Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17710g82180939530.0
AGR117C79985720880.0
Kwal_56.2345382884720410.0
YER169W (RPH1)79685117690.0
Scas_681.1986488917710.0
CAGL0L11880g98095614680.0
Scas_76.12282236773e-83
YDR096W (GIS1)8945287186e-82
KLLA0D10758g8502433001e-27
Sklu_2303.67951572954e-27
CAGL0H00528g7401572751e-24
ABR167C7761572751e-24
Kwal_55.218555211572711e-24
Scas_691.277352212671e-23
YJR119C7281572642e-23
CAGL0G08107g625832115e-17
Scas_709.32822541704e-12
Scas_649.28730561642e-11
Sklu_2181.1410541613e-11
Scas_602.9547571605e-11
Kwal_47.17241403541586e-11
ACL057W520541589e-11
KLLA0C17072g474541543e-10
CAGL0E04884g1489531553e-10
CAGL0M13189g541561533e-10
CAGL0L06072g300641504e-10
CAGL0K02145g317541495e-10
AGR031W140501406e-10
Kwal_56.2420615022391536e-10
ABR089C571561508e-10
Kwal_26.8351698561501e-09
YKL062W (MSN4)630541491e-09
Scas_721.921152531492e-09
AGR172W1057531482e-09
YDR043C (NRG1)231681412e-09
KLLA0F26961g694561463e-09
Sklu_2357.7157501354e-09
AFL127C15212001464e-09
KLLA0F13046g1379531455e-09
YER130C443541401e-08
Sklu_2351.6548551401e-08
CAGL0F05995g597551383e-08
YMR037C (MSN2)704511383e-08
Kwal_27.10925264501333e-08
Scas_707.31289671343e-08
Scas_718.44266591333e-08
CAGL0K12078g463781364e-08
CAGL0A01628g424561354e-08
KLLA0E10989g474741354e-08
YOR113W (AZF1)914531365e-08
Scas_703.231341561357e-08
AFR471C389551329e-08
KLLA0F18524g357521311e-07
Scas_712.42*290571301e-07
CAGL0M00594g1020561341e-07
AER159C1191561331e-07
Kwal_47.166211178561331e-07
YML081W1251561331e-07
KLLA0B04477g1332561331e-07
YDR216W (ADR1)1323531312e-07
YPL038W (MET31)177551232e-07
YJR127C (ZMS1)1380561312e-07
Sklu_2443.22213561243e-07
CAGL0L07480g314701263e-07
Scas_569.2293521263e-07
CAGL0K09372g396561265e-07
AFR580C838491275e-07
ACR264W769531275e-07
Scas_697.35839531276e-07
Scas_575.3455551266e-07
KLLA0F23782g782521268e-07
KLLA0B07909g922491268e-07
Kwal_47.17888786521258e-07
Scas_717.17525591259e-07
CAGL0H04213g1321531251e-06
Scas_378.1208571191e-06
YGR067C794531241e-06
Kwal_14.2278463521222e-06
YGL209W (MIG2)382581212e-06
YGL035C (MIG1)504721212e-06
Scas_683.25879511213e-06
AGL207W277501174e-06
YBR066C (NRG2)220501154e-06
Scas_720.3914551991196e-06
YDR253C (MET32)191541136e-06
CAGL0L03916g642521169e-06
Kwal_47.19045266611121e-05
Scas_693.31635551142e-05
CAGL0K04631g1013521152e-05
KLLA0B00605g239511093e-05
KLLA0B03454g472541114e-05
CAGL0C02519g318661094e-05
KLLA0C16203g14542571115e-05
Scas_687.33288571086e-05
Scas_719.681350561106e-05
YPL230W391531088e-05
AGL071C396631088e-05
CAGL0K03003g647711081e-04
YER028C394571071e-04
YDR146C (SWI5)709551062e-04
CAGL0M06831g645481062e-04
Scas_568.5199551012e-04
Kwal_26.8021507531042e-04
AGL197W844481034e-04
Kwal_27.11460531551024e-04
YMR176W (ECM5)14112691034e-04
Scas_720.3331653998e-04
KLLA0F11682g37458998e-04
AEL278W47677999e-04
Scas_631.743377999e-04
Scas_636.14d27555989e-04
Kwal_56.23925745551000.001
CAGL0J05060g71366990.001
Sklu_2389.276755990.001
CAGL0M01870g31550970.001
KLLA0D16456g85447990.001
KLLA0E08679g59642980.001
Scas_695.257152980.001
KLLA0E18645g43152970.002
AEL174W66153980.002
CAGL0H07557g47655970.002
Scas_711.5683248970.002
Scas_627.17d27555950.002
YJL056C (ZAP1)88041970.002
Kwal_23.540042944960.002
YMR070W (MOT3)49057960.002
AGL246W22774930.003
CAGL0B02651g18952920.003
Scas_721.5619982920.003
CAGL0E06116g61343950.004
Kwal_14.254371161950.004
ADL198W54749940.004
YMR182C (RGM1)21144910.004
CAGL0E01331g68955930.006
Scas_717.60d16751880.007
Kwal_27.1182419956890.007
CAGL0M04323g70355920.007
KLLA0C16005g33154910.007
KLLA0F20636g28553910.007
YNL027W (CRZ1)67858920.008
KLLA0F01463g78153920.009
CAGL0G10021g39453910.009
YPR186C (PZF1)42977900.010
YLR131C (ACE2)77055900.013
Kwal_27.1046730250880.015
CAGL0L12562g22348870.016
CAGL0I02838g65540890.017
Kwal_14.220625448870.020
CAGL0E04312g68871880.024
KLLA0A04609g42351870.025
Kwal_47.1657788150870.028
AFL136W40943870.028
Sklu_1527.120562820.054
AFR461C54493850.054
Scas_718.6747357840.060
ADR308C27853830.066
Scas_718.36d33050830.077
YDL020C (RPN4)53176830.081
KLLA0E03146g78891830.081
KLLA0D11902g28957810.099
Sklu_2126.544844810.16
Sklu_2289.129152790.20
YDR463W (STP1)51971800.20
CAGL0L00583g38839790.23
YHR006W (STP2)54187790.23
Scas_604.458544790.27
CAGL0K01727g49957780.28
CAGL0K02343g116263790.31
Scas_627.6120758790.32
CAGL0E03762g58449780.35
KLLA0A10373g20655760.35
KLLA0E00726g51749780.35
Kwal_47.1833753681780.37
Scas_641.2453281770.39
YHL027W (RIM101)62545770.49
Sklu_2244.327153750.50
CAGL0I02816g29157740.68
YGL254W (FZF1)29954740.71
Scas_713.1146557750.75
AFR190C43244750.80
Sklu_2436.951764750.85
YPR022C113351750.94
Sklu_2359.572261731.3
Sklu_1870.436557731.3
Scas_660.1236764721.3
KLLA0F10109g62364731.5
Kwal_26.930030424702.2
Scas_712.232752702.3
ADL040W33051702.5
KLLA0E12155g18140682.6
Kwal_33.1422755172703.0
Kwal_55.2063441945693.9
CAGL0K06413g35985684.4
Scas_591.8680100684.8
KLLA0F21692g1525132685.4
Scas_670.243547676.1
Kwal_27.1016728556666.4
Scas_683.3047847676.8
YLR375W34334668.5
YIL162W (SUC2)53247668.6
CAGL0G07172g86650669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17710g
         (809 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...  1527   0.0  
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...   808   0.0  
Kwal_56.23453                                                         790   0.0  
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...   686   0.0  
Scas_681.19                                                           686   0.0  
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...   570   0.0  
Scas_76.1                                                             265   3e-83
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...   281   6e-82
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...   120   1e-27
Sklu_2303.6 YJR119C, Contig c2303 8969-11356                          118   4e-27
CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces cer...   110   1e-24
ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2...   110   1e-24
Kwal_55.21855                                                         108   1e-24
Scas_691.27                                                           107   1e-23
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...   106   2e-23
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    86   5e-17
Scas_709.32                                                            70   4e-12
Scas_649.28                                                            68   2e-11
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            67   3e-11
Scas_602.9                                                             66   5e-11
Kwal_47.17241                                                          65   6e-11
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    65   9e-11
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    64   3e-10
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    64   3e-10
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    64   3e-10
CAGL0L06072g complement(679924..680826) some similarities with s...    62   4e-10
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    62   5e-10
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    59   6e-10
Kwal_56.24206                                                          64   6e-10
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    62   8e-10
Kwal_26.8351                                                           62   1e-09
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    62   1e-09
Scas_721.92                                                            62   2e-09
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    62   2e-09
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    59   2e-09
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    61   3e-09
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        57   4e-09
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    61   4e-09
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    60   5e-09
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    59   1e-08
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       59   1e-08
CAGL0F05995g complement(598819..600612) some similarities with s...    58   3e-08
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    58   3e-08
Kwal_27.10925                                                          56   3e-08
Scas_707.31                                                            56   3e-08
Scas_718.44                                                            56   3e-08
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    57   4e-08
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    57   4e-08
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    57   4e-08
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    57   5e-08
Scas_703.23                                                            57   7e-08
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    55   9e-08
KLLA0F18524g complement(1701498..1702571) some similarities with...    55   1e-07
Scas_712.42*                                                           55   1e-07
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    56   1e-07
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    56   1e-07
Kwal_47.16621                                                          56   1e-07
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    56   1e-07
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    56   1e-07
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    55   2e-07
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    52   2e-07
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    55   2e-07
Sklu_2443.22 , Contig c2443 45390-46027                                52   3e-07
CAGL0L07480g complement(822240..823184) some similarities with s...    53   3e-07
Scas_569.2                                                             53   3e-07
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    53   5e-07
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    54   5e-07
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    54   5e-07
Scas_697.35                                                            54   6e-07
Scas_575.3                                                             53   6e-07
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    53   8e-07
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    53   8e-07
Kwal_47.17888                                                          53   8e-07
Scas_717.17                                                            53   9e-07
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    53   1e-06
Scas_378.1                                                             50   1e-06
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    52   1e-06
Kwal_14.2278                                                           52   2e-06
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    51   2e-06
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    51   2e-06
Scas_683.25                                                            51   3e-06
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    50   4e-06
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    49   4e-06
Scas_720.39                                                            50   6e-06
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    48   6e-06
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    49   9e-06
Kwal_47.19045                                                          48   1e-05
Scas_693.31                                                            49   2e-05
CAGL0K04631g complement(440721..443762) some similarities with s...    49   2e-05
KLLA0B00605g complement(46736..47455) some similarities with sp|...    47   3e-05
KLLA0B03454g complement(314015..315433) some similarities with s...    47   4e-05
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    47   4e-05
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    47   5e-05
Scas_687.33                                                            46   6e-05
Scas_719.68                                                            47   6e-05
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    46   8e-05
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    46   8e-05
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    46   1e-04
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    46   1e-04
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    45   2e-04
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    45   2e-04
Scas_568.5                                                             44   2e-04
Kwal_26.8021                                                           45   2e-04
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    44   4e-04
Kwal_27.11460                                                          44   4e-04
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    44   4e-04
Scas_720.33                                                            43   8e-04
KLLA0F11682g complement(1068992..1070116) some similarities with...    43   8e-04
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    43   9e-04
Scas_631.7                                                             43   9e-04
Scas_636.14d                                                           42   9e-04
Kwal_56.23925                                                          43   0.001
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    43   0.001
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            43   0.001
CAGL0M01870g complement(219813..220760) some similarities with t...    42   0.001
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    43   0.001
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    42   0.001
Scas_695.2                                                             42   0.001
KLLA0E18645g complement(1648263..1649558) some similarities with...    42   0.002
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    42   0.002
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    42   0.002
Scas_711.56                                                            42   0.002
Scas_627.17d                                                           41   0.002
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    42   0.002
Kwal_23.5400                                                           42   0.002
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    42   0.002
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    40   0.003
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    40   0.003
Scas_721.56                                                            40   0.003
CAGL0E06116g complement(604708..606549) some similarities with t...    41   0.004
Kwal_14.2543                                                           41   0.004
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    41   0.004
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    40   0.004
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    40   0.006
Scas_717.60d                                                           39   0.007
Kwal_27.11824                                                          39   0.007
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    40   0.007
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    40   0.007
KLLA0F20636g complement(1914452..1915309) some similarities with...    40   0.007
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    40   0.008
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    40   0.009
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    40   0.009
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    39   0.010
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    39   0.013
Kwal_27.10467                                                          39   0.015
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    38   0.016
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    39   0.017
Kwal_14.2206                                                           38   0.020
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    39   0.024
KLLA0A04609g complement(411494..412765) some similarities with s...    38   0.025
Kwal_47.16577                                                          38   0.028
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    38   0.028
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             36   0.054
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    37   0.054
Scas_718.67                                                            37   0.060
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    37   0.066
Scas_718.36d                                                           37   0.077
YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of ...    37   0.081
KLLA0E03146g complement(299014..301380) similar to sp|Q12386 Sac...    37   0.081
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    36   0.099
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            36   0.16 
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          35   0.20 
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    35   0.20 
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    35   0.23 
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    35   0.23 
Scas_604.4                                                             35   0.27 
CAGL0K01727g complement(152569..154068) similar to sp|Q03465 Sac...    35   0.28 
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    35   0.31 
Scas_627.6                                                             35   0.32 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    35   0.35 
KLLA0A10373g complement(907244..907864) some similarities with c...    34   0.35 
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    35   0.35 
Kwal_47.18337                                                          35   0.37 
Scas_641.24                                                            34   0.39 
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    34   0.49 
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                33   0.50 
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    33   0.68 
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    33   0.71 
Scas_713.11                                                            33   0.75 
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    33   0.80 
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          33   0.85 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    33   0.94 
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          33   1.3  
Sklu_1870.4 YLR056W, Contig c1870 4612-5709                            33   1.3  
Scas_660.12                                                            32   1.3  
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    33   1.5  
Kwal_26.9300                                                           32   2.2  
Scas_712.2                                                             32   2.3  
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    32   2.5  
KLLA0E12155g 1079451..1079996 similar to sp|P33421 Saccharomyces...    31   2.6  
Kwal_33.14227                                                          32   3.0  
Kwal_55.20634                                                          31   3.9  
CAGL0K06413g 627811..628890 some similarities with sp|Q00947 Sac...    31   4.4  
Scas_591.8                                                             31   4.8  
KLLA0F21692g complement(2014152..2018729) gi|14571818|gb|AAK6729...    31   5.4  
Scas_670.2                                                             30   6.1  
Kwal_27.10167                                                          30   6.4  
Scas_683.30                                                            30   6.8  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    30   8.5  
YIL162W (SUC2) [2515] chr9 (37385..38983) Beta-fructofuranosidas...    30   8.6  
CAGL0G07172g complement(678730..681330) some similarities with Y...    30   9.7  

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 1527 bits (3953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 746/809 (92%), Positives = 746/809 (92%)

Query: 1   MSYEPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSA 60
           MSYEPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSA
Sbjct: 1   MSYEPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSA 60

Query: 61  ETLQKIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNEDS 120
           ETLQKIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNEDS
Sbjct: 61  ETLQKIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNEDS 120

Query: 121 SGIEPHQQSNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLNFT 180
           SGIEPHQQSNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLNFT
Sbjct: 121 SGIEPHQQSNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLNFT 180

Query: 181 EPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQ 240
           EPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQ
Sbjct: 181 EPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQ 240

Query: 241 DLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLLQS 300
           DLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLLQS
Sbjct: 241 DLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLLQS 300

Query: 301 NGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCIDDA 360
           NGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCIDDA
Sbjct: 301 NGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCIDDA 360

Query: 361 VGINVQKLRSNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEERPPLKKFKMGDSDR 420
           VGINVQKLRSNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEERPPLKKFKMGDSDR
Sbjct: 361 VGINVQKLRSNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEERPPLKKFKMGDSDR 420

Query: 421 SFDSVKSTPEFLLKTNSXXXXXXXXXXXXXXXXXSSIRSTTPNSQKTGLYGFGIKKEGAF 480
           SFDSVKSTPEFLLKTNS                 SSIRSTTPNSQKTGLYGFGIKKEGAF
Sbjct: 421 SFDSVKSTPEFLLKTNSDLLDEKANLDNLNNNNNSSIRSTTPNSQKTGLYGFGIKKEGAF 480

Query: 481 NSNTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKKQSQFMPLSMXXXXXXXXXXXXX 540
           NSNTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKKQSQFMPLSM             
Sbjct: 481 NSNTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKKQSQFMPLSMAQQQAIFPPPAQN 540

Query: 541 XXXXXSGQMSPSENAFFSPSHDHEDNMIALSLALMANSSPAFNQLPPLNISNPRPYSPIL 600
                SGQMSPSENAFFSPSHDHEDNMIALSLALMANSSPAFNQLPPLNISNPRPYSPIL
Sbjct: 541 PLPAPSGQMSPSENAFFSPSHDHEDNMIALSLALMANSSPAFNQLPPLNISNPRPYSPIL 600

Query: 601 QDSILSPRPSYNSNVLSYGQAGNTKSPLGGFSSSTQLPFIKRIQSPNRVTLNIXXXXXXX 660
           QDSILSPRPSYNSNVLSYGQAGNTKSPLGGFSSSTQLPFIKRIQSPNRVTLNI       
Sbjct: 601 QDSILSPRPSYNSNVLSYGQAGNTKSPLGGFSSSTQLPFIKRIQSPNRVTLNISRESSRS 660

Query: 661 XXXXXGMYGNPNAMMVPIPHPYQSSQTSTLNQVSTAERSPAVTPPTSPSXXXXXXXXXXX 720
                GMYGNPNAMMVPIPHPYQSSQTSTLNQVSTAERSPAVTPPTSPS           
Sbjct: 661 PVSLSGMYGNPNAMMVPIPHPYQSSQTSTLNQVSTAERSPAVTPPTSPSKNKPARKKAPK 720

Query: 721 XXXXXIDPESPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSG 780
                IDPESPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSG
Sbjct: 721 QPKAKIDPESPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSG 780

Query: 781 EKPHSCPKCGKKFKRRDHVLQHLNKKIPC 809
           EKPHSCPKCGKKFKRRDHVLQHLNKKIPC
Sbjct: 781 EKPHSCPKCGKKFKRRDHVLQHLNKKIPC 809

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/857 (51%), Positives = 549/857 (64%), Gaps = 119/857 (13%)

Query: 1   MSYEPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSA 60
           MS  PDH+EG VPVF+P +E F+DFYK+M  +++YGMKSG++KI+PP +WV+++   P  
Sbjct: 1   MSGNPDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGV 60

Query: 61  ETLQKIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPE----GRHSAK 116
           E L++I I++PIQQH+SGSKGVFVVQNVE+ KSYN+IQWK L+ DY+LP+    G   ++
Sbjct: 61  EQLRRIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMRGYGGSLSR 120

Query: 117 NEDSSGIEPHQQSNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKT 176
           +  + G  P  + + +R++  DSF+ +DF +F+E++N + L Q+DDE  +  LE+YYWKT
Sbjct: 121 SAAAGGARP--RPSNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKT 178

Query: 177 LNFTEPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWH 236
           LNFTEPMYGAD+LG+LF DS+ +WN+S LP++L++L+EKVPGVN+SYLYAGLWKASFAWH
Sbjct: 179 LNFTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWH 238

Query: 237 LEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPK 296
           LEDQDLYSINY+HFGAPKQWYSIPQEDS KF+ FM+EQFPEES  C EFLRHKMF+VSPK
Sbjct: 239 LEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPK 298

Query: 297 LLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLC 356
           +L+ NGIRCN IVHRQ EF+VTYP+GYH+GFNYGYNLAESVNFAL SWL IG KAKKC+C
Sbjct: 299 VLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCMC 358

Query: 357 IDDAVGINVQKLRSNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEERPPLKKFKMG 416
           +DD+VGI++QKL+S Y  S            +Q D++ S+        +  PP K+ K  
Sbjct: 359 VDDSVGIDIQKLKSAYFRS------------LQEDRAGSA--------DPEPPRKRLKQE 398

Query: 417 DSDRSF---------DSVKSTPEFLLKTNSXXXXXXXXXXXXXXXXXSSIRSTTPNSQKT 467
            +  SF         DS+KS  E +                       SIRSTTPN    
Sbjct: 399 PNTSSFVQAPILDTGDSLKSFNELI------NHSAYELQAMEDNPNQRSIRSTTPNQ--- 449

Query: 468 GLYGFGIKKEGAFNSNTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKKQSQFMPLSM 527
                       + SN SISR+SSPLLSRMMDLS+IVEPTLEDPTLKFK+K         
Sbjct: 450 ------------YFSNPSISRMSSPLLSRMMDLSNIVEPTLEDPTLKFKRK--------- 488

Query: 528 XXXXXXXXXXXXXXXXXXSGQMSPSENAFFSP---SHDHEDNMIALSLALMANS--SPAF 582
                             SG  +P  +    P   ++ HE++++ALSLA MANS  S   
Sbjct: 489 ---VVAQDTSNAMAPNPVSGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSGNSSPR 545

Query: 583 NQLPPLN--ISNPRPYSPILQDSILSPRPSYNSNVLSYGQAGNTKSPLGGFSSSTQLPFI 640
           N LPPLN  + N RPY+P   D+IL+PRPSY+ N LSY     TKSP         +P  
Sbjct: 546 NALPPLNSAVGNSRPYTPT-GDAILAPRPSYDQNPLSYYSTQTTKSP---------MPLF 595

Query: 641 KRIQSPNRVTLNIXXXXXXXXXXXXGMYGNPNAMMVPIPHPYQSSQT--STLNQVSTAER 698
           KRI SPNRVTLNI              YG P    +  PHP  +     ++LNQVST ER
Sbjct: 596 KRINSPNRVTLNISRESSRSPISFGSEYGKPP---LSKPHPLNAGAVNLTSLNQVSTIER 652

Query: 699 S-PAVTPPTSPSXXXXXXXXXXXXXXXXID-------------------------PESPT 732
           + P+    ++ +                +                          PE  T
Sbjct: 653 NIPSHRDRSAKAYHGDKVNIHGVSSGKFVGHQINDSLALLNDDALTNSVLPGAGRPERAT 712

Query: 733 SALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKK 792
           S    SKI+ EEI+  D G K YVCQEC RQFSSGHHLTRHKKSVHSGEKPHSCPKCGKK
Sbjct: 713 S--PTSKISAEEIIISDKG-KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKK 769

Query: 793 FKRRDHVLQHLNKKIPC 809
           FKRRDHVLQHLNKKIPC
Sbjct: 770 FKRRDHVLQHLNKKIPC 786

>Kwal_56.23453
          Length = 828

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/847 (51%), Positives = 542/847 (63%), Gaps = 105/847 (12%)

Query: 5   PDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSAETLQ 64
           P  +EG VPVF+P+YE F+DFY++M  V+KYG KSGI+K++PP++W+D++  PP  ETLQ
Sbjct: 6   PSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVETLQ 65

Query: 65  KIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNE------ 118
           KI+I+TPIQQH +GSKGVFVVQNVEK KSYN+IQWK +S+DY+LP+G   A         
Sbjct: 66  KIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPDGGGEASGSSEADAG 125

Query: 119 DSSGIEPHQ---QSNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWK 175
           D+ G        +S+K++ +  +SF+  +FEKF  ++N D+L  F D  R EFLESY+WK
Sbjct: 126 DTLGARKSPSPLKSSKIKLRSPESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLESYFWK 185

Query: 176 TLNFTEPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAW 235
           TL FT PMYGADSLGSLF+D +  WN+S LP+IL++++ KVPGVN SYLYAGLWKASF+W
Sbjct: 186 TLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWKASFSW 245

Query: 236 HLEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSP 295
           HLEDQDLYSINYIHFGAPKQWYSIPQEDS+KFY FM+EQFPE +  C EFLRHK FLVSP
Sbjct: 246 HLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSP 305

Query: 296 KLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCL 355
           K+L+ NGIRCN IVH QQEFI+TYP+GYHAGFNYGYNLAESVNFAL +WLDIG KAK+CL
Sbjct: 306 KILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKAKRCL 365

Query: 356 CIDDAVGINVQKLRSNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEE-----RPPL 410
           CIDDAVGI+V+KLR +++ S     + +   E+Q  +  S+  + +   E+     + P 
Sbjct: 366 CIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQESQRGSNGVSKKAKFEKDSASTKQPS 425

Query: 411 KKFKMGD-----SDRS-FDSVKSTPEFLLKTNSXXXXXX---------------XXXXXX 449
           +  K  D     SD+S  + V  TP   L  N                            
Sbjct: 426 EGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLHHSSYELQAME 485

Query: 450 XXXXXSSIRSTTPNSQKTGLYGFGIKKEGAFNSNTSISRVSSPLLSRMMDLSHIVEPTLE 509
                S+IRSTTPN    G Y  G+ +        SISR+SSPLLSRMMDLS+IVEPTLE
Sbjct: 486 DNPQQSAIRSTTPN---PGQYYSGLSQ--------SISRISSPLLSRMMDLSNIVEPTLE 534

Query: 510 DPTLKFKKKQSQFMPLSMXXXXXXXXXXXXXXXXXXSGQMSPSENAFFSPSHDHEDNMIA 569
           DPTLKFKK                            S  +S   +       D++DNM+A
Sbjct: 535 DPTLKFKK----------------------------SSNLSQQNSQTPQVLEDNDDNMLA 566

Query: 570 LSLALMAN--SSPAFNQLPPLNISNPRPYSP-ILQDSILSPRPSYNSNVLSYGQAGNTKS 626
           LSLA MA+  SSP +  LPP+    PRPYSP +  DS+L+  P Y  N  SY  + N KS
Sbjct: 567 LSLASMASGASSPRY-PLPPI---QPRPYSPAVAGDSMLASGPLYEQNPFSY-YSTNFKS 621

Query: 627 PLGGFSSS----TQLPFIKRIQSPNRVTLNIXXXXXXXXXXXXGMYGNPNAMMVPIPHPY 682
            +G    S    + LPFIKR++SPNRVTLNI              + +P  +   I    
Sbjct: 622 TMGSPQPSSPALSNLPFIKRLKSPNRVTLNISRESSRSPILLNSEFKSP--LSNNIAANG 679

Query: 683 QSSQTSTLNQVSTAERSPAVTPPTSPSXXXXXXXXXXXXXXXXIDPESPTSALAQSKIND 742
            ++  S L+Q +T E SP V+PP   +                         +A SKIN 
Sbjct: 680 NTAVNSNLSQATTVEHSPPVSPPIPNNSIADFSKR----------------PIAPSKINS 723

Query: 743 EEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           EEI+  D G KVYVCQEC RQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH
Sbjct: 724 EEIIVSDKG-KVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 782

Query: 803 LNKKIPC 809
           LNKKIPC
Sbjct: 783 LNKKIPC 789

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/851 (46%), Positives = 504/851 (59%), Gaps = 140/851 (16%)

Query: 5   PDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSAETLQ 64
           P    G VPVFKP YE F DFY +   +NKYGMKSG++K++PP++W DK+  P SAETLQ
Sbjct: 7   PSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAETLQ 66

Query: 65  KIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNEDSSGIE 124
           KIKIK+PIQQHISG+KG+F+VQNVEK K+YN+IQWK LS DY  PE   + +N     + 
Sbjct: 67  KIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNSRKGSV- 125

Query: 125 PHQQSNKVRSKCLDS-FTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLNFTEPM 183
              +S K++ K  +S F +DDFE+FR  +  D L  F + +R++FLE YYWKTLNFT PM
Sbjct: 126 --SKSTKLKLKNFESSFNIDDFEQFRTEYTID-LSDFQNTERLKFLEEYYWKTLNFTTPM 182

Query: 184 YGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLY 243
           YGAD+ GS+F + +  WN++ LP+IL++++ KVPGVN+SYLYAGLWKASF+WHLEDQDLY
Sbjct: 183 YGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLY 242

Query: 244 SINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLLQSNGI 303
           SINYIHFGAPKQWYSIPQED  KFY FM+EQFPEE+KNC EFLRHKMFL SPKLLQ NGI
Sbjct: 243 SINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQENGI 302

Query: 304 RCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCIDDAVGI 363
           RCN IVH + EF++TYP+GYHAGFNYGYNLAESVNFAL  WL IG KA KC CI D+V I
Sbjct: 303 RCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSVEI 362

Query: 364 NVQKLRSNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEERPPLKKFKMGDSDRSFD 423
           +V+KL  ++         ++  KE +    ++        L  RP LK+ +         
Sbjct: 363 DVKKLAKSW---------RDNNKESKGTPPLNQLPNPAMPLLHRPTLKEME--------- 404

Query: 424 SVKSTPEFLLKTNSXXXXXXXXXXXXXXXXXSSIRSTTPNSQKTGLYGFGIKKEGAF-NS 482
                                          SS+RST+P+              G F N 
Sbjct: 405 ------------------------------SSSLRSTSPDV-------------GHFSNF 421

Query: 483 NTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKKQS-QFMPLSMXXXXXXXXXXXXXX 541
            +  S VSSPLLSRM D S+IVEPTLEDPTLK K+  S Q  PL+               
Sbjct: 422 KSKSSGVSSPLLSRMKDYSNIVEPTLEDPTLKLKRISSFQEQPLNKLL------------ 469

Query: 542 XXXXSGQMSPSENAFFSPSHDHEDNMIALSLALMANSSPAFNQLP--PLN----ISNPRP 595
                 +   S+ A  +   DHEDN++A+SL  MANS+ +  +LP   LN    +SN +P
Sbjct: 470 ------KRETSQTAMLT---DHEDNIVAMSLTSMANSAASSPRLPLSRLNSSNELSNAQP 520

Query: 596 YSPILQDSILSPRPSYNS--NVLSYGQAGNTKSPLGGFSSST-------QLPFIKRIQSP 646
              +  +++  PRP+  S  N L Y    N    + G S S         +  IKR++SP
Sbjct: 521 LLDMTNNTLAFPRPNGPSGLNPLLYISNKN----ISGISHSAPHSPVNPNISLIKRVKSP 576

Query: 647 NRVTLNIXXXX----------XXXXXXXXGMYGNPNAMM---------------VPIPHP 681
           N VTLNI                        +  P+ +                +  PHP
Sbjct: 577 NIVTLNISRESSRSPIALNYEARQQHSQQHSFSTPSTVSNLSTSVLGPLSDTNDIKTPHP 636

Query: 682 YQSSQTSTLNQVSTAERSPAVTPPTS---PSXXXXXXXXXXXXXXXXIDPESPTSALAQS 738
            + +   T N++   E SP  T  ++                     +D E  +S L  S
Sbjct: 637 ERPNH-KTANRILKKE-SPVETSKSNLILSKVASTRQEDSFTSRNDDLDKEQGSSPL-NS 693

Query: 739 KINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDH 798
           K   EEI+ L   +K+Y+C+EC R+FSSGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDH
Sbjct: 694 KFAPEEIV-LSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDH 752

Query: 799 VLQHLNKKIPC 809
           VLQHLNKKIPC
Sbjct: 753 VLQHLNKKIPC 763

>Scas_681.19
          Length = 864

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/889 (45%), Positives = 516/889 (58%), Gaps = 160/889 (17%)

Query: 4   EPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSAETL 63
           +P   E  +P+FKP ++ F+DFYKFM  +NK+GM+SGI+K++PP +W+  +  PPS E L
Sbjct: 8   KPALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVEAL 67

Query: 64  QKIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSA-KNED--- 119
           Q IKIK PI+Q ISG+ G+F+  N+E+ K+Y++IQWK LS DY LP+  HS  KN+D   
Sbjct: 68  QGIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPDT 127

Query: 120 --SSGIE-PHQQSNKVRSKCLDSFTLDDFEKFRENFN--CDHLEQFDDEQRVEFLESYYW 174
                IE P   S+    K   SF+ +DF+ F++NFN   + L+QF+D++R+ FLE+YYW
Sbjct: 128 NNGKTIEMPSSTSSATHRKRQHSFSKEDFKNFQKNFNESDEILKQFNDKERLNFLENYYW 187

Query: 175 KTLNFTEPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFA 234
           KTLNFT PMYGAD+ GS+F +++  WN+S LP++L+YLD+++PGVN+S+LYAGLWKASF 
Sbjct: 188 KTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASFP 247

Query: 235 WHLEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVS 294
           WHLEDQDLYSIN+IHFGAPKQWYSIPQED + FYNFM+EQFPEE+K C EFLRHK F+ S
Sbjct: 248 WHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMAS 307

Query: 295 PKLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKC 354
           PKLL  NGIRCN IVH Q EF++T+P+GYHAGFNYGYNLAESVNFAL  WL+IG +A KC
Sbjct: 308 PKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERANKC 367

Query: 355 LCIDDAVGINVQKLRSN-YMHSPNGGAQKETGKEVQNDKSI--SSSKTLEEVLEER--PP 409
           LC++D+V I+V+KL SN Y+       + ET   V++   +   SS+ L+ + +++   P
Sbjct: 368 LCVNDSVEIDVRKLASNWYIFKNKPNLKNETDLRVRSFTELLNHSSQELQNIQKKQQVQP 427

Query: 410 LKKFKMGDSDRSFDSVKSTPEFLLKTNSXXXXXXXXXXXXXXXXXSSIRSTTPNSQKTGL 469
           ++ F   + D S  S   TP     TN                                 
Sbjct: 428 IRTFTESNKDVSLRSTSPTPSQFFTTNETNKPV--------------------------- 460

Query: 470 YGFGIKKEGAFNSNTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKK--------QSQ 521
                           ISRVSSP LSRMMDLS+IVEPTLEDPTLKFK+K         + 
Sbjct: 461 ----------------ISRVSSPFLSRMMDLSNIVEPTLEDPTLKFKRKLNAPSVSQNNT 504

Query: 522 FMPLSMXXXXXXXXXXXXXXXXXXSGQMSPSENAFFSP-SHDHEDNMIALSLALMANSS- 579
             P+SM                            F SP   D+EDNMIALSLA MANS  
Sbjct: 505 LPPISMPP-------------------------LFQSPLLEDNEDNMIALSLANMANSGT 539

Query: 580 -------PAFN-QLPPLNISNPRPYSPILQDSILSPRPSY---------NSNVLSYGQAG 622
                  PA N  + P+N S+      I   SIL+P+PS          N+N ++Y    
Sbjct: 540 SSPRLIIPALNSSIDPINSSSSNGNDRI--SSILAPKPSLSSSPYVTSNNNNPMTYNSTF 597

Query: 623 NTKS--------PL--GGFSSSTQLPFIKRIQSPNRVTLNIXXXXXXX--XXXXXGMYGN 670
           +  +        PL  GG S+   L FIKRI+SPN VTLNI                  N
Sbjct: 598 SNHNNNIQNNVVPLSPGGRSN---LSFIKRIKSPNIVTLNISRETSRSPILTSVPDFRSN 654

Query: 671 PNAMMVPIPHPYQSSQTSTLNQ----------------VSTAERSPAVTPPTSPSXXXXX 714
            N        PY +   S+LNQ                V+ +E S    PP         
Sbjct: 655 NNNTGT---LPYSAIPQSSLNQMELNNPLGNDDTNNNTVTNSELSILNQPPQKKQRLTNG 711

Query: 715 XXXXXXXXXXXIDPESPTSAL-------------AQS-KINDEEIMFLDDGSKVYVCQEC 760
                      ++  S    L             AQ+ K   +EI+  + G KVYVC EC
Sbjct: 712 TRSNQRKMELGVEQPSGDGVLIGNSSSNNNNNTNAQAPKFTSDEIIMSETG-KVYVCLEC 770

Query: 761 ARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 809
            RQF+SGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC
Sbjct: 771 KRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 819

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/956 (36%), Positives = 497/956 (51%), Gaps = 164/956 (17%)

Query: 12  VPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSAETLQKIKIKTP 71
           VPVF+P +E F+DF  +M ++  +GM SGI+K++PP +W+D+    P  + L++++I+ P
Sbjct: 7   VPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREVRIRNP 66

Query: 72  IQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNEDSSGIEPHQQSNK 131
           IQQH+SGSKGV+++ NVEK K+YN+IQWK LS+D+++P+   S KN+    I+ +++S +
Sbjct: 67  IQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQDNERSQQ 126

Query: 132 -------VRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLNFTEPMY 184
                  ++ K  DS T +DF+ F + +N +++  FDDE+R++FLESYYWKTLNFT P+Y
Sbjct: 127 RRRSSSGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLNFTTPLY 186

Query: 185 GADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYS 244
           GADS GS+F   ++EWN++ LP++L ++D+ +PGVN++YLYAGLWKASF WHLEDQDLYS
Sbjct: 187 GADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLYS 246

Query: 245 INYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLLQSNGIR 304
           INYIHFGAPKQWYSIPQED EKFY FMKE+FPEE+  C EFLRHKMFLVSPK+L+ N I+
Sbjct: 247 INYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVLKENNIK 306

Query: 305 CNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCIDDAVGIN 364
           CN + H + EFI+TYP+GYHAGFNYGYNLAESVNFAL  WL+IG KA KC CI D+V ++
Sbjct: 307 CNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCISDSVEVD 366

Query: 365 VQKLRSNYMH--------------SPNGGAQKETGKEVQNDKSISSSKTLEEVLEERPP- 409
           V KL  N+ +              SP    +  T    +   ++S++K  +EV  E    
Sbjct: 367 VDKLAENWSNFKKKREIEDPETEDSPQKKRKSSTVDSNETISNVSATKEDDEVKNEDNDD 426

Query: 410 ----LKKFKMGDSDRSFDSVKSTPEFLLKTNSXX--XXXXXXXXXXXXXXXSSIRSTTPN 463
               +K  K   +D + D + ++ +   ++N                    + I +  P 
Sbjct: 427 NSKLIKDVKKEVTDSNEDDLNASVDVQRQSNDNTFGDNSNPATNIKMESNKTKIEANVPG 486

Query: 464 SQKTGLYGFG----------------------IKKEGAFNSNT---------SISRVSSP 492
             K  L GF                         ++    SN+         SI R+SSP
Sbjct: 487 VAKK-LRGFDELLNRSPQNSPRMETSLKNDPFFARDSPLRSNSPGTNLFFNQSIQRMSSP 545

Query: 493 LLSRMMDLSHIVEPTLEDPTLKFKKKQ---SQFMP---LSMXXXXXXXXXXXXXXXXXXS 546
           +LS+M+DLS+IVEPTL+DPTLKFK+K    SQ +    +S                   S
Sbjct: 546 ILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLLQNIQDQQNQQQQQQRS 605

Query: 547 GQMSPSENAFFSPSH-----------DHEDNMIALSLALMANSSPAFNQLPPLNISNP-- 593
              +P  N  F P             +++DNM+ALSL  MANS P+  +L  +NI N   
Sbjct: 606 QNGTPLSNLSFGPMRSGLGSNPVLLDNNDDNMLALSLTSMANSRPSSPRLHHINIPNEAN 665

Query: 594 ------------------RPYSPILQD-SILSPRPSYNSNVLSYGQA-----GNTKSPLG 629
                                S + Q  S++SP+P     V  YG        +  SP+ 
Sbjct: 666 SKMKSGSNDTVNAASNFVTSGSNVQQGMSVVSPKP-----VPYYGNQFERTFNSMPSPIP 720

Query: 630 GFSSSTQLPFIKRIQSPNRVTLNIXXXXXXXXXXXXGMYGNP----NAMMVPIPHPYQSS 685
                + +PFIKR++SPN VTLNI                +P      +  PIP   Q S
Sbjct: 721 MSPGGSNMPFIKRLKSPNIVTLNISREGSKSPVSLQNEVRSPLGLNTTLSYPIPTEKQLS 780

Query: 686 QTSTLNQVSTAERSPAVTPPTSP---------------SXXXXXXXXXXXXXXXXIDPES 730
             + +N  +    SPA+    +                S                    S
Sbjct: 781 NLNPVNNSNYQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYESS 840

Query: 731 PTSALAQSKINDEEI---MFLDDGSKVYVCQECARQFS-----SGHHLTRHKKSVHSGEK 782
           P  +LA +   D E+   M     SK  +  + AR  S      G    + +  +    K
Sbjct: 841 PLMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSGK 900

Query: 783 PHSCPKCGKKF-----------------------------KRRDHVLQHLNKKIPC 809
            + C +C ++F                             KRRDHVLQHLNKKIPC
Sbjct: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPC 956

>Scas_76.1
          Length = 228

 Score =  265 bits (677), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 165/223 (73%), Gaps = 28/223 (12%)

Query: 85  VQNVEKPKSYNVIQWKHLSHDYKLPEG---------------RHSAKNEDSSGIEPHQQ- 128
           VQNVEK K YN+IQWK LSHDYK PEG               R+++  E+ +  E + + 
Sbjct: 1   VQNVEKNKIYNIIQWKDLSHDYKPPEGSSSTDPSTKGMNTRSRNASVGEEDAEHETNSEH 60

Query: 129 ------------SNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKT 176
                       S+K++ +  ++FTL+DFE+F  ++NC++L Q  +  R+EFLESYYW+T
Sbjct: 61  VTQKKKSQSPMKSSKIKLRNHENFTLEDFEEFLPSYNCENLSQLTEPSRLEFLESYYWRT 120

Query: 177 LNFTEPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWH 236
           LNFT PMYGAD+LGSLF D +  WN+S LP++L+++D ++PGVN+SYLYAGLWKASFAWH
Sbjct: 121 LNFTTPMYGADTLGSLFNDKLDTWNVSRLPNLLDHMDRRLPGVNDSYLYAGLWKASFAWH 180

Query: 237 LEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEES 279
           LEDQDLYSINY+HFGAPKQWYSIPQ+DS KFY FM++QFPE++
Sbjct: 181 LEDQDLYSINYLHFGAPKQWYSIPQQDSHKFYKFMQDQFPEDA 223

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score =  281 bits (718), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 174/528 (32%), Positives = 265/528 (50%), Gaps = 86/528 (16%)

Query: 1   MSYEPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSA 60
           M  +P      VPVFKP    F +F  F+ E+ K+G+++GI+K++PP++W++ +   P A
Sbjct: 1   MEIKPVEVIDGVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPA 60

Query: 61  ETLQKIKIKTPIQQHISG----SKGVFVVQNVEKPKSYNVIQWKHL--SHDYKLPEGRHS 114
           E+L+ I++ +PIQQ          GVF ++N    KSYN+ QWK+L  S D ++ +G  +
Sbjct: 61  ESLKTIQLDSPIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAESLDSRISQGDFN 120

Query: 115 AKNEDSSGIEPHQQSNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYW 174
            K                                +EN   D  +   D  +++ LES +W
Sbjct: 121 DK------------------------------TLKENCRVDSQQDCYDLAQLQILESDFW 150

Query: 175 KTLNFTEPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFA 234
           KT+ F++P Y  D   S+F   +  WN+++LP  +   + +        L  G  K  F 
Sbjct: 151 KTIAFSKPFYAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQSKCIFP 202

Query: 235 WHLEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVS 294
           WHL++Q+  SINY+HFGAPKQWYSIP  ++++F   + ++     +NC  F+RH+  + S
Sbjct: 203 WHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNIITS 262

Query: 295 PKLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKC 354
           P  L+ N I+ N +V  Q EFI+T+P+  ++GFNYGYN  ES+ F L     +  +  KC
Sbjct: 263 PDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVRKQPLKC 322

Query: 355 LCIDDAVGINVQKLR----SNYMHSPNGGAQKETGKEVQNDKSISSSKTLEEVLEERPPL 410
            C     G   ++ +    SN  +  N   Q+  G    ND  +      ++V       
Sbjct: 323 GC-----GNKKEERKSGPFSNLSYDSNESEQR--GSITDNDNDL-----FQKV------- 363

Query: 411 KKFKMGDSDRSFDSVKSTPEFLLKTNSXXXXXXXXXXXXXXXXXSSIRSTTPNSQKTGLY 470
                    RSFD + +     L+                    SS+RSTTPN       
Sbjct: 364 ---------RSFDELLNHSSQELQNLEDNKNPLFSNINMNRPQSSSLRSTTPN------- 407

Query: 471 GFGIKKEGAFNSNTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKK 518
             G+ +    N  T+ISR+SSPLLSRMMDLS+IVEPTL+DP  KFK+K
Sbjct: 408 --GVNQFLNMNQ-TTISRISSPLLSRMMDLSNIVEPTLDDPGSKFKRK 452

 Score =  132 bits (332), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 64/72 (88%), Gaps = 1/72 (1%)

Query: 738 SKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 797
           SK  + E++  D G K+Y+C+EC RQFSSGHHLTRHKKSVHSGEKPHSCP+CGK+FKRRD
Sbjct: 812 SKFGENEVIMSDHG-KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRD 870

Query: 798 HVLQHLNKKIPC 809
           HVLQHLNKKIPC
Sbjct: 871 HVLQHLNKKIPC 882

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 64/134 (47%), Gaps = 46/134 (34%)

Query: 562 DHEDNMIALSLALMANSSPAFNQ--LPPLNI-SNPRPYSPILQD---------------- 602
           D++DNM+ALSLA +ANS+ A  +  LPPL+   NP  ++    +                
Sbjct: 560 DNDDNMLALSLATLANSATASPRLTLPPLSSPMNPNGHTSYNGNMMNNNSGNGSNGSNSY 619

Query: 603 ------------------SILSPRPSYNSNVLSYGQAGNTKSPLG-GFS----SSTQLPF 639
                             SI+SP P+Y+ N LS     N+K+PL  G +    S++ +PF
Sbjct: 620 SNGVTTAAATTTSAPHNLSIVSPNPTYSPNPLSL-YLTNSKNPLNSGLAPLSPSTSNIPF 678

Query: 640 IKRIQSPNRVTLNI 653
           +KR    N VTLNI
Sbjct: 679 LKR---NNVVTLNI 689

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score =  120 bits (300), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 112/243 (46%), Gaps = 46/243 (18%)

Query: 155 DHLEQFDDEQ-------RVEFLESYYWKTLNFTEP-----MYGAD-------------SL 189
           +H   FDD+Q        +E LE  +W+ +    P      YGAD             ++
Sbjct: 365 EHCANFDDQQFAGNKPNDIETLEKLFWEHVQEMVPNPITVKYGADIHRNKPGQTTGFPTM 424

Query: 190 G---------------SLFEDSVKEWNISSLP----SILEYLDEKVPGVNESYLYAGLWK 230
           G                  + S   WN+ +LP    S+L  ++ K+ G+   ++Y G   
Sbjct: 425 GYVPPFITDKESDEFKQFLKVSSHPWNLINLPRARGSLLSIINRKISGMTIPWIYVGSTF 484

Query: 231 ASFAWHLEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKM 290
           ++F WHLEDQ   S NY H G+ K WYSIP+  +  F   MK   P+  +   + L   +
Sbjct: 485 STFCWHLEDQYTLSANYQHIGSQKIWYSIPERSTSAFDEMMKNISPDLFERQPDLLHQLI 544

Query: 291 FLVSP--KLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIG 348
            LVSP  K     GI C   +    E+IVTYP  YHAGFN G+N  E+VNF L  WL  G
Sbjct: 545 TLVSPYSKRFVEAGIDCYKAIQNPGEYIVTYPKCYHAGFNSGFNFNEAVNFTLDLWLPYG 604

Query: 349 AKA 351
            ++
Sbjct: 605 LQS 607

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 12 VPVFKPDYETFRDFYKFMC--EVNKYGMKSGIIKIVPPEQW 50
          +P  +P  E F D   F+   EV K GMK G+IK++PPE +
Sbjct: 4  IPTLRPSEEQFLDPIGFLSSNEVKKLGMKYGMIKLIPPESF 44

>Sklu_2303.6 YJR119C, Contig c2303 8969-11356
          Length = 795

 Score =  118 bits (295), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 89/157 (56%), Gaps = 6/157 (3%)

Query: 201 NISSLP----SILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQW 256
           N+ +LP    S+L    +K+ G+   ++Y G   ++F WHLEDQ   S NY H G PK W
Sbjct: 411 NLLNLPQAKGSLLPVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVW 470

Query: 257 YSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSP--KLLQSNGIRCNHIVHRQQE 314
           YSIP+   +KF   MK+  P+  +   + L   + L+SP  K  Q   I C   + +  E
Sbjct: 471 YSIPEHSCDKFNRLMKDIAPDLFEKQPDLLHQLITLISPYDKRFQQAKISCYKALQKPGE 530

Query: 315 FIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKA 351
           +I+T+P  YHAGFN GYN  E+VNF L +WL  G +A
Sbjct: 531 YIITFPKCYHAGFNTGYNFNEAVNFTLDTWLPYGIEA 567

>CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, hypothetical start
          Length = 740

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 88/157 (56%), Gaps = 6/157 (3%)

Query: 201 NISSLP----SILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQW 256
           N+ +LP    S+L +L+  + G+   ++Y G   ++F WHLEDQ   S NY H G+PK W
Sbjct: 390 NLLNLPQASSSLLPFLNRNISGMTIPWIYVGSKFSTFCWHLEDQYTLSANYQHEGSPKVW 449

Query: 257 YSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPK--LLQSNGIRCNHIVHRQQE 314
           YSIP    + F+  + +  P+  +   + L   + L+SP   L +   ++    V    E
Sbjct: 450 YSIPDNSCDNFHKLLHDLTPDLFEKQPDLLHQLVSLISPYDPLFKKYNVKWYKAVQHPNE 509

Query: 315 FIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKA 351
           +IVT+P  YHAGFN GYN+ E+VNF   SWL  G +A
Sbjct: 510 YIVTFPKCYHAGFNTGYNINEAVNFTSESWLPYGLEA 546

>ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2331
           bp, 776 aa]
          Length = 776

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 84/157 (53%), Gaps = 6/157 (3%)

Query: 201 NISSLP----SILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQW 256
           N+ +LP    S+L      + G+   +LY G   ++F WHLEDQ   S NY H G PK W
Sbjct: 394 NLLNLPMARGSLLPVFGRSISGMTVPWLYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVW 453

Query: 257 YSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSP--KLLQSNGIRCNHIVHRQQE 314
           YSIP++ +  F   MK   P+  +   + +   + L+SP  +  ++  I C   V    E
Sbjct: 454 YSIPEQSATAFNKLMKNIAPDLFEKQPDLMHQLVTLISPYDEKFEAANIACYKAVQYPGE 513

Query: 315 FIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKA 351
           +I+TYP  YHAGFN GYN  E+VNF L  W+  G  A
Sbjct: 514 YIITYPKCYHAGFNTGYNFNEAVNFTLDLWVPYGLSA 550

>Kwal_55.21855
          Length = 521

 Score =  108 bits (271), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 85/157 (54%), Gaps = 6/157 (3%)

Query: 201 NISSLPS----ILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQW 256
           N+ +LPS    +L    +K+ G+   ++Y G   ++F WHLEDQ   S N+ H G PK W
Sbjct: 140 NLVNLPSAKGSLLSVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANFQHEGDPKVW 199

Query: 257 YSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSP--KLLQSNGIRCNHIVHRQQE 314
           YSIP    +KF   M++  P+  +   + L   + L++P     +   I C   +    E
Sbjct: 200 YSIPGSSCDKFNTLMRQMAPDLFQKQPDLLHQLVTLIAPYDSAFKDAKISCYKAIQYPGE 259

Query: 315 FIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKA 351
           +I+T+P  YH+GFN GYN  E+VNF L  WL  G +A
Sbjct: 260 YIITFPKCYHSGFNTGYNFNEAVNFTLDLWLPYGIEA 296

>Scas_691.27
          Length = 735

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/221 (32%), Positives = 107/221 (48%), Gaps = 16/221 (7%)

Query: 203 SSLPSILEYLDEK-VPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQWYSIPQ 261
           ++L S+L  L  K + G+   ++Y G   ++F WH+EDQ   S NY H GA K WYSIP 
Sbjct: 396 NALGSLLPLLSNKTISGMTIPWIYVGSTFSTFCWHMEDQYTLSANYQHEGASKIWYSIPA 455

Query: 262 EDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLLQSNGIRCNHIVHRQQEFIVTYPF 321
              E F   +    P+      + +   + LVSP  L    I C   +    E+I+T+P 
Sbjct: 456 SSCEPFQKLLHSMTPDLFIKQQDLIHQLVSLVSPYDL-PKSINCYKAIQNPNEYIITFPK 514

Query: 322 GYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCIDD------AVGINVQKLRSNYMHS 375
            +H+GFN GYNL E+VNF  P WL  G +A     +DD          +V +L  N +  
Sbjct: 515 CFHSGFNTGYNLNEAVNFTTPFWLPFGVEA-----VDDYKLTQRKCAFDVNELLLNLIKY 569

Query: 376 PN-GGAQKETGKEVQNDKSISSSKTLEEVLEERPPLKKFKM 415
            N  G  K+    V     I+  ++L  V  E+  LK+ ++
Sbjct: 570 MNKKGGNKQDISHVLITSCITYLRSL--VFREKSLLKELRV 608

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 84/157 (53%), Gaps = 6/157 (3%)

Query: 201 NISSLP----SILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQW 256
           N+++LP    S+L      + G+   ++Y G   ++F WH+EDQ   S NY H G PK W
Sbjct: 388 NLTNLPMAHNSLLPLFKRNISGMTIPWIYIGSLFSTFCWHMEDQYTLSANYQHEGDPKVW 447

Query: 257 YSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKL--LQSNGIRCNHIVHRQQE 314
           YSIP+    KF + + +  P+      + L   + L+SP     + +GI     V +  E
Sbjct: 448 YSIPESGCTKFNDLLNDMSPDLFIKQPDLLHQLVTLISPYDPNFKKSGIPVYKAVQKPNE 507

Query: 315 FIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKA 351
           +I+T+P  YHAGFN GYN  E+VNF +  WL  G  A
Sbjct: 508 YIITFPKCYHAGFNTGYNFNEAVNFTIDFWLPYGFGA 544

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 85.9 bits (211), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 727 DPESPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC 786
           D ES  +  +  +I + +I +  DG K + C+ C   F S +HL RH+ SVHS EKP++C
Sbjct: 535 DDESSKNVESLGQIFNSKIRY-SDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC 593

Query: 787 PKCGKKFKRRDHVLQHLNKKIPC 809
           P C K FKR+DHV QHL KK PC
Sbjct: 594 PICSKGFKRKDHVSQHLKKKTPC 616

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 105/268 (39%), Gaps = 39/268 (14%)

Query: 70  TPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPEGRHSAKNEDSSGIEPHQQS 129
           T + QH+ G     V   VE PK  +   W  +     + +G+ S K   +SGI     S
Sbjct: 62  TTVFQHVIGED---VPNIVEVPKEIDYHFWIDM-----MDQGKRSKKKCSTSGILDFGMS 113

Query: 130 NKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLNFTEPMYGADSL 189
             V                 ENF+   +     +     LE+ +W      E  Y   S 
Sbjct: 114 LSVA----------------ENFSFVEIPAVTKK-----LENIFW------EHQYAYTSY 146

Query: 190 GS--LFEDSVKEWNISSLPSILEY-LDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSIN 246
            S  + + +V +  I+     LEY L  + P   E  +    +     W ++  + Y + 
Sbjct: 147 YSSLILDKTVPQNEINKELYDLEYILSSERPDCKEK-IKLCCFGTQIPWRIDTVNQYHLI 205

Query: 247 YIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLLQSNGIRCN 306
           +  FG P QWY +   + +   +++K+  P+ S+ C+ F  HK +   P  L+   I   
Sbjct: 206 FNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFGPDFLERANIPYK 265

Query: 307 HIVHRQQEFIVTYPFGYHAGFNYGYNLA 334
            +V    +  ++ P      F+YGY++ 
Sbjct: 266 TMVQESGKLFISKPGTCFFVFHYGYSIV 293

>Scas_709.32
          Length = 822

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           D +K + C+ C + F    HL RH +SVHS E+P +CP C KKF R D++ QH+
Sbjct: 760 DENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHI 813

>Scas_649.28
          Length = 730

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           LDD +K + C EC + F    HL RH +SVHS E+P +C  C KKF R D++ QHL
Sbjct: 666 LDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHL 721

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (66%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           D SK + C+ C R+F    HL RH +S+H GEKP+ C  CGKKF R D++ QH+
Sbjct: 349 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHI 402

>Scas_602.9
          Length = 547

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 747 FLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
            L D +K + C  C R+F    HL RH +S+H GEKP++C  C K F R D++ QH+
Sbjct: 487 LLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHI 543

>Kwal_47.17241
          Length = 403

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (62%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           D SK + C  C R+F    HL RH +S+H GEKP  C  CGKKF R D++ QH+
Sbjct: 341 DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHI 394

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (66%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           D +K + C+ C R+F    HL RH +S+H GEKP+ C  CGKKF R D++ QH+
Sbjct: 455 DATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHI 508

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (64%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           D SK + C+ C R+F    HL RH +S+H  EKP+ C  CGKKF R D++ QHL
Sbjct: 413 DASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHL 466

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 771 TRHKKS--VHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 809
           TR +K   +    KP  C  C ++FKR++H+ +H+     C
Sbjct: 403 TRGRKPSPILDASKPFGCEYCDRRFKRQEHLKRHIRSLHIC 443

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (71%), Gaps = 1/53 (1%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           +++VCQ C R F+   HLTRH++S H+ EKP+ C  C ++F RRD +L+H +K
Sbjct: 28  RLFVCQTCTRAFARQEHLTRHERS-HTKEKPYCCGICDRRFTRRDLLLRHAHK 79

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           L DG+K + C +C + F    HL RH +SVHS E+P  C  C KKF R D++ QHL
Sbjct: 477 LPDGAKPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHL 532

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%)

Query: 739 KINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDH 798
           KI   +   L D +K++ C  C R+F    HL RH  S+H GE+P+SC  C K F R D+
Sbjct: 202 KIRGRKPSLLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDN 261

Query: 799 VLQH 802
           + QH
Sbjct: 262 LNQH 265

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (64%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           D SK + C+ C R+F    HL RH +S+H GEKP+ C  C KKF R D++ QH+
Sbjct: 259 DLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHI 312

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           ++CQ C + F++  HL RH + +H+GEK H+C  P CG++F R D+ LQH
Sbjct: 80  HLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128

>Kwal_56.24206
          Length = 1502

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 102/239 (42%), Gaps = 54/239 (22%)

Query: 200 WNISSLP----SILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQ 255
           WN++++     S+L YLD       ++ L  G+  +   W +ED  L SI+Y H G+ K 
Sbjct: 509 WNLNNVATSENSMLRYLDADFGNHLDTKLDIGMLFSVKGWSIEDNFLASIHYHHVGSSKL 568

Query: 256 WYSIPQEDSEKFYNFMK--EQFPEESKNC------------SEFLR-------------- 287
           WY IP +D EKF   ++  E  P++ ++             SEF +              
Sbjct: 569 WYVIPPQDMEKFERLIEFYESQPQDVESSYPNGVETKQFEKSEFYQSFLDTTPSRPTSMR 628

Query: 288 ---------HKMFLVS-----------PKLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGF 327
                    +K F  S           P+ L+ +GI    +V   + FI  +P  Y +  
Sbjct: 629 PHRVNTHTLNKNFQSSNSTLANDWNFHPETLKDHGITVYKVVQDPRSFIFRFPKSYSSNI 688

Query: 328 NYGYNLAESVNFALPSWLDIGAKAKKCLCIDDAV-GINVQKLRSNYMH-SPNGGAQKET 384
           + G++++E   FA  SWL I  + +K L  +  + GI++  L  N +  +P  G   E 
Sbjct: 689 SSGFSVSEFALFAPTSWLGIAIEGEKWLSKNGLLPGISIFPLLLNIVQRAPQKGLAVEA 747

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           L++  K + CQEC + F    HL RH +SVHS ++P  C  C KKF R D++ QHL
Sbjct: 497 LEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHL 552

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 6/35 (17%)

Query: 781 EKPHSCPKCGKKFKRRDHVLQHL------NKKIPC 809
           EKP  C +C K F+R +H+ +H+      ++  PC
Sbjct: 501 EKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPC 535

>Kwal_26.8351
          Length = 698

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           +++  K + CQEC + F    HL RH +SVHS E+P  C  C KKF R D++ QHL
Sbjct: 634 VEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHL 689

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           D +K + C++C + F    HL RH +SVHS E+P +C  C KKF R D++ QHL
Sbjct: 568 DKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 621

>Scas_721.92
          Length = 1152

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           +++VC  C+R F+   HL RH +S H+ EKP+ C  C KKF RRD +L+H  K
Sbjct: 76  RLFVCDVCSRAFARQEHLDRHARS-HTNEKPYQCGICTKKFTRRDLLLRHAQK 127

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           +++VC  C R F+   HL RHK+S H+ EKP+ C  C ++F RRD +L+H +K
Sbjct: 47  RLFVCHTCTRAFARQEHLIRHKRS-HTNEKPYICGICDRRFSRRDLLLRHAHK 98

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 737 QSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFK 794
           ++ ++DEE +   +  + Y+C+ CAR F++  HL RH + +H+GEK H CP   C ++F 
Sbjct: 159 RNTLSDEEDL---EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQRFS 214

Query: 795 RRDHVLQH 802
           R D+ LQH
Sbjct: 215 RHDNCLQH 222

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           +D+  K + C +C + F    HL RH +SVHS E+P  C  C KKF R D++ QHL
Sbjct: 614 MDEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHL 669

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 802
           YVC+ C+R F++  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 100 YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH]
           (193474..198039) [4566 bp, 1521 aa]
          Length = 1521

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 78/200 (39%), Gaps = 54/200 (27%)

Query: 200 WNISSLP----SILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQ 255
           WNI+++P    S+L YLD     +    ++ G+  ++  W L DQ L +I Y H G    
Sbjct: 544 WNINNVPLAANSLLSYLDIDYGCLTRPKMHVGMTFSTRGWSLGDQYLPTIEYNHLGCSLL 603

Query: 256 WYSIPQEDSEKF------YNFMKEQFPEESKNC------SEF------------------ 285
           WY I  E  E F       N  K   P +  +       SEF                  
Sbjct: 604 WYFIAPESQEAFEKLVEEINLGKRDHPTDELDVDPEFKKSEFYNSYLETNMRNRLNDTHK 663

Query: 286 LRHK----MF----------------LVSPKLLQSNGIRCNHIVHRQQEFIVTYPFGYHA 325
           LR K    MF                 + P+ LQ  GI+  + +   + FI+ YP  Y+ 
Sbjct: 664 LRSKNGSHMFGQAARGPKSYLLPNDIQIHPEELQKRGIKFYNAIQEAKTFIIKYPRAYNT 723

Query: 326 GFNYGYNLAESVNFALPSWL 345
               G++++ES   A  SWL
Sbjct: 724 SIAAGFHVSESCYLAPESWL 743

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           +++VC+ C R F+   HLTRH++S H+ EKP+ C  C ++F RRD +++H  K
Sbjct: 123 RLFVCKVCTRAFARQEHLTRHERS-HTKEKPYVCGICERRFTRRDLLIRHCQK 174

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 7/54 (12%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806
           K YVC  C R+F+    L RH + +H G        CG   +R    ++  +KK
Sbjct: 151 KPYVCGICERRFTRRDLLIRHCQKLHGG-------NCGDYIRRTSRKVRRDSKK 197

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           D SK + C+ C R+F    HL RH +S+H  EKP +C  C K F R D++ QH+
Sbjct: 384 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHV 437

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           D  + YVC  C+R F    H TRH ++ H+GEKPH+C  P CGK+F R D + +H
Sbjct: 29  DSPRPYVCPICSRAFHRLEHQTRHIRT-HTGEKPHACEFPGCGKRFSRSDELTRH 82

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 749 DDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           +D  K + C  C++ F    HL RH +SVHS ++P SC  C KKF R D++ QH+
Sbjct: 529 NDIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHI 583

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           K + C  C + F    HL RH +SVHS E+P +C  C KKF R D++ QH+
Sbjct: 645 KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHI 695

>Kwal_27.10925
          Length = 264

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 802
           YVC+ C + F++  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 201 YVCKICVKGFTTSGHLARHNR-IHTGEKNHVCPHEGCGQRFSRHDNCVQH 249

>Scas_707.31
          Length = 289

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%)

Query: 737 QSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRR 796
           Q K+   +   L D SK Y C  C ++F    HL RH +++H   +P  C  C K+F R 
Sbjct: 205 QPKVRGRKPSILPDDSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRN 264

Query: 797 DHVLQHL 803
           D++ QH+
Sbjct: 265 DNLNQHV 271

>Scas_718.44
          Length = 266

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 746 MFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 802
           M      + +VC+ C+  F++  HL+RH + +H+GEK HSCP   C +KF R D+ LQH
Sbjct: 201 MKRQQNRRKHVCKICSTGFTTSGHLSRHNR-IHTGEKNHSCPFEGCNQKFSRHDNCLQH 258

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 729 ESPTSALAQSKINDEEIMFLDDGS--KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC 786
           +S  S L Q K +   +   DD    + Y+C+ C + F++  HL RH + +H+GEK H C
Sbjct: 374 QSRKSKLQQKKHSISSLCNSDDIELRRKYLCKVCGKGFTTSGHLARHNR-IHTGEKRHVC 432

Query: 787 P--KCGKKFKRRDHVLQH 802
           P   CG++F R D+ LQH
Sbjct: 433 PYEGCGQRFNRHDNCLQH 450

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 749 DDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           DD  + +VC  C R F    H TRH ++ H+GEKPH+C  P C K+F R D + +H
Sbjct: 37  DDAPRPHVCPICGRAFHRLEHQTRHMRT-HTGEKPHACDFPGCVKRFSRSDELTRH 91

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 782 KPHSCPKCGKKFKRRDHVLQHL 803
           +PH CP CG+ F R +H  +H+
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHM 62

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 732 TSALAQSKINDEEIMFLD-DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PK 788
           T A+ + K + + I   D DG + YVC  C R F    H TRH ++ H+GE+PH+C  P 
Sbjct: 2   TEAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRT-HTGERPHACDFPG 60

Query: 789 CGKKFKRRDHVLQH 802
           C K+F R D + +H
Sbjct: 61  CSKRFSRSDELTRH 74

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 773 HKKSVHS----GEKPHSCPKCGKKFKRRDHVLQHL 803
           HKKS++     G +P+ CP C + F R +H  +H+
Sbjct: 11  HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHI 45

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G K +VC  C ++F+ G +L  H++ +H+GEKP+SC  C KKF R+ ++  HL
Sbjct: 617 GYKPFVCDYCGKRFTQGGNLRTHER-LHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           K + C  C R FS   HL  H +S H G KP  C  CGK+F +  ++  H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRS-HIGYKPFVCDYCGKRFTQGGNLRTH 639

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 3/60 (5%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 805
           L  G K Y C  C ++FS   +L  H    H   KP  C    C K F +  ++  H N+
Sbjct: 642 LHTGEKPYSCDICDKKFSRKGNLAAH-LVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNR 700

>Scas_703.23
          Length = 1341

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           D  + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 67  DKPRPFLCPTCTRGFVRQEHLKRHQRS-HTNEKPFLCVFCGRCFARRDLVLRHQHK 121

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           D  + YVC  CAR F    H TRH ++ H+GEKPH+C    CGK+F R+D + +H
Sbjct: 17  DAPRPYVCPICARAFHRLEHQTRHIRT-HTGEKPHACDFAGCGKRFSRQDELTRH 70

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 3/52 (5%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           + Y+C+ C+R F++  HL RH + +H+GEK H C  P C ++F R D+ +QH
Sbjct: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332

>Scas_712.42*
          Length = 290

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 749 DDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 803
           D+  + + C+ CAR F    H  RH ++ H+GEKPH C  P CGK F R D + +HL
Sbjct: 12  DNDERPFRCETCARGFHRLEHKKRHMRT-HTGEKPHHCAFPGCGKGFSRSDELKRHL 67

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           D  + ++C  C+R F    HL RH+ S H+ EKP  C  CGK F R+D VL+HL K
Sbjct: 22  DKPRPFLCPICSRGFVRQEHLKRHQNS-HTHEKPFLCLICGKCFARKDLVLRHLQK 76

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           D  + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 75  DKPRPFLCPVCTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 129

>Kwal_47.16621
          Length = 1178

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           D  + ++C  C R F+   HL RH+++ H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 73  DRPRPFLCSICTRGFARQEHLKRHQRA-HTNEKPFLCAFCGRCFARRDLVLRHQQK 127

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           D  + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 56  DKPRPFLCHICTRGFVRQEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRHQHK 110

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           D  + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 78  DRPRPFLCPICTRGFARQEHLRRHERS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 132

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           + +VC+ C R F+   HL RH +S H+ EKP+ C  C + F RRD +++H  K
Sbjct: 102 RSFVCEVCTRAFARQEHLKRHYRS-HTNEKPYPCGLCNRCFTRRDLLIRHAQK 153

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 804
           +G+++Y C +C  +FS    L RH+K VHS   PH C  CGK F R+D + +H N
Sbjct: 90  EGAQLYSCAKCQLKFSRSSDLRRHEK-VHSLVLPHICSNCGKGFARKDALKRHSN 143

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           D  + ++C  C R F    HL RH+ S H+ EKP+ C  CG+ F RRD VL+H  K
Sbjct: 146 DKPRPFLCPTCTRGFVRQEHLKRHQHS-HTREKPYLCIFCGRCFARRDLVLRHQQK 200

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           D  + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 43  DKPRPFLCPICTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 97

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 9/70 (12%)

Query: 741 NDEEIMFLDDGS------KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKK 792
           N   ++ L D +      + ++CQ C   F++  HL+RH K +H+GEK H CP   C + 
Sbjct: 232 NRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQS 290

Query: 793 FKRRDHVLQH 802
           F R D+ LQH
Sbjct: 291 FSRHDNCLQH 300

>Scas_569.2
          Length = 293

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           + Y+C+ C++ F++  HL RH + +H+GEK H C  P C  KF R D+ +QH
Sbjct: 226 RKYICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 749 DDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           D+  + + C+ C+R F    H  RH ++ H+GEKPH C  P CGK F R D + +H
Sbjct: 11  DNKERPFKCEHCSRGFHRLEHKKRHMRT-HTGEKPHGCSFPGCGKSFSRSDELKRH 65

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           Y+C  CA+ FS   H TRH++S H+G KP SC  C   F RRD + +H+
Sbjct: 8   YICSFCAQAFSRSEHKTRHERS-HTGVKPFSCKVCNHSFVRRDLLQRHI 55

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G K + C+ C ++F+ G +L  H + +H+GE+P+ C KCGK+F R+ ++  H+
Sbjct: 511 GYKPFQCEYCGKRFTQGGNLRTHVR-LHTGERPYECDKCGKRFSRKGNLAAHM 562

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 806
           G K + C  C + F+   HL  H +S H G KP  C  CGK+F +    R HV  H  ++
Sbjct: 483 GVKQHKCPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGER 541

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 805
           L  G + Y C +C ++FS   +L  H  + H   KP  C    C K F +  ++  H N+
Sbjct: 536 LHTGERPYECDKCGKRFSRKGNLAAHMLT-HENYKPFQCKLDDCNKSFTQLGNMKAHQNR 594

>Scas_697.35
          Length = 839

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G K Y C  C ++F+ G +L  H++ +H+GEKP+ C  C KKF R+ ++  HL
Sbjct: 539 GYKPYQCGYCGKRFTQGGNLRTHQR-LHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           L +GSK + C  C R F+   HL  H +S H G KP+ C  CGK+F +  ++  H
Sbjct: 508 LHEGSKQHKCPYCHRLFAQSTHLEVHIRS-HLGYKPYQCGYCGKRFTQGGNLRTH 561

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 775 KSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           K++H G K H CP C + F +  H+  H+
Sbjct: 506 KTLHEGSKQHKCPYCHRLFAQSTHLEVHI 534

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 805
           L  G K Y C+ C ++FS   +L  H  + H   KP  C    C + F +  ++  H N+
Sbjct: 564 LHTGEKPYECELCDKKFSRKGNLAAHLLT-HQKVKPFICKLDNCNRSFTQLGNMKAHQNR 622

>Scas_575.3
          Length = 455

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           D  + +VC  C R F    H TRH ++ H+GEKPH C  P C KKF R D + +H
Sbjct: 63  DAPRPHVCPICQRAFHRLEHQTRHMRT-HTGEKPHECDFPGCVKKFSRSDELTRH 116

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           G K + C+ C ++F+ G +L  H + +H+GEKP+ C +CG+KF R+ ++  H
Sbjct: 547 GYKPFSCEFCGKRFTQGGNLRTHIR-LHTGEKPYECERCGRKFSRKGNLAAH 597

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 806
           G K + C  C + F+   HL  H +S H G KP SC  CGK+F +    R H+  H  +K
Sbjct: 519 GVKQFQCPYCHKYFTQSTHLEVHVRS-HIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEK 577

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 805
           L  G K Y C+ C R+FS   +L  HK + H   KP  C    C K F +  ++  H N+
Sbjct: 572 LHTGEKPYECERCGRKFSRKGNLAAHKLT-HDNLKPFECKLDDCNKNFTQLGNMKAHQNR 630

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           Y+C  CA+ FS   H  RH++S H+G KP SC  C   F RRD + +H+
Sbjct: 8   YICSFCAKPFSRSEHKARHERS-HTGSKPFSCSICSHSFVRRDLLQRHI 55

>Kwal_47.17888
          Length = 786

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           G K + C+ C ++F+ G +L  H + +H+GEKP+ C KCG++F R+ ++  H
Sbjct: 527 GYKPFQCEYCGKRFTQGGNLRTHVR-LHTGEKPYECEKCGRRFSRKGNLAAH 577

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 806
           G+K + C  C + F+   HL  H +S H G KP  C  CGK+F +    R HV  H  +K
Sbjct: 499 GAKQHECPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEK 557

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 805
           L  G K Y C++C R+FS   +L  H+ + H   KP  C    C K F +  ++  H N+
Sbjct: 552 LHTGEKPYECEKCGRRFSRKGNLAAHRLT-HENLKPFHCKLDGCNKSFTQLGNMKAHQNR 610

>Scas_717.17
          Length = 525

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806
            D  + VY+C  C++ F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 381 FDSENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           D  + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H
Sbjct: 28  DKPRPHLCPICTRGFVRLEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRH 79

>Scas_378.1
          Length = 208

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806
           D   VY C  C + F     L RH  + HS ++ +SCPKC  K KR+D++LQHL  K
Sbjct: 79  DTPSVYQCHMCVKSFRRHSWLKRHLLA-HSSQRHYSCPKCVSKHKRKDNLLQHLKLK 134

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G K Y+C  C + FS   H  RH++S H+G KP  C  C   F RRD + +H+
Sbjct: 4   GQKKYICSFCLKPFSRSEHKIRHERS-HAGVKPFQCQVCKHSFVRRDLLQRHI 55

>Kwal_14.2278
          Length = 463

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           + Y+C  C+R F    H TRH ++ H+GEKPH+C    C K+F R D + +H
Sbjct: 21  RPYICPICSRAFHRLEHQTRHIRT-HTGEKPHACDFAGCTKRFSRSDELTRH 71

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 803
           +D+ ++ + C  C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H+
Sbjct: 10  VDNENRPFRCDTCHRGFHRLEHKKRHLRT-HTGEKPHHCAFPGCGKSFSRSDELKRHM 66

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 733 SALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCG 790
           S L +SK +  ++    +  + + C  C R F    H TRH + +H+GEKPH+C  P C 
Sbjct: 17  SLLKESK-SKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMR-IHTGEKPHACDFPGCV 74

Query: 791 KKFKRRDHVLQH 802
           K+F R D + +H
Sbjct: 75  KRFSRSDELTRH 86

>Scas_683.25
          Length = 879

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           K ++C  CA+ FS   H  RH++S H+G KP+ C  C   F R D  L+H+
Sbjct: 13  KRFICSFCAKGFSRAEHKIRHERS-HTGLKPYKCKVCTHCFVRSDLALRHI 62

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 802
           YVC EC + F+    L  H+ ++H+G++P +CP   CGK F  R ++L+H
Sbjct: 183 YVCTECGKGFARASSLRTHR-NIHTGDRPFTCPFKNCGKSFNARSNMLRH 231

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 802
           + C+ C+  F++  HL+RH + +H+GEK H CP   CG++F R D+  QH
Sbjct: 153 HFCKICSTGFTTSGHLSRHNR-IHTGEKNHICPHEGCGQRFSRHDNCNQH 201

>Scas_720.39
          Length = 1455

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 70/199 (35%), Gaps = 53/199 (26%)

Query: 200 WNISSLP----SILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQ 255
           W + ++P    S+L YLD  +     +    G++ +   W + D  L SI+Y H G+ K 
Sbjct: 499 WRLENIPLSEDSLLRYLDLDLGCNTRTKFDIGMFLSVAGWSVTDNFLPSIDYHHMGSSKL 558

Query: 256 WYSIPQEDSEKFYNFMKEQFPEESKNCSE----------------FLRHKMF-------- 291
           WY +  +D EK    MK    E  K  ++                F+ + M         
Sbjct: 559 WYVVSPKDLEKLEALMKNVDTEIEKTQTQMLASISLNDNFKESEFFIAYDMTKQTNFSIQ 618

Query: 292 -------------------------LVSPKLLQSNGIRCNHIVHRQQEFIVTYPFGYHAG 326
                                    L +   L+ NGI    +      +I TYP  Y + 
Sbjct: 619 TSADFRKDLSLTKENNFEQPSKPASLFTTAFLKKNGIEVRTVSQDSGSYIFTYPKTYTSY 678

Query: 327 FNYGYNLAESVNFALPSWL 345
              G  L++   FA  SWL
Sbjct: 679 IGAGVYLSQHATFAPKSWL 697

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 804
           G K + C +C+ +FS    L RH+K+ H    P+ CP+CGK F R+D + +H +
Sbjct: 94  GEKRFKCAKCSLEFSRSSDLRRHEKT-HFAILPNICPQCGKGFARKDALKRHYD 146

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           G K + C+ C ++F+   +L  H++ +H+GE+P  C KC K F RR ++  H
Sbjct: 504 GYKPFECEFCGKRFTQAGNLRTHRR-LHTGERPFKCDKCDKTFARRGNLTAH 554

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           Y C  C++ FS   HL  H K+ H G KP  C  CGK+F +  ++  H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKA-HMGYKPFECEFCGKRFTQAGNLRTH 526

>Kwal_47.19045
          Length = 266

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 749 DDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNKK 806
           + G + + C  C + F    H  RH ++ H+GEKPHSC  P C K+F R D + +H+   
Sbjct: 8   EGGHRPFKCDMCGKGFHRLEHKRRHIRT-HTGEKPHSCNFPGCVKRFSRSDELKRHVRTH 66

Query: 807 I 807
           +
Sbjct: 67  M 67

>Scas_693.31
          Length = 635

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 5/55 (9%)

Query: 755 YVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 807
           Y C    C + F   H L RHKK VHS EK ++CP CGKKF R D ++ H ++ I
Sbjct: 519 YACDFPNCDKAFVRNHDLVRHKK-VHS-EKSYACP-CGKKFNREDALIVHRSRMI 570

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 752 SKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           +K + C  C + FS   H TRH++S H+G KP  C  C   F RRD + +H+
Sbjct: 9   TKRHFCSFCNKAFSRSEHKTRHERS-HAGVKPFECQVCSHSFVRRDLLQRHI 59

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 803
           Y+C+ C  +F    H TRH ++ H+GEKP +C  P C K+F R D + +H+
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRT-HTGEKPFACTVPGCPKRFSRNDELKRHI 61

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 752 SKVYVC--QECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           SKVY C  Q C + F+    LT H+ +VH G KP  C  CGK+F ++ H+ +H+
Sbjct: 103 SKVYFCDYQGCNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHM 156

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 743 EEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           E  + +  G K + C  C ++F+   HL RH  S H+ +KP +C  CGK    R  + +H
Sbjct: 125 EHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHMFS-HTDDKPFTCSICGKGVTTRQQLKRH 183

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 739 KINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRR 796
           KI +++    D+  + + C+ C+R F    H  RH ++ H+GEKPH C  P C K F R 
Sbjct: 4   KIKNQDSYPPDNFKRPFRCEICSRGFHRLEHKKRHFRT-HTGEKPHKCKFPSCPKSFSRA 62

Query: 797 DHVLQH 802
           D + +H
Sbjct: 63  DELKRH 68

>KLLA0C16203g complement(1414169..1418533) weakly similar to
           sp|Q03214 Saccharomyces cerevisiae YMR176w ECM5 involved
           in cell wall biogenesis and architecture singleton,
           start by similarity
          Length = 1454

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/257 (19%), Positives = 100/257 (38%), Gaps = 55/257 (21%)

Query: 140 FTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLNFTEPMYGADSLGSLFEDSVKE 199
            +L DFE+       +    FD +  ++     +  T + T  M  +D    L    +  
Sbjct: 483 ISLLDFERLYYTILKEESLSFDVDTGIDLPTIVHGSTFS-TSKMASSDETKRL----IDA 537

Query: 200 WNISSL----PSILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQ 255
           WN++++     S+L+Y D     +    +  G+  ++  W LED+ L  +++ + G+ K 
Sbjct: 538 WNLNTINLSEKSLLQYQDLDFGNLAGGKIDVGMMLSTSGWALEDEFLPLLDFSYLGSSKV 597

Query: 256 WYSIPQE-----------------------------DSEKFYNFMKEQFPEESKNCSEFL 286
           WY +P +                             +S+ F +F +  F ++ K   +  
Sbjct: 598 WYFVPPQYRNSLEALFDDIRNKKEVKSSDQFEADFTESDFFQSFQETNFLDQHKTSRKRS 657

Query: 287 RHKMFL-----------------VSPKLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNY 329
            + MFL                 +S   L ++ IR   ++   + FI+ YP  Y    + 
Sbjct: 658 INHMFLKNLVQDKHNSYTPNDFQISTSELSASHIRYFKVIQDPKTFIMKYPQVYSTSISS 717

Query: 330 GYNLAESVNFALPSWLD 346
           G+ ++E   FA   W++
Sbjct: 718 GFQISEKSLFAPEEWVN 734

>Scas_687.33
          Length = 288

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 749 DDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 803
           D+  + + C  C+R F    H  RH ++ H+GEKPH C    CGK F R D + +H+
Sbjct: 11  DNFQRPFRCPICSRGFHRLEHKKRHVRT-HTGEKPHPCTFAHCGKSFSRGDELKRHI 66

>Scas_719.68
          Length = 1350

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           D  + ++C  C R      HL RH++S H+ EKP  C  CG+ F RRD VL++  K
Sbjct: 36  DKPRPFLCPICTRT----EHLKRHQRS-HTREKPFVCVFCGRCFARRDLVLRYQTK 86

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 753 KVYVC---QECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           K + C     C   F+   HL RH +  H+GEKP  CP C K F R D++ QH
Sbjct: 39  KTFKCTGYDGCTMSFTRAEHLARHIRK-HTGEKPFQCPACLKFFSRVDNLKQH 90

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 744 EIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           ++M L+    ++ C  C + F     L RH  S HS  KP+SCP C  + KR+D++ QHL
Sbjct: 174 QLMDLNSFENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHL 232

Query: 804 NKK 806
             K
Sbjct: 233 KLK 235

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 9/71 (12%)

Query: 744 EIMFLDDGSKVYV--------CQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR 795
           E+MF + G K+ V        C  C + F     L RH  S HS ++   CP C  + KR
Sbjct: 515 EMMFGNQGEKIEVSSLAFPHRCHLCPKLFKRKSWLKRHLLS-HSQQRHFLCPWCNSRHKR 573

Query: 796 RDHVLQHLNKK 806
           RD++LQH+  K
Sbjct: 574 RDNLLQHMKLK 584

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 749 DDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHL 803
           D+  + + C+ C+R F    H  RH ++ H+GEKPH C    C K F R D + +HL
Sbjct: 11  DNDQRPFRCEICSRGFHRLEHKKRHGRT-HTGEKPHKCTVQGCPKSFSRSDELKRHL 66

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 755 YVCQE--CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 807
           Y C    C + F   H L RHKKS    EK ++CP CGKKF R D ++ H ++ I
Sbjct: 580 YSCDHPGCDKAFVRNHDLIRHKKSHQ--EKAYACP-CGKKFNREDALVVHRSRMI 631

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           YVC+ C + FS  ++L  H ++ H+ EKP+ C  CGK F R+    +H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRT-HTDEKPYQCSICGKAFARQHDKKRH 567

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHL 803
           K Y C  C + F+  H   RH + +H+G+K + C           CGKKF R D + +H 
Sbjct: 547 KPYQCSICGKAFARQHDKKRH-EDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHF 605

>Scas_568.5
          Length = 199

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 752 SKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806
           +K Y C +C   F     L RH+K+ H    PH C +CGK F R+D + +H N +
Sbjct: 115 NKRYPCSKCELIFLRSSDLRRHEKA-HLLVLPHICSQCGKGFARKDALKRHFNTQ 168

>Kwal_26.8021
          Length = 507

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 754 VYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806
            Y C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 807
           C + F   H L RHKK+    EK  +CP CGKKF R D +L H  + I
Sbjct: 711 CTKAFVRNHDLIRHKKT--HAEKTFTCP-CGKKFSREDALLTHRTRMI 755

>Kwal_27.11460
          Length = 531

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           L   + VY C+ C ++F+  ++L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 406 LQKNASVYACELCDKKFTRPYNLKSHLRT-HTDERPFSCAICGKAFARQHDRKRH 459

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 803
           + C  C + F+  H   RH+  +H+G+K ++C           CGKKF R D + +H 
Sbjct: 441 FSCAICGKAFARQHDRKRHE-DLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHF 497

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in
           cell wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/269 (20%), Positives = 105/269 (39%), Gaps = 61/269 (22%)

Query: 197 VKEWNISSLP----SILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGA 252
           + +WN+ ++P    S+L++LD  +     +    G+  +   W + D  L SI++ H G+
Sbjct: 479 LDQWNLDNIPLNELSLLQHLDLDMANFTRTTYDIGMLFSCQGWSVSDHFLPSIDFNHLGS 538

Query: 253 PKQWYSIPQEDSEKFYNFMKEQFPE---------------ESKNCSEFLRHKMFLVSPK- 296
            K  YSI  +D EKF   +     E               E K+  E   +K FL + + 
Sbjct: 539 TKLVYSIAPKDMEKFEALIARGKSEWDTIQSRPRYSTSDDELKSFIETDFYKSFLDAEQS 598

Query: 297 --------------------------------LLQSNGIRCNHI-----VHRQQEFIVTY 319
                                           + + N I  N I        Q  +I  +
Sbjct: 599 ADYSNTGDNSKNSFPEDKIAGNTLHDGSQSDFIFEPNFILANGIKLYKTTQEQGSYIFKF 658

Query: 320 PFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCIDDAV-GINVQKLRSNYMHSPNG 378
           P  +      G+ L+++  FA  SWL   ++A K       + G++V +L  N + + N 
Sbjct: 659 PKAFTCSIGSGFYLSQNAKFAPSSWLRFSSEAAKWTSKMGFLPGLDVNQLLINALLNSNN 718

Query: 379 GAQKETGKEVQNDKSI---SSSKTLEEVL 404
              ++  +++ ++  +    +SK L E++
Sbjct: 719 PVLRKKCRDLISNYVVEEAENSKKLGELI 747

>Scas_720.33
          Length = 316

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 753 KVYVCQ---ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           K + CQ   +C   F+   HL RH +  H+GEKP  C  C + F R D++ QH
Sbjct: 13  KTFACQGYKDCHMTFTREEHLARHIRK-HTGEKPFQCYICFRFFSRMDNLKQH 64

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 5/58 (8%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH--LNKKIP 808
           Y C EC + F+    L+ H  ++H+G+KP+ C  P C K+F  + ++L+H  L+ K P
Sbjct: 304 YRCAECGKAFARPSSLSTHM-NIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKTP 360

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 726 IDPESPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHS 785
            D E    A  +  +  E       G + Y C++C R F+   HL RH  S HS  KP S
Sbjct: 121 CDYEGCYKAFTRPSLLTEHQQTAHQGIRAYQCEQCGRGFTKKSHLERHLFS-HSETKPFS 179

Query: 786 CPKCGKKFKRRDHVLQH 802
           C  CGK    R  + +H
Sbjct: 180 CTVCGKGVTTRQQLRRH 196

 Score = 37.0 bits (84), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 753 KVYVC--QECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           K + C  + C + F+    LT H+++ H G + + C +CG+ F ++ H+ +HL
Sbjct: 117 KTHYCDYEGCYKAFTRPSLLTEHQQTAHQGIRAYQCEQCGRGFTKKSHLERHL 169

>Scas_631.7
          Length = 433

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 726 IDPESPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHS 785
            D    T A  +  +  E  +    G K + C++C +QFS   HL RH  S HS  KP  
Sbjct: 59  CDYSGCTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHLIS-HSDSKPFC 117

Query: 786 CPKCGKKFKRRDHVLQH 802
           C  CGK    R  + +H
Sbjct: 118 CLHCGKGVTTRQQLKRH 134

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 753 KVYVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           K Y C    C + F+    L+ H+ + H G KP  C +C K+F R+ H+ +HL
Sbjct: 55  KNYFCDYSGCTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHL 107

>Scas_636.14d
          Length = 275

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 809
           + C  C + + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 215 FPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268

>Kwal_56.23925
          Length = 745

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 755 YVC--QECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 807
           Y C  + C + F   H L RHKK+    EK + CP CGKKF R D +L H ++ I
Sbjct: 615 YFCDFEGCHKAFVRNHDLIRHKKT--HAEKCYVCP-CGKKFVREDALLVHRSRMI 666

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 740 INDE-EIMFLDDGSKVYVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRR 796
           +ND  E M L  G   Y C+   C + FS    L RH K VHS  KP+ CP+C K F   
Sbjct: 551 LNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLK-VHSKYKPYQCPQCQKCFSTE 609

Query: 797 DHVLQH 802
           D + QH
Sbjct: 610 DTLNQH 615

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 793
           K Y C +C + FS+   L +HK+ VHSGEKP+ C  C K+F
Sbjct: 595 KPYQCPQCQKCFSTEDTLNQHKR-VHSGEKPYECHICHKRF 634

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G K Y C  C ++F+  + L  H ++ H+GEKP  C  CG+ F    ++ +H+
Sbjct: 621 GEKPYECHICHKRFAISNSLKIHIRT-HTGEKPLKCKVCGRCFNESSNLSKHM 672

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 751 GSKVYVC--QECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G   Y C    C++ F+    L RH K VHSG KP  CP C KKF   D + QH+
Sbjct: 624 GQSSYQCSWDTCSKSFTQRQKLLRHLK-VHSGYKPFKCPHCTKKFSTEDILQQHI 677

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G + + C  C +QF++   L  H ++ H+GEKP  C  CGK+F    ++ +H+
Sbjct: 682 GERPFKCTYCTKQFATSSSLRIHIRT-HTGEKPLKCKICGKRFNESSNLSKHM 733

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 806
           G K + C  C ++FS+   L +H ++ HSGE+P  C  C K+F      R H+  H  +K
Sbjct: 654 GYKPFKCPHCTKKFSTEDILQQHIRT-HSGERPFKCTYCTKQFATSSSLRIHIRTHTGEK 712

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 809
           G K   C+ C ++F+   +L++H K   + E+ + C KC + F + + +  H N+   C
Sbjct: 710 GEKPLKCKICGKRFNESSNLSKHMK---THERKYKCEKCKRSFNQLEQLRLHQNRCSHC 765

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 802
           ++C+ C ++F     L+ H  ++H+GEKP+ CP   C K F  + ++L+H
Sbjct: 173 FICKVCLKKFKRPSSLSTHM-NIHTGEKPYPCPFDNCTKSFNAKSNMLRH 221

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806
           C + F   H L RHKKS    EK +SC  CGKKF   D +++H  +K
Sbjct: 730 CQKAFVRNHDLLRHKKS--HLEKGYSCAGCGKKFHSEDSLVKHQERK 774

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 754 VYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR 795
           VY C  C ++F+  ++L  H +S H+ E+P+ C  CGK F R
Sbjct: 468 VYACDICDKKFTRPYNLKSHLRS-HTDERPYVCSVCGKAFAR 508

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 10/62 (16%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHLNK 805
           YVC  C + F+  H   RH+  +H+G++ + C           CGKKF R D + +H   
Sbjct: 497 YVCSVCGKAFARMHDKNRHED-LHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKT 555

Query: 806 KI 807
           ++
Sbjct: 556 EL 557

>Scas_695.2
          Length = 571

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           GS  Y C+ C + F+  ++L  H ++ H+ E P  C  CGK F R+    +H
Sbjct: 448 GSGAYACELCDKTFTRPYNLKSHLRT-HTNEXPFVCNICGKAFARQHDRKRH 498

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHL 803
           +VC  C + F+  H   RH + +H+G+K + C           C KKF R D + +H 
Sbjct: 480 FVCNICGKAFARQHDRKRH-EDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHF 536

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806
           Y C  C +QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G + + C  C +QFS+   L  H ++ H+GEKP SC  CGK+F    ++ +H+
Sbjct: 568 GERPFHCHYCRKQFSTSSSLRVHIRT-HTGEKPLSCTVCGKRFNESSNLSKHM 619

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 757 CQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 806
           C  C + FS+   L +H ++ HSGE+P  C  C K+F      R H+  H  +K
Sbjct: 546 CPHCPKTFSTDDILAQHIRT-HSGERPFHCHYCRKQFSTSSSLRVHIRTHTGEK 598

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query: 752 SKVYVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
            + YVCQ   C R+FS    L +H+ + H+ E+P+ C  P CGK+F R  H+  H
Sbjct: 54  GRKYVCQIDGCKREFSVPSLLAQHRNA-HTDERPYVCDEPNCGKRFLRPCHLRVH 107

>Scas_711.56
          Length = 832

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 746 MFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 793
           M +  G K + C  C + FS+   L +H+++ HSGEKP  C  CGK+F
Sbjct: 717 MRVHSGYKPFQCSICKKHFSNEETLKQHERT-HSGEKPFKCDICGKRF 763

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G K + C  C ++F+    L  H ++ H+GEKP  C  CGK F    ++ +H+
Sbjct: 750 GEKPFKCDICGKRFAISSSLKIHIRT-HTGEKPLHCKICGKAFNESSNLSKHM 801

>Scas_627.17d
          Length = 275

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 809
           + C  C + + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 215 FPCPHCQKTYLTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 793
           K Y C+ C R FSS   L +H ++ HSGEKP+ C  C KKF
Sbjct: 766 KPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKF 805

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G K Y C  C ++F+    L  H ++ H+GEKP  C  CGK+F    ++ +H+
Sbjct: 792 GEKPYKCHICNKKFAISSSLKIHIRT-HTGEKPLQCKICGKRFNESSNLSKHI 843

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 739 KINDE-EIMFLDDGSKVYVC--QECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR 795
           ++ND  E + L  G   Y C   +C R F     L RH K VHS  KP+ C  C + F  
Sbjct: 721 ELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLK-VHSKYKPYKCKTCKRCFSS 779

Query: 796 RDHVLQH 802
            + ++QH
Sbjct: 780 EETLVQH 786

>Kwal_23.5400
          Length = 429

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           C++ FS    LT H++ VH G KP  C  C ++F R+ H+ +H+
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHM 100

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 747 FLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
            +  G K + C  CARQFS   HL RH  S HS +KP  C  CGK    +  + +H
Sbjct: 73  VVHQGIKPFQCTVCARQFSRKTHLERHMFS-HSEDKPFKCSYCGKGVTTKQQLRRH 127

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 750 DGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806
           D   ++ CQ C + F     L RH  S HS ++   CP C  + KR+D++LQH+  K
Sbjct: 341 DHKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 396

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 40.4 bits (93), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 730 SPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKC 789
           SP +AL  S   +E +   +DG + + C +C   F     L RH+K VH    P+ C  C
Sbjct: 126 SPGAALEVSGGPEETV---NDGKRFH-CTKCELVFRRSGDLRRHEK-VHLPILPNICSLC 180

Query: 790 GKKFKRRDHVLQHL 803
           GK F R+D + +H 
Sbjct: 181 GKGFARKDALKRHF 194

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 804
           K+Y C  C   +     L +H+++ H  ++ + C  CGKKF R+D + +H +
Sbjct: 118 KIYPCNICGISYDKLTDLRKHERASHEPKQENVCMNCGKKFARKDALKRHFD 169

>Scas_721.56
          Length = 199

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 726 IDPESPTSALAQSKINDEEIM----FLDDGSKV-YVCQECARQFSSGHHLTRHKKSVHSG 780
           +D    TS    +  N+ +IM      D+GS+  + C +C   F     L RH+K+ H  
Sbjct: 81  LDKNITTSKFDGTGSNNSKIMKGTPRSDEGSRTGFQCNKCELYFIRSSDLRRHEKT-HLS 139

Query: 781 EKPHSCPKCGKKFKRRDHVLQH 802
             P+ C +CGK F R+D + ++
Sbjct: 140 ILPNICSQCGKGFARKDALKRY 161

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           C   FS   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 33  CEMSFSRAEHLARHIRR-HTGEKPFKCDICLKYFSRIDNLKQH 74

>Kwal_14.2543
          Length = 711

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 743 EEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           ++ M    G K Y C  C + F++   L  H ++ H+GEKP  C  CGK+F    ++ +H
Sbjct: 622 QQHMRTHSGEKPYKCSHCGKGFATSSSLRIHIRT-HTGEKPLECKVCGKRFNESSNLSKH 680

Query: 803 L 803
           +
Sbjct: 681 M 681

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 751 GSKVYVC--QECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G   YVC  + C R  +    L RH + VH+  KP  C  C K F  +D + QH+
Sbjct: 572 GKSSYVCGWENCGRVITQRQKLLRHLR-VHTRYKPCKCVHCLKTFSTQDILQQHM 625

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 754 VYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           +Y C  C ++F+  ++L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 425 IYSCNLCDKKFTRPYNLKSHLRT-HTDERPFSCSVCGKAFARQHDRKRH 472

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 803
           + C  C + F+  H   RH+  +HSG+K + C           CGKKF R D + +H 
Sbjct: 454 FSCSVCGKAFARQHDRKRHED-LHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHF 510

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 759 ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           +C   F+   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 26  DCNMSFNRTEHLARHIRK-HTGEKPFQCNICLKFFSRIDNLRQH 68

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 755 YVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 807
           Y C    C + F   H L RHKK+    EK ++CP CGK F R D +  H ++ I
Sbjct: 586 YRCDYDGCDKAFVRNHDLVRHKKTHQ--EKSYACP-CGKMFNREDALAVHRSRMI 637

>Scas_717.60d
          Length = 167

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 752 SKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           ++++ C+EC++ F +   L +H K  HS         CGK FKR+D    H
Sbjct: 96  NELFNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEYNCGKAFKRKDQRKSH 146

>Kwal_27.11824
          Length = 199

 Score = 38.9 bits (89), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 749 DDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 804
           D G+K + C +C   F     L RH+++ H    P+ C  CGK F R+D + +H +
Sbjct: 113 DAGAKKFPCAKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRHFD 167

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 753 KVYVC--QECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 805
           K Y C  + C + F   H L RHKK   + +K  SCP CGKKF     +++H N+
Sbjct: 551 KPYKCDFEGCTKAFVRNHDLARHKK---THDKHFSCP-CGKKFSSEQSMMKHKNR 601

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 753 KVYVCQ---ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           K + CQ   +C  +F+   HL RH +  H+GE+P  C  C + F R D++ QH+
Sbjct: 18  KSFKCQGFGDCRMEFTRQEHLARHIRK-HTGEQPFQCHLCLRFFSRLDNLKQHV 70

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHL 803
           K  +C +C +QF+    L  H   VHSG+KP  C    C KKF  + ++++HL
Sbjct: 230 KADICAQCGKQFTRPSALRTHML-VHSGDKPFECTWEGCNKKFNVKSNLIRHL 281

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHL 803
           ++C  C + F+  H   RH + +H+G+K + C           CGKKF R D + +H 
Sbjct: 597 FICSICGKAFARQHDRKRH-EDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHF 653

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           + C  C ++F+  ++L  H ++ H+ E+P  C  CGK F R+    +H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRT-HTNERPFICSICGKAFARQHDRKRH 615

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G + + C  C + +S+   L  H ++ H+GEKP SCP C K+F    ++ +H+
Sbjct: 716 GERPFKCHLCPKSYSTSSSLRIHIRT-HTGEKPLSCPICNKRFNESSNLAKHI 767

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 751 GSKVYVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           G   Y C+   C + F     L RH K VHS  KP  C +CGK F  +D + QHL
Sbjct: 658 GLSSYKCEWEGCNKVFVQKQKLIRHLK-VHSKYKPFRCAECGKCFNTQDILTQHL 711

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 806
           K + C EC + F++   LT+H + VHSGE+P  C  C K +      R H+  H  +K
Sbjct: 690 KPFRCAECGKCFNTQDILTQHLR-VHSGERPFKCHLCPKSYSTSSSLRIHIRTHTGEK 746

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 753 KVYVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           K Y+C+   C + F+    LT H+ +VH G KP  C +C   F ++ H+ +HL
Sbjct: 34  KTYLCEYDNCDKAFTRPSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHL 86

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           G K + C +C   F+   HL RH  + H+ E+P  C  CGK    R  + +H
Sbjct: 63  GRKPWKCNQCESSFTKKIHLERHLYT-HTDERPFYCSFCGKGLITRQQLKRH 113

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 726 IDPESPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHS 785
            D +    A  +  I  E  + +  G + + C +CA+ F    HL RH  + HS  KP  
Sbjct: 51  CDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYT-HSDTKPFQ 109

Query: 786 CPKCGKKFKRRDHVLQH 802
           C  CGK    R  + +H
Sbjct: 110 CSYCGKGVTTRQQLKRH 126

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 753 KVYVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           K Y C    C + F+    LT H+ SVH G +   C KC K F ++ H+ +HL
Sbjct: 47  KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHL 99

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 755 YVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 807
           Y C    C + F   H L RHK S H+ +K + CP CGK+F R D ++ H ++ I
Sbjct: 633 YSCDFPGCTKAFVRNHDLIRHKIS-HNAKK-YICP-CGKRFNREDALMVHRSRMI 684

>Kwal_27.10467
          Length = 302

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 802
           Y C +C + F+    L  H  + H+G+KP+ CP   C K+F  R ++ +H
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNT-HTGDKPYCCPFDNCDKQFNARSNMTRH 246

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 38.1 bits (87), Expect = 0.016,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           + C +C+ +F+    L RH+++ H    P+ C +CGK F R+D + +H
Sbjct: 142 HYCSQCSLKFNRSSDLRRHERA-HLLVLPYICTQCGKGFARKDALKRH 188

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 752 SKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGK 791
           SK + CQ C R F+   HL  H +S H G+KP+ C  CGK
Sbjct: 611 SKQFECQYCHRCFAQVTHLDVHIRS-HLGKKPYQCEYCGK 649

>Kwal_14.2206
          Length = 254

 Score = 38.1 bits (87), Expect = 0.020,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 757 CQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           C+ C + FS    L+ H   +H+G +P++C  P CGK+F  + ++++H
Sbjct: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 13/71 (18%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP----------KC--GKKFKR 795
           LDD  K +VC  C  +F    +LTRH K  H+ EK + CP          +C     F R
Sbjct: 191 LDDDEKEFVCHYCDAKFRIRGYLTRHIKK-HAIEKAYHCPFYNGQEVPSKRCHNSGGFSR 249

Query: 796 RDHVLQHLNKK 806
           RD    H+  +
Sbjct: 250 RDTYKTHMKAR 260

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 757 CQECARQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHLNK 805
           C  C R  S    L  H  S+H+G+KP+ CPK  C K+F  + ++L+H  +
Sbjct: 343 CHICGRICSRPSTLQTHL-SIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKR 392

>Kwal_47.16577
          Length = 881

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNKKI 807
           C++ FS   HL RHK + HS EK + C  P CG++F R D   +H  + +
Sbjct: 20  CSKSFSRSDHLGRHKAN-HSSEK-YKCEWPACGREFSRLDVKKKHFGRHL 67

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           C R F+   HL RH +   +GEKP  C  C + F R D++ QH
Sbjct: 28  CDRSFTRAEHLARHIRK-QTGEKPSQCEVCNRFFSRIDNLKQH 69

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 36.2 bits (82), Expect = 0.054,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 743 EEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           E++  L++  K Y C +C   F     L RH+++ H    P+ C  CGK F R+D + +H
Sbjct: 114 EDVQQLNEDKK-YQCDKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRH 171

Query: 803 LN 804
            +
Sbjct: 172 YD 173

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 17/93 (18%)

Query: 727 DPESPTSALAQSKINDEEIMFLDDGSK-VYVCQECARQFSSGHHLTRHKKSVHSGEKPHS 785
           +P SP S+ + +++ DE+    D+ SK  +VC  C  +F    +LTRH K  H+ EK + 
Sbjct: 126 EPLSPRSSSSAAQLKDED---GDELSKERFVCHYCDAEFRIRGYLTRHIKK-HAVEKAYH 181

Query: 786 CP----------KCGKK--FKRRDHVLQHLNKK 806
           CP          +C     F RRD    HL  +
Sbjct: 182 CPFFNSHVPPETRCHTTGGFSRRDTYKTHLRSR 214

>Scas_718.67
          Length = 473

 Score = 37.0 bits (84), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKP-HSCPKC---------GKKFKRRDHVLQHLNKK 806
           C  QFS  + LTRH+ ++H+ +K    C +C          K F R D + +H+  K
Sbjct: 392 CCAQFSRSYDLTRHQNTIHASKKTVFRCSECIKSLGNEGYDKTFSRLDALTRHIKSK 448

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 752 SKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           +K  VC+ C R+      L  H  + H+G++P SC  P C K F  R ++L+H
Sbjct: 201 TKKNVCKVCGRECRRPSTLKTHMLT-HTGQRPFSCRHPGCSKSFNVRSNMLRH 252

>Scas_718.36d
          Length = 330

 Score = 36.6 bits (83), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 802
           Y C  C + F     L  H  ++ SG +P+ CP   C K F  + ++L+H
Sbjct: 239 YFCDVCGKGFRRPSSLRTHS-NIRSGNRPYKCPYSNCTKSFNAKSNMLRH 287

>YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of the
           regulatory particle of the proteasome, also binds DNA to
           act as a positive regulator of expression of many
           proteasome subunit genes, functions in RNA polymerase II
           transcription elongation [1596 bp, 531 aa]
          Length = 531

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 18/76 (23%)

Query: 749 DDGSKVYVCQ--------ECARQFSSGHHLTRHKKSVHSGEK-PHSCPKC---------G 790
           D  ++++ CQ         C  QFS  + LTRH+ ++H+  K    C +C          
Sbjct: 431 DGNNEIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCSECIKILGSEGYQ 490

Query: 791 KKFKRRDHVLQHLNKK 806
           K F R D + +H+  K
Sbjct: 491 KTFSRLDALTRHIKSK 506

>KLLA0E03146g complement(299014..301380) similar to sp|Q12386
           Saccharomyces cerevisiae YOR141c ARP8 Actin-related
           protein singleton, hypothetical start
          Length = 788

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 6/91 (6%)

Query: 283 SEFLRHKMFLVSPKLLQSNGIRCN-HIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFAL 341
           ++F  +++ L+ P L     +    H++  + +F             YG  L+ S     
Sbjct: 322 NQFSNYRVVLIVPDLFDKTFVESMIHLLLIELDFQSIALIQESLASCYGAGLSNST---- 377

Query: 342 PSWLDIGAKAKKCLCIDDAVGINVQKLRSNY 372
              +DIGAK  K  C+DD V +    LR NY
Sbjct: 378 -CVIDIGAKQTKIACVDDGVVVKNSALRLNY 407

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 804
           LDD  K + C++C   F     L RH++  H    P+ C  CGK F R+D + +H +
Sbjct: 199 LDD--KRFPCEKCHMVFRRSSDLRRHERQ-HLPILPNICTLCGKGFARKDALKRHFD 252

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           C  +     H+T H + VH   KP  C  CGKKFKR   + +HL
Sbjct: 95  CNTKTVKRDHITSHLR-VHVPLKPFGCSTCGKKFKRPQDLKKHL 137

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 9/69 (13%)

Query: 749 DDGSKVYVCQ--ECARQFSSGHHLTRHKKSVHSGEKPH-----SC--PKCGKKFKRRDHV 799
           DD S++ VCQ   C++ F     L  H  + H G K       +C    C  K  +RDH+
Sbjct: 46  DDSSEMLVCQWQGCSQVFPQPELLYHHLCNDHVGRKSQKNLQLNCNWGNCNTKTVKRDHI 105

Query: 800 LQHLNKKIP 808
             HL   +P
Sbjct: 106 TSHLRVHVP 114

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 753 KVYVCQE--CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           + +VC+E  C + F    HL  HK S HS  KP +CP C K F     + +H
Sbjct: 36  RPFVCEEPGCGKGFLRASHLKVHKWS-HSQVKPLACPVCSKGFTTNQQLSRH 86

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 13/71 (18%)

Query: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP----------KC--GKKFKR 795
           L++G + ++C  C   F    +LTRH K  H+ EK + CP          +C     F R
Sbjct: 153 LNNGEEEFICHYCDATFRIRGYLTRHIKK-HAIEKAYHCPFFNSATPPDLRCHNSGGFSR 211

Query: 796 RDHVLQHLNKK 806
           RD    HL  +
Sbjct: 212 RDTYKTHLKAR 222

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 764 FSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 802
           F+   H  RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 3   FTRAEHHARHIRK-HTGEKPFQCDICMKFFSRIDNLKQH 40

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEK 782
           G K + C  C + FS   +L +HK SVHS  K
Sbjct: 18  GEKPFQCDICMKFFSRIDNLKQHKDSVHSANK 49

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 15/87 (17%)

Query: 734 ALAQSKINDEEIMFLDDGSKV--YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP---- 787
           ++ +S ++DE     D+ S+   Y+C  C  +F    +LTRH K  H+  K + CP    
Sbjct: 181 SIDESPLSDEVQGIADESSETLPYICHYCDARFRIRGYLTRHIKK-HAKRKAYHCPFFDN 239

Query: 788 ------KC--GKKFKRRDHVLQHLNKK 806
                 +C     F RRD    HL  +
Sbjct: 240 SISQELRCHTSGGFSRRDTYKTHLKSR 266

>Scas_604.4
          Length = 585

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           C  +     H+T H + VH   KP +C KC KKFKR   + +HL
Sbjct: 224 CFTKTVKRDHITSHLR-VHVPLKPFACKKCTKKFKRPQDLKKHL 266

>CAGL0K01727g complement(152569..154068) similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c, start by similarity
          Length = 499

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKP-HSCPKC---------GKKFKRRDHVLQHLNKK 806
           C  QFS  + LTRH+ ++H+ ++    C +C          K F R D + +H+  K
Sbjct: 418 CGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIRALGDEGFQKTFSRLDALTRHIKAK 474

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 9/63 (14%)

Query: 749 DDGSKVYVCQE--CARQFSSGHHLTRHKKSVHSGE-------KPHSCPKCGKKFKRRDHV 799
           +DG   Y C    C + FS   HL+RHK +    E        P S   CGK F RRD +
Sbjct: 39  EDGQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLL 98

Query: 800 LQH 802
            +H
Sbjct: 99  NRH 101

>Scas_627.6
          Length = 1207

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 11/58 (18%)

Query: 755 YVCQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCP--------KCGKKFKRRDHVLQH 802
           Y+C   +C + F+   HL+RHK + H  ++   CP         C K F R+D +++H
Sbjct: 42  YICPHPDCNKSFTRQEHLSRHKLN-HWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRH 98

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query: 757 CQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           CQ   C  +     H+T H + VH   KP +C  C K+FKR   + +HL
Sbjct: 191 CQWDNCTSKTEKRDHMTSHLR-VHVPLKPFACSTCSKRFKRPQDLKKHL 238

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 35/92 (38%), Gaps = 11/92 (11%)

Query: 726 IDPESPTSALAQSKINDEEIMFLDDGSKVYVCQ--ECARQFSSGHHLTRHKKSVHSGEKP 783
           I  ESPTS     +   +     D   +  +C+   C R+F     L  H    H G K 
Sbjct: 126 IKKESPTSTEPLKETTKDTSK--DTPKETLICKWSHCYREFQQAELLYHHLCQEHVGRKS 183

Query: 784 HS-----C--PKCGKKFKRRDHVLQHLNKKIP 808
                  C    C  K ++RDH+  HL   +P
Sbjct: 184 QKNLQLKCQWDNCTSKTEKRDHMTSHLRVHVP 215

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 753 KVYVC--QECARQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHL 803
           K YVC  + C +++S    L +H +S H+ EKP  CP+  C K F R  H+  H+
Sbjct: 6   KRYVCPIESCGKKYSRPCLLRQHVRS-HTNEKPFHCPEPGCDKAFLRPSHLRVHM 59

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 757 CQ--ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           CQ  +C  +     H+T H + VH   KP +C  C KKFKR   + +HL
Sbjct: 149 CQWGDCQTKTVKRDHITSHLR-VHVQLKPFACSTCNKKFKRPQDLKKHL 196

>Kwal_47.18337
          Length = 536

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 35/81 (43%), Gaps = 14/81 (17%)

Query: 738 SKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP---------- 787
           SK  DEE      G K +VC  C  +F    +LTRH K  H+ EK + CP          
Sbjct: 141 SKTEDEE-KDAHKGQKRFVCHYCNAEFYIRGYLTRHIKK-HAVEKAYYCPFFNADAPKDA 198

Query: 788 KCGKK--FKRRDHVLQHLNKK 806
           +C     F RRD    HL  +
Sbjct: 199 RCHTTGGFSRRDTYKTHLRSR 219

>Scas_641.24
          Length = 532

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 36/81 (44%), Gaps = 18/81 (22%)

Query: 738 SKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP---------- 787
           +K  DEE    DDG   ++C  C  +F    +LTRH K  H+ EK + CP          
Sbjct: 171 TKEEDEET---DDGP--FICHYCDAKFRIRGYLTRHIKK-HAVEKAYHCPFFNSDILSES 224

Query: 788 KCGKK--FKRRDHVLQHLNKK 806
           +C     F RRD    HL  +
Sbjct: 225 RCHNTGGFSRRDTYKTHLKAR 245

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 759 ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           +C  +     H+T H + VH   KP  C  C KKFKR   + +HL
Sbjct: 188 DCTTKTEKRDHITSHLR-VHVPLKPFGCSTCSKKFKRPQDLKKHL 231

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 752 SKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802
           S  Y C +C ++F     L  H   +H G  P  C  P C KKF  + ++L+H
Sbjct: 213 SYTYCCPKCKKEFKRPSGLRTHM-VIHYGRNPFFCKWPNCSKKFNVKSNLLRH 264

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 751 GSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 805
           G K Y C  C ++FS   +L  HK + H   +P  C    C K F +  ++  H NK
Sbjct: 7   GEKPYECDICKKRFSRKGNLAAHKMT-HGKIRPFICKLDNCNKSFSQLGNMKSHQNK 62

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 779 SGEKPHSCPKCGKKFKRRDHVLQH 802
           +GEKP+ C  C K+F R+ ++  H
Sbjct: 6   TGEKPYECDICKKRFSRKGNLAAH 29

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 753 KVYVCQE--CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 804
           K Y C E  C ++F    HL  HK + HS  KP +C  C K+F     + +HLN
Sbjct: 40  KPYHCDEPGCGKKFIRPCHLRVHKWT-HSQIKPKACTLCQKRFVTNQQLRRHLN 92

>Scas_713.11
          Length = 465

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEK-PHSCPKC---------GKKFKRRDHVLQHLNKK 806
           C+ QFS  + L RH+ ++H+ +K    C +C          K F R D + +HL  K
Sbjct: 383 CSAQFSRSYDLVRHQNTIHAKQKIVFHCLQCIKLFGERGFSKTFSRLDALSRHLKSK 439

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 760 CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           C  +     H+T H + VH   KP SC  C +KFKR   + +HL
Sbjct: 113 CTTKTVKRDHITSHLR-VHVPLKPFSCSTCSRKFKRPQDLKKHL 155

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKK--FKRRDHVLQH 802
           YVC  C  +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 162 YVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDTYKTH 220

Query: 803 LNKK 806
           L  +
Sbjct: 221 LKSR 224

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 759 ECARQFSSGHHLTRHKKS-------VHSGEKPHSCPKCGKKFKRRDHVLQH 802
           EC + FS   HL+RHK +       V S   P +   C K F R+D +++H
Sbjct: 37  ECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRH 87

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 9/61 (14%)

Query: 751 GSKVYVCQE--CARQFSSGHHLTRHKKSVHSGE-------KPHSCPKCGKKFKRRDHVLQ 801
           G   YVC    C++ F+   HL+RHK +    E        P     C + F RRD +++
Sbjct: 12  GKPRYVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVR 71

Query: 802 H 802
           H
Sbjct: 72  H 72

>Sklu_1870.4 YLR056W, Contig c1870 4612-5709
          Length = 365

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 378 GGAQKETGKEVQNDKSISSSKTLEEVLEERPPLKKFKMGDSDRSFDSVKSTPEFLLK 434
           GG+ +E  +E+ N     S++T EE +++   +KK   GD D   D V  T E LLK
Sbjct: 309 GGSYREPDRELFNKSLKKSTRTWEEQVKKMEIIKKEVEGDDD---DRVYGTEESLLK 362

>Scas_660.12
          Length = 367

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKK--FKRRDHVLQH 802
           YVC  C  +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKK-HAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTH 154

Query: 803 LNKK 806
           L  +
Sbjct: 155 LKAR 158

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKK--FKRRDHVLQH 802
           +VC  C  +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 242 FVCHYCDAEFKMRGYLTRHIKK-HAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTH 300

Query: 803 LNKK 806
           L  +
Sbjct: 301 LRSR 304

>Kwal_26.9300
          Length = 304

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 782 KPHSCPKCGKKFKRRDHVLQHLNK 805
           KPH CP CG+ F R + +L+H  +
Sbjct: 171 KPHKCPVCGRGFTRHNDLLRHRKR 194

>Scas_712.2
          Length = 327

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 755 YVC--QECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 804
           Y+C  + C ++F    HL  HK + HS  KP  C  C K F     + +HLN
Sbjct: 43  YICDVEGCGKRFMRPCHLKVHKWT-HSKVKPLKCAFCEKGFITNQQLKRHLN 93

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 756 VCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLN 804
            C  C R+ +    L  H   +H+GE P  C  P C K+F  R ++ +H+N
Sbjct: 259 TCLVCGRRCTRPSTLKTHML-IHTGELPFQCSWPGCSKRFNVRSNMNRHVN 308

>KLLA0E12155g 1079451..1079996 similar to sp|P33421 Saccharomyces
           cerevisiae YKL141w SDH3 cytochrome b560 subunit of
           respiratory complex II, start by similarity
          Length = 181

 Score = 30.8 bits (68), Expect = 2.6,   Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%)

Query: 315 FIVTYPFGYHAGFNYGY---NLAESVNFALPSWLDIGAKA 351
           + VT  FG    F  G    NL +  N  +PSW+D+ AKA
Sbjct: 91  YAVTIAFGVSTVFGLGMSTENLVQFYNEKIPSWIDLTAKA 130

>Kwal_33.14227
          Length = 551

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 18/72 (25%)

Query: 753 KVYVCQ--------ECARQFSSGHHLTRHKKSVH-SGEKPHSCPKC---------GKKFK 794
           +V+ CQ         C+++FS  + L RH+K++H S +K   C  C          K F 
Sbjct: 456 EVHTCQLMNPITSEPCSKKFSRPYDLIRHQKTIHASKKKVFRCVFCIQQQGAEGYQKTFS 515

Query: 795 RRDHVLQHLNKK 806
           R D + +H+  K
Sbjct: 516 RGDALSRHIKVK 527

>Kwal_55.20634
          Length = 419

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 759 ECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           +C  +     H+T H + VH   KP +C  C K FKR   + +HL
Sbjct: 98  KCTAKTVKRDHITSHLR-VHVPLKPFACSTCTKTFKRPQDLKKHL 141

>CAGL0K06413g 627811..628890 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1, hypothetical
           start
          Length = 359

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 36/85 (42%), Gaps = 13/85 (15%)

Query: 734 ALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKK- 792
            + +  + +EE+       + +VC  C  +F    +LTRH K  H+ +K + CP   +K 
Sbjct: 20  VVGRKLVKEEEVSKTRHEQEEFVCHYCDARFKIRGYLTRHIKK-HALQKAYYCPYYNEKA 78

Query: 793 -----------FKRRDHVLQHLNKK 806
                      F RRD    H+  +
Sbjct: 79  PPDLRCHNNGGFSRRDTYKAHMKTR 103

>Scas_591.8
          Length = 680

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 40/100 (40%), Gaps = 21/100 (21%)

Query: 193 FEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGA 252
           F+   KE+ +S LP  +  L  +V              A+ +W     D       HFG 
Sbjct: 594 FDRQTKEYQLSVLPDDVPILSVEV-------------AATLSWGNYSHD-------HFGI 633

Query: 253 PKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLR-HKMF 291
            +   S    D+ KF+ F KE   E ++   EF +  KM+
Sbjct: 634 DRFGVSGKGPDAFKFFEFTKEGVTERARKAMEFYKGRKMY 673

>KLLA0F21692g complement(2014152..2018729)
           gi|14571818|gb|AAK67294.1|AF245358_1 Kluyveromyces
           lactis multidrug pump KlPDR5, start by similarity
          Length = 1525

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 55/132 (41%), Gaps = 17/132 (12%)

Query: 3   YEPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGII--------------KIVPPE 48
           Y P H   ++ +    +  F  FY   CE N+  ++ G I              K++  +
Sbjct: 754 YNPSHRWRALGIALAYFIFFTAFYLLFCEFNESAVQKGEILLFPKSVLKRAKKQKLIKAK 813

Query: 49  QWVDKVAFPPSAETLQKIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKL 108
             V+ V     A T QK+   + ++ +IS S    V  NV   KS  +  W+++ +D ++
Sbjct: 814 HDVEAVQDSEGALTDQKLLQDSLVESNISSSSDKSV--NVGLSKSEAIFHWRNVCYDVQI 871

Query: 109 -PEGRHSAKNED 119
             E R    N D
Sbjct: 872 KKETRRILSNVD 883

>Scas_670.2
          Length = 435

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 757 CQECARQFSSGHHLTRHKKS-VHSGEKPHSCPKCGKKFKRRDHVLQH 802
           C  C+  ++   +LT HK + +   ++PH CP C + F R + +++H
Sbjct: 254 CPICSGYYA---NLTTHKATHLVPEDRPHKCPICQRGFGRNNDLIRH 297

>Kwal_27.10167
          Length = 285

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 750 DGSKVYVCQE--CARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803
           + ++ + C E  C ++F    H+  H+ + HS  KP  C +C K F  +  + +HL
Sbjct: 60  NNNRPFACPEPNCGKRFLRVCHMNVHRWT-HSKIKPLKCEECSKGFTTKQQLSRHL 114

>Scas_683.30
          Length = 478

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 757 CQECARQFSSGHHLTRHKKSVHSGE-KPHSCPKCGKKFKRRDHVLQH 802
           C  C   ++   +L+ HK +  + E +PH CP C + F R + +++H
Sbjct: 289 CPTCLNYYA---NLSTHKSTHLTPEDRPHKCPICERGFARNNDLIRH 332

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 770 LTRHKKSVHSGE-KPHSCPKCGKKFKRRDHVLQH 802
           LT HK +  + E +PH CP C + F R + +L+H
Sbjct: 154 LTTHKATHLTPEDRPHKCPICHRGFARNNDLLRH 187

>YIL162W (SUC2) [2515] chr9 (37385..38983) Beta-fructofuranosidase
           2, invertase [1599 bp, 532 aa]
          Length = 532

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 146 EKFRENFNCDHLEQFDDEQR-VEFLESYY-WKTLNFTEPMYGADSLG 190
           + F  +FN  H E FD++ R V+F + YY  +T   T+P YG+ +LG
Sbjct: 259 QYFVGSFNGTHFEAFDNQSRVVDFGKDYYALQTFFNTDPTYGS-ALG 304

>CAGL0G07172g complement(678730..681330) some similarities with
           YALI0E14399g Yarrowia lipolytica, hypothetical start
          Length = 866

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 207 SILEYLDEKVPGVNESYLYAGLWKASFAWHLEDQDLYSINYIHFGAPKQW 256
           + LEY D + P    +YL   L      WH+ D++LY+I +    A K+W
Sbjct: 189 ATLEYKDGRKPKGVIAYLSHKLHSYETRWHIRDKELYAIVF----ALKKW 234

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,388,826
Number of extensions: 1226804
Number of successful extensions: 3781
Number of sequences better than 10.0: 219
Number of HSP's gapped: 3647
Number of HSP's successfully gapped: 297
Length of query: 809
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 699
Effective length of database: 12,788,129
Effective search space: 8938902171
Effective search space used: 8938902171
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)