + 
Sbjct: 625  KNYIRNDISSTLYSSRLQIITGANMTGKTAFLRQIPLLCIMAQMGSPIPAENAILPVYEN 684

Query: 977  IMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVL 1036
            I TRL  +D++    S F  E+ E   IL+     SL+++DELGRG S  DGFAI+ A+L
Sbjct: 685  IHTRL-CNDSMEMTSSNFSFEMKEMAYILECCNAESLIIIDELGRGTSIGDGFAISLAIL 743

Query: 1037 HHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKM 1071
            ++++  ++S  F +TH+  +     N P+++ L M
Sbjct: 744  NYLS-KLESTTFISTHFDVIPMILKNKPSIRHLHM 777

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 91/217 (41%), Gaps = 25/217 (11%)

Query: 423 FGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIMEKSNV---CSLAQKIIKFN 479
            G + I+ +TG I L E+ D +   +    +  ++PT++++   +V    S    I+K N
Sbjct: 127 IGISLINFSTGEIILTEYVDSQLFIRTMNKIQLYEPTDILIPCHSVRPHMSKLATILKLN 186

Query: 480 AQPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLL 539
              E  I+   S   Y+  ++  E I        D    +L   YE       H    L 
Sbjct: 187 INHEIKIHIAKS-SCYNNRRSI-EFIKASSINKADGIQILLAKLYEKR-----HCLFSLA 239

Query: 540 SYLQWLKLDTSLVTMGQVEEYNPVRS------------QTCLALDGITLQNLEIFANTYD 587
           +  ++L+   S+   G   + N V S            +  L +D  T+ NLE+   T +
Sbjct: 240 AATEFLQSKNSV--KGLTPKKNKVLSDYSRFRIRYEAIENTLLIDSKTVTNLELI-RTLE 296

Query: 588 GTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDI 624
           G ++ SLF  +N   T MG R LR  ++ PL  +  I
Sbjct: 297 GDEKLSLFGTLNTTCTKMGYRNLRGAILQPLTDLNGI 333

>YFL003C (MSH4) [1678] chr6 complement(134516..137152)
            Meiosis-specific protein homologous to E. coli MutS [2637
            bp, 878 aa]
          Length = 878

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 95/185 (51%), Gaps = 6/185 (3%)

Query: 901  FKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQL 960
             ++ RHP         K F+PN +   K +  L ++TG N +GKS  L+   +  I+AQ+
Sbjct: 600  IRDSRHPLL---EKVLKNFVPNTISSTKHSSSLQIITGCNMSGKSVYLKQVALICIMAQM 656

Query: 961  GCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELG 1020
            G  IP     F    R+  R+  +D++    S F  E+ E    LD +   +LL++DELG
Sbjct: 657  GSGIPALYGSFPVFKRLHARV-CNDSMELTSSNFGFEMKEMAYFLDDINTETLLILDELG 715

Query: 1021 RGGSSSDGFAIAEAVLHHVATHIQSLGFFATHYAALGSSFTNHPNVQPLKM-AILVDEES 1079
            RG S +DGF ++ AV  H+    ++  F +TH+  +    +  P V  L M A+L+++ S
Sbjct: 716  RGSSIADGFCVSLAVTEHLL-RTEATVFLSTHFQDIPKIMSKKPAVSHLHMDAVLLNDNS 774

Query: 1080 RNVTF 1084
              + +
Sbjct: 775  VKMNY 779

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 88/204 (43%), Gaps = 18/204 (8%)

Query: 423 FGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPTEVIMEKSNVCSLAQKI---IKFN 479
            G   I+  TG + L +F D +   ++   +  ++PTE+++  S++     K+   IKFN
Sbjct: 120 IGLCIINCNTGQMYLSDFMDSQIYIRVVHKLQIYQPTEILIPSSSLAPTVSKLATMIKFN 179

Query: 480 AQPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWPTVLKSYYETGKKVGFHAFGGLL 539
                 I + + K F     + D L     +  MD     LK      K     A    +
Sbjct: 180 VAETVKIEEGSRKCF----NSQDGLAAITKYL-MDDTKKDLKIEEIIDKTFALCAASAAI 234

Query: 540 SYLQWLKLDTSLVTMGQVEEYNPVRSQ-----TCLALDGITLQNLEIFANTYDGTDRGSL 594
           SY++ +   +S      +  +  +R Q       + +D  T++ LE+  N  D  +  SL
Sbjct: 235 SYMEEIISKSS----RNLNAFRKLRIQFEGTENTMLIDSKTVRGLELVENKLDK-NGISL 289

Query: 595 FKLINRAITPMGKRKLRKWVMHPL 618
           +K ++   T MG+R LR  ++ PL
Sbjct: 290 WKFLDTTSTKMGQRSLRNSILQPL 313

>Kwal_14.1697
          Length = 734

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 39  PVESESNDTSPLKEKSETDAKKKDTTSKGPLQFKHQPEVVEKEPATKTEPSKPEATKTVE 98
           P+ SE +D S + E  E +    +T    PL ++  PE  E    T  EP   EA    E
Sbjct: 207 PLVSEQSDNSAVGENEEINGNSSNTAQIDPLSYEATPEPAE----TSIEPLAAEAASAYE 262

>CAGL0L10252g complement(1100014..1102551) similar to sp|P50275
           Saccharomyces cerevisiae YOR058c ASE1
           microtubule-associated protein, start by similarity
          Length = 845

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 22/113 (19%)

Query: 740 EFDESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQ 799
           E   + + +Q  ED L+ C T+ KKL            +E Y++  P+    ++  E+  
Sbjct: 489 EMRHTSNSLQDDEDTLEICETEVKKL------------EEQYSLYKPVL---DLYEEFNS 533

Query: 800 MAANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWL 852
           + ++++F    S D  RL      AR  HK+L  + K R  K+ T H+  V L
Sbjct: 534 LLSDQAFLEASSKDSSRLL-----ARNSHKILLKEEKTR--KRITRHFPRVIL 579

>Kwal_47.17390
          Length = 801

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 86/212 (40%), Gaps = 27/212 (12%)

Query: 299 FELYEKDAHLGHHLFDLKIAGGGRANMQLAGVPEMSFDYWASQFIQYGYKVAKVD-QKES 357
           +ELY  D  LG    ++ I G    NM +  V       W ++        A +D  K S
Sbjct: 92  YELY--DPRLGGK--EVIIDGENNLNMSIHFVKSRDGQNWVAKV-----SGAPLDPNKPS 142

Query: 358 MLAKEM---REGSKGIVERELQCVLTSGTLTDSEMLKSDLATYCVAVREEPITYYDEEIL 414
           +L+  +   + G +G +EREL  VL  G L  +  + SD  TY +A+++    YY     
Sbjct: 143 VLSIVLYFSQNGPEGHLERELLEVLPEGQLKLNG-ISSDFGTYNIAIKDVSGRYY----- 196

Query: 415 ALPKTGKYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFKPT--EVIMEKSNV--CS 470
                G   G  +  + T H+  L   DD+     D   S    +  ++I    N+   S
Sbjct: 197 ---ARGPALGPDSDSSRTAHMS-LTVPDDQVWKAKDIFQSLLTDSVQDIISRGENLDPLS 252

Query: 471 LAQKIIKFNAQPEAIINQRTSKEFYDFEKTFD 502
           L   ++  N    A  N    ++ +DF   F+
Sbjct: 253 LPSALMIRNVHSFAPGNFHFVQKTFDFTDPFE 284

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,171,169
Number of extensions: 1569990
Number of successful extensions: 6490
Number of sequences better than 10.0: 97
Number of HSP's gapped: 6575
Number of HSP's successfully gapped: 132
Length of query: 1176
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1063
Effective length of database: 12,684,275
Effective search space: 13483384325
Effective search space used: 13483384325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)