Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17644g1576155282670.0
YER166W (DNF1)1571152653530.0
YDR093W (DNF2)1612160452500.0
Scas_576.81591151552140.0
AGR120C1547153851160.0
CAGL0L11814g1576150450520.0
Scas_636.161554152150500.0
CAGL0G08085g1578150648730.0
Kwal_26.70701315108817430.0
KLLA0A04015g1343103717440.0
CAGL0G06270g1328103917180.0
YAL026C (DRS2)1355103816690.0
ADR350W1311112016200.0
Kwal_56.234672802638561e-104
YIL048W (NEO1)11518948522e-94
CAGL0L00715g11448938442e-93
Sklu_2193.111438848326e-92
ADL079C11668898301e-91
CAGL0H04477g16266138403e-91
KLLA0E01650g15505428366e-91
Scas_704.3811618738202e-90
Kwal_23.578911338898087e-89
Kwal_23.355615975618153e-88
YMR162C (DNF3)16565528136e-88
AFL191W15755798082e-87
KLLA0C08393g11488947883e-86
Scas_669.316385957753e-83
Scas_505.410253725835e-61
Scas_89.12712863847e-41
Kwal_26.920714694252112e-16
AFR567W14493181772e-12
Scas_665.3014393221729e-12
CAGL0M11308g14523201682e-11
KLLA0B08217g14393301673e-11
YOR291W14723221664e-11
YGL006W (PMC1)11733711494e-09
CAGL0A00517g11223751476e-09
KLLA0E22352g12063111299e-07
Kwal_47.1754712403791252e-06
CAGL0L01419g12143231218e-06
AFR354C12103211191e-05
YEL031W (SPF1)12152871191e-05
KLLA0A08910g12801881163e-05
KLLA0E14630g10826711129e-05
Scas_583.14*8753481082e-04
Kwal_23.316011005391064e-04
KLLA0F20658g10824231047e-04
CAGL0I04312g9511851010.001
KLLA0A03157g938199990.003
AEL301W957195990.003
AFL011W1242189960.006
Scas_297.180069880.050
YGL167C (PMR1)950191840.15
Scas_710.4190454840.16
CAGL0A00495g90262840.16
Kwal_14.1498939181840.17
Scas_688.191362830.19
YPL036W (PMA2)94762830.22
YGL008C (PMA1)91862820.23
AGL085C90962790.54
Kwal_47.1752289962780.74
CAGL0J01870g94661780.77
KLLA0A09031g89962780.77
Scas_707.48*741184770.95
KLLA0D04092g115265742.6
CAGL0K12034g1087108732.7
YNL272C (SEC2)75981732.8
YJL103C618103714.9
AGL097C1096118715.1
YCR011C (ADP1)104967715.2
Scas_515.41114113715.3
KLLA0D04554g102289715.4
Scas_317.1357233705.4
AGL041C123361706.3
KLLA0C15785g228756698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17644g
         (1552 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...  3189   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...  2066   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...  2026   0.0  
Scas_576.8                                                           2013   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...  1975   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...  1950   0.0  
Scas_636.16                                                          1949   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...  1881   0.0  
Kwal_26.7070                                                          676   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   676   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   666   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   647   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   628   0.0  
Kwal_56.23467                                                         334   e-104
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   332   2e-94
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   329   2e-93
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         325   6e-92
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   324   1e-91
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   328   3e-91
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   326   6e-91
Scas_704.38                                                           320   2e-90
Kwal_23.5789                                                          315   7e-89
Kwal_23.3556                                                          318   3e-88
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   317   6e-88
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   315   2e-87
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   308   3e-86
Scas_669.3                                                            303   3e-83
Scas_505.4                                                            229   5e-61
Scas_89.1                                                             152   7e-41
Kwal_26.9207                                                           86   2e-16
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    73   2e-12
Scas_665.30                                                            71   9e-12
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    69   2e-11
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    69   3e-11
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    69   4e-11
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    62   4e-09
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    61   6e-09
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    54   9e-07
Kwal_47.17547                                                          53   2e-06
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    51   8e-06
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    50   1e-05
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    50   1e-05
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    49   3e-05
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    48   9e-05
Scas_583.14*                                                           46   2e-04
Kwal_23.3160                                                           45   4e-04
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    45   7e-04
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    44   0.001
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    43   0.003
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    43   0.003
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    42   0.006
Scas_297.1                                                             39   0.050
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    37   0.15 
Scas_710.41                                                            37   0.16 
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    37   0.16 
Kwal_14.1498                                                           37   0.17 
Scas_688.1                                                             37   0.19 
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    37   0.22 
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    36   0.23 
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    35   0.54 
Kwal_47.17522                                                          35   0.74 
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    35   0.77 
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    35   0.77 
Scas_707.48*                                                           34   0.95 
KLLA0D04092g complement(344666..348124) some similarities with s...    33   2.6  
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    33   2.7  
YNL272C (SEC2) [4337] chr14 complement(126803..129082) Guanine n...    33   2.8  
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    32   4.9  
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    32   5.1  
YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of t...    32   5.2  
Scas_515.4                                                             32   5.3  
KLLA0D04554g complement(385733..388801) similar to sp|P25371 Sac...    32   5.4  
Scas_317.1                                                             32   5.4  
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    32   6.3  
KLLA0C15785g complement(1367880..1374743) similar to sp|P38111 S...    31   8.9  

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 3189 bits (8267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1533/1552 (98%), Positives = 1533/1552 (98%)

Query: 1    MTGPKKKGKDSDPYSGSFKXXXXXXXXFNDRFVFEQGNQFASNLDGTIDNEADGSKTKLK 60
            MTGPKKKGKDSDPYSGSFK        FNDRFVFEQGNQFASNLDGTIDNEADGSKTKLK
Sbjct: 1    MTGPKKKGKDSDPYSGSFKDDSSPDSPFNDRFVFEQGNQFASNLDGTIDNEADGSKTKLK 60

Query: 61   GRQGSILKNGSTSSPSKIGKKKNQQLTFGDTGKTSDLKNEEFEEISFETTGADDQRSYVN 120
            GRQGSILKNGSTSSPSKIGKKKNQQLTFGDTGKTSDLKNEEFEEISFETTGADDQRSYVN
Sbjct: 61   GRQGSILKNGSTSSPSKIGKKKNQQLTFGDTGKTSDLKNEEFEEISFETTGADDQRSYVN 120

Query: 121  TPIINQGNFAVDEEDEREKDRQLSSAEDSKHVKRMRWGTRRDKKGKPAMGRAKTLRWTKK 180
            TPIINQGNFAVDEEDEREKDRQLSSAEDSKHVKRMRWGTRRDKKGKPAMGRAKTLRWTKK
Sbjct: 121  TPIINQGNFAVDEEDEREKDRQLSSAEDSKHVKRMRWGTRRDKKGKPAMGRAKTLRWTKK 180

Query: 181  NFHNPFADDTNLAAEGHSSDDDNDENYDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYY 240
            NFHNPFADDTNLAAEGHSSDDDNDENYDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYY
Sbjct: 181  NFHNPFADDTNLAAEGHSSDDDNDENYDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYY 240

Query: 241  PRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIV 300
            PRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIV
Sbjct: 241  PRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIV 300

Query: 301  VLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKANTRVLFRFI 360
            VLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKANTRVLFRFI
Sbjct: 301  VLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKANTRVLFRFI 360

Query: 361  HLCQELFTEEGKKQRAQRKRHEMHNKIRQTQTPRNSLDSVGSYRNSMESEFGGDLTERGK 420
            HLCQELFTEEGKKQRAQRKRHEMHNKIRQTQTPRNSLDSVGSYRNSMESEFGGDLTERGK
Sbjct: 361  HLCQELFTEEGKKQRAQRKRHEMHNKIRQTQTPRNSLDSVGSYRNSMESEFGGDLTERGK 420

Query: 421  DDLCLLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVET 480
            DDLCLLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPA           GACYVET
Sbjct: 421  DDLCLLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVET 480

Query: 481  KNLDGETNLKVRQSLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLE 540
            KNLDGETNLKVRQSLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLE
Sbjct: 481  KNLDGETNLKVRQSLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLE 540

Query: 541  KNEPVNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFM 600
            KNEPVNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFM
Sbjct: 541  KNEPVNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFM 600

Query: 601  NFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPI 660
            NFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPI
Sbjct: 601  NFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPI 660

Query: 661  SLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQN 720
            SLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQN
Sbjct: 661  SLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQN 720

Query: 721  VMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGE 780
            VMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGE
Sbjct: 721  VMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGE 780

Query: 781  NSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFK 840
            NSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFK
Sbjct: 781  NSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFK 840

Query: 841  AQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKI 900
            AQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKI
Sbjct: 841  AQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKI 900

Query: 901  PSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQREL 960
            PSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQREL
Sbjct: 901  PSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQREL 960

Query: 961  SWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATL 1020
            SWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATL
Sbjct: 961  SWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATL 1020

Query: 1021 GEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLIL 1080
            GEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLIL
Sbjct: 1021 GEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLIL 1080

Query: 1081 KYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCK 1140
            KYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCK
Sbjct: 1081 KYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCK 1140

Query: 1141 AVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMS 1200
            AVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMS
Sbjct: 1141 AVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMS 1200

Query: 1201 SDYAIGQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFE 1260
            SDYAIGQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFE
Sbjct: 1201 SDYAIGQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFE 1260

Query: 1261 YTYLTLFNLAFTSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAM 1320
            YTYLTLFNLAFTSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAM
Sbjct: 1261 YTYLTLFNLAFTSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAM 1320

Query: 1321 YQSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFS 1380
            YQSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFS
Sbjct: 1321 YQSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFS 1380

Query: 1381 SLFIALSCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADT 1440
            SLFIALSCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADT
Sbjct: 1381 SLFIALSCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADT 1440

Query: 1441 FLRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNAFVYNKDIEMAQSSTDSIQ 1500
            FLRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNAFVYNKDIEMAQSSTDSIQ
Sbjct: 1441 FLRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNAFVYNKDIEMAQSSTDSIQ 1500

Query: 1501 TEEIPMDELFNSSATSPRSYPHNRHQRSSGRPSLEITRAEMRNSNQLDNRYS 1552
            TEEIPMDELFNSSATSPRSYPHNRHQRSSGRPSLEITRAEMRNSNQLDNRYS
Sbjct: 1501 TEEIPMDELFNSSATSPRSYPHNRHQRSSGRPSLEITRAEMRNSNQLDNRYS 1552

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 2066 bits (5353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1007/1526 (65%), Positives = 1191/1526 (78%), Gaps = 62/1526 (4%)

Query: 69   NGSTSSPSKIGKKKNQQLTFGDTGKTSDLKNEEFEEISFETTGADDQRSYVNTPIINQGN 128
            +G+TS+     K    Q++F D  +T   K E+ EE +F      D  S+  TP +N G+
Sbjct: 40   DGATSN-----KYSRPQVSFND--ETPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNNGS 92

Query: 129  FAVDEEDEREKDRQLSSAEDSKHVKRMRWGTRRDKKGKPAMGRAKTLRWTKKNFHNPFAD 188
               D+ +      +  +  D   +KR R GT+R+KKG P MGR+KTL+W +KN  NPF D
Sbjct: 93   GTFDDVELDNDSGEPHTNYDG--MKRFRMGTKRNKKGNPIMGRSKTLKWARKNIPNPFED 150

Query: 189  DTNLAAEGHSSDDDNDENYDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTT 248
             T          DD D      +R +E RT+YYN+PLP+D++DE+GN  + YPRNKIRTT
Sbjct: 151  FTK---------DDIDPG--AINRAQELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTT 199

Query: 249  KYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDA 308
            KYTPLTF PKNI FQF N ANVYFLVLII+G FQIFGV NPGL+ VPL+VIV++T+ KDA
Sbjct: 200  KYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDA 259

Query: 309  IEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKANTRVLFRFIHLCQELFT 368
            IEDSRRT+LD+EVNN  THIL+GVEN NVS D +SLWR+FKKAN+R+LF+FI  C+E  T
Sbjct: 260  IEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISLWRRFKKANSRLLFKFIQYCKEHLT 319

Query: 369  EEGKKQRAQRKRHEMH-NKIRQTQTPRNSLDSVGSYRNSME---SEFGGDLTERGKDDLC 424
            EEGKK+R QRKRHE+   K   T  PR+SLDS+ SYR S +        D  E+G  +  
Sbjct: 320  EEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSADYGRPSLDYDNLEQGAGEAN 379

Query: 425  LLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLD 484
            ++D SLP   DCKFAK+YWK V VGDIVR+HNNDEIPA           GACYVETKNLD
Sbjct: 380  IVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLD 439

Query: 485  GETNLKVRQSLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEP 544
            GETNLKVRQSLKC++ IR S++I RTKF +ESEGPHSNLY+YQGN+KW +   G  +NEP
Sbjct: 440  GETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEP 499

Query: 545  VNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFAL 604
            + INN+LLRGCTLRNTKWAMG+V+FTG DTKIMLN+G+TPTK SRISRELN SV +NF L
Sbjct: 500  ITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVL 559

Query: 605  LFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYI 664
            LF+LCF +GI NGVYY     SR  +EFG+IAGSAA NG VSFWVA+ILYQS+VPISLYI
Sbjct: 560  LFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYI 619

Query: 665  SIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEF 724
            S+EIIKTAQA FIYGDV LYN +LDYPCTPKSW ISDDLGQ+EYIFSDKTGTLTQNVMEF
Sbjct: 620  SVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEF 679

Query: 725  KKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQL 784
            KKCTINGVSYGRAYTEALAGLRKRQGIDVE EG  EK  IA+D++ M+  L+ L  NSQ 
Sbjct: 680  KKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQF 739

Query: 785  RPENVTFVSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSP 844
             PE VTFVSKEFV+D  GA+GE Q++C E+FMLALALCH+VLVE N D+P+ +D KAQSP
Sbjct: 740  YPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSP 799

Query: 845  DEAALVGTARDMGFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSEN 904
            DEAALV TARD+GFSFVG+TK G+I+++QG+QKE+ +LN+LEFNS+RKRMSCI+KIP  N
Sbjct: 800  DEAALVATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLN 859

Query: 905  PNEEPRALLICKGADSIIYSRLSK---NNDEKLLEKTALHLEQYATEGLRTLCIAQRELS 961
            P +EPRALLICKGADSIIYSRLS+   +N E +LEKTALHLEQYATEGLRTLCIAQRELS
Sbjct: 860  PGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELS 919

Query: 962  WKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLG 1021
            W EY++WNEK++IAAA+L +REDE+E VAD IEREL LLGGTAIEDRLQDGVPD I  L 
Sbjct: 920  WSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLA 979

Query: 1022 EAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILK 1081
            EAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIK +GDDV  +GS+P+EIV  L+ K
Sbjct: 980  EAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSK 1039

Query: 1082 YLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKA 1141
            YL+E F ++GS EE+ EAKK HE P GN+ ++IDGDALKLAL  +D++R+FLLLCK C+A
Sbjct: 1040 YLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRA 1099

Query: 1142 VLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSS 1201
            VLCCRVSP+QKAAVVKLVK++LDVMTLAIGDGSNDVAMIQSAD+G+GIAGEEGRQAVM S
Sbjct: 1100 VLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCS 1159

Query: 1202 DYAIGQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEY 1261
            DYAIGQFRYL RLVLVHGRWSYKR+AEMIP FFYKN+IF L+LFWYG+YN++DGSYL+EY
Sbjct: 1160 DYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEY 1219

Query: 1262 TYLTLFNLAFTSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMY 1321
            TY+  +NLAFTSLPVIFLGILDQDVND +S+VVPQLYRVGILR EWNQ KF  YM D +Y
Sbjct: 1220 TYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLY 1279

Query: 1322 QSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSS 1381
            QS+ICFF PYL Y+K  IVT NG GLDHRY+VGV+V TIAV+SCNTYVLLHQYRWDWFS 
Sbjct: 1280 QSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSG 1339

Query: 1382 LFIALSCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTF 1441
            LFIALSCL +FAWTGIWSS  +S EF+K+AA IYG P FWA+ F  +LFCLLPRF  D+F
Sbjct: 1340 LFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSF 1399

Query: 1442 LRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNA----------FVYNKDIEM 1491
             + + P D++I+RE W+ G FDHYP GYDPTDP+RPKV  A             + ++  
Sbjct: 1400 QKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKAGQHGEKIIEGIALSDNLGG 1459

Query: 1492 AQSSTDSIQTEEIPMDELFNSSA------------TSPR------SYPHNRHQRSSG--- 1530
            +  S DS+ TEEIPM  +                 TSP+        P  +  ++ G   
Sbjct: 1460 SNYSRDSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSPKETQDLLQSPQFQQAQTFGRGP 1519

Query: 1531 ----RPSLEITRAEMRNSNQLDNRYS 1552
                R SL+ TR +M  +NQLDNRYS
Sbjct: 1520 STNVRSSLDRTREQMIATNQLDNRYS 1545

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 2026 bits (5250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1009/1604 (62%), Positives = 1206/1604 (75%), Gaps = 71/1604 (4%)

Query: 1    MTGPKKKGK----DSDPYSGSFKXXXXXXXXFNDRFVFEQGNQFASNLDGTIDNEADGSK 56
            M+ P K       D +  SGS          F+D F FE+ +    N++     +  GS 
Sbjct: 1    MSSPSKPTSPFVDDIEHESGSASNGLSSMSPFDDSFQFEKPSSAHGNIEVA---KTGGSV 57

Query: 57   TKLKGRQGSILKNGSTSSPSKIG-KKKNQQLTFGDTGKTSDLKNEEFEEISFETTGADDQ 115
             K   RQ   +K+ ST   SK+     +      D     +L  ++ E    E    DD 
Sbjct: 58   LK---RQSKPMKDISTPDLSKVTFDGIDDYSNDNDINDDDELNGKKTEIHEHENEVDDDL 114

Query: 116  RSYVNTPIINQGNFAVDEEDEREKDRQLSSAEDSKHVKRMRWGTRRDKKGKPAMGRAKTL 175
             S+  TP+ N G F   E D  E     S A+    +KR+R+GTRR+K G+  + R+KTL
Sbjct: 115  HSFQATPMPNTGGFEDVELDNNEGSNNDSQAD--HKLKRVRFGTRRNKSGRIDINRSKTL 172

Query: 176  RWTKKNFHNPFADDTNLAAEGHSSDDDNDENYDKSHRQRETRTIYYNLPLPEDILDEDGN 235
            +W KKNFHN        A +  S+ +D+ EN    +R  E RT+YYNLPLPED+LDEDG 
Sbjct: 173  KWAKKNFHN--------AIDEFSTKEDSLENSALQNRSDELRTVYYNLPLPEDMLDEDGL 224

Query: 236  STIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVP 295
                YPRNKIRTTKYTPLTFFPKNI FQF N AN+YFL+L+I+G FQIFGV NPG A+VP
Sbjct: 225  PLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVP 284

Query: 296  LIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKANTRV 355
            LIVIV++T+ KD IEDSRRT+LD+EVNN  THIL GV+N NV+ D VSLWR+FKKANTR 
Sbjct: 285  LIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENVAVDNVSLWRRFKKANTRA 344

Query: 356  LFRFIHLCQELFTEEGKKQRAQRKRHEMHNKIRQTQT--PRNSLDSVGSYRNSMESEFGG 413
            L +      E  T  G++++ Q+KR E+  K R +++  PR SLDS+GSYR  M ++FG 
Sbjct: 345  LIKIFEYFSENLTAAGREKKLQKKREELRRK-RNSRSFGPRGSLDSIGSYR--MSADFGR 401

Query: 414  ------------DLTERGKDDLCLLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIP 461
                            R  D   L+D +L   P+C+FAKDYWK+V VGDIVRVHNNDEIP
Sbjct: 402  PSLDYENLNQTMSQANRYNDGENLVDRTLQPNPECRFAKDYWKNVKVGDIVRVHNNDEIP 461

Query: 462  AXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRNSRNITRTKFKVESEGPHS 521
            A           GACYVETKNLDGETNLKVRQSLKCS +I++SR+ITRTKF VESEGPH+
Sbjct: 462  ADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDITRTKFWVESEGPHA 521

Query: 522  NLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAG 581
            NLYSYQGN KW D + G  +NEPVNINNLLLRGCTLRNTKWAMG+V+FTG DTKIM+NAG
Sbjct: 522  NLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAG 581

Query: 582  VTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAA 641
            VTPTK SRISRELN SV +NF LLF+LCF AGIVNGVYY+    SR+YFEFG+I GSA+ 
Sbjct: 582  VTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSAST 641

Query: 642  NGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISD 701
            NG VSFWVA+ILYQS+VPISLYIS+EIIKTAQA+FIY DV LYN +LDYPCTPKSW ISD
Sbjct: 642  NGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISD 701

Query: 702  DLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEK 761
            DLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG+DVE EG  EK
Sbjct: 702  DLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREK 761

Query: 762  EGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLALAL 821
            E IA+D+E M+  L+ + +N+Q  PE++TFVSKE V+D  G++G+ Q+KC E+F+LALAL
Sbjct: 762  EEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALAL 821

Query: 822  CHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQGVQKEYRL 881
            CH+VLVE NKDDP+ +D KAQSPDE+ALV TAR +G+SFVG +K+G+IV+IQGVQKE+++
Sbjct: 822  CHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGLIVEIQGVQKEFQV 881

Query: 882  LNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSK-NNDEKLLEKTAL 940
            LNVLEFNS+RKRMSCI+KIP   P +EP+ALLICKGADS+IYSRL +  ND  LLEKTAL
Sbjct: 882  LNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTAL 941

Query: 941  HLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLL 1000
            HLE+YATEGLRTLC+AQREL+W EY+ W + +++AAA++ +RE+E++KV DVIEREL LL
Sbjct: 942  HLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILL 1001

Query: 1001 GGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKAS 1060
            GGTAIEDRLQDGVPDSIA L EAGIKLWVLTGDKVETAINIGFSCN+LNN+MELLV+KAS
Sbjct: 1002 GGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKAS 1061

Query: 1061 GDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALK 1120
            G+DV+ +GS P ++V NL+ KYL+EKF MSGS EEL+EAK+ H  P GNF VIIDGDALK
Sbjct: 1062 GEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALK 1121

Query: 1121 LALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMI 1180
            +AL  ++++R+FLLLCK CKAVLCCRVSPAQKAAVVKLVK TLDVMTLAIGDGSNDVAMI
Sbjct: 1122 VALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMI 1181

Query: 1181 QSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIF 1240
            QSAD+GVGIAGEEGRQAVM SDYAIGQFRY+TRLVLVHG+W YKR+AEMIP FFYKNVIF
Sbjct: 1182 QSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIF 1241

Query: 1241 TLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILDQDVNDIVSMVVPQLYRV 1300
            TLSLFWYG+YNN+DGSYLFEYTYLT +NLAFTS+PVI L +LDQDV+D VSM+VPQLYRV
Sbjct: 1242 TLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRV 1301

Query: 1301 GILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATI 1360
            GILR EWNQTKF  YM D +YQSVICFF PYL Y+K  +VT+NG GLDHRY+VGVFV  I
Sbjct: 1302 GILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAI 1361

Query: 1361 AVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVF 1420
            AV SCN YV + QYRWDWF  LFI LS    + WTGIW+S +SS EFYK AA ++ QP +
Sbjct: 1362 AVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTSSSSSNEFYKGAARVFAQPAY 1421

Query: 1421 WAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKV- 1479
            WA++F G+LFCLLPRF  D   + + PKDI+I+RE W RGDFD YP+GYDPTDP RP++ 
Sbjct: 1422 WAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRIN 1481

Query: 1480 --------KNAFVYNKDIEMAQSSTDSIQTEEIPMDEL---------FNSSAT------- 1515
                    K     +   +    S ++I TEEIPM  L         +  S T       
Sbjct: 1482 EIRPLTDFKEPISLDTHFDGVSHSQETIVTEEIPMSILNGEQGSRKGYRVSTTLERRDQL 1541

Query: 1516 SPRSYPHNRHQRSSG-------RPSLEITRAEMRNSNQLDNRYS 1552
            SP +  +N  +RS         R SL+ TR EM  ++QLD RYS
Sbjct: 1542 SPVTTTNNLPRRSMASARGNKLRTSLDRTREEMLANHQLDTRYS 1585

>Scas_576.8
          Length = 1591

 Score = 2013 bits (5214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 988/1515 (65%), Positives = 1186/1515 (78%), Gaps = 63/1515 (4%)

Query: 91   TGKTSDLKNEEFEEISFETTGADDQRSYVNTPIINQGNFAVDE---EDEREKDRQLSSAE 147
            T  TS   ++E E +SF     +D  S+  TP I   N A D+   E++           
Sbjct: 56   THLTSFDDSKEKESLSFHEDVDNDIHSFEPTPRIGTSNGAFDDISLENDDHDPSSSHHHS 115

Query: 148  DSKHV-KRMRWGTRRDKKGKPAMGRAKTLRWTKKNFHNPFADDTNLAAEGHSSDDDNDEN 206
             S+++ KR+R GT+R+KKGKP +GRAKTL+W +K F NPF +  N         DD  ++
Sbjct: 116  TSENIMKRLRMGTQRNKKGKPTVGRAKTLKWAQKTFVNPFEESNN--------RDDIFDD 167

Query: 207  YDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKN 266
               ++R  E RT+YYN+PLP++++DEDG     YPRNKIRTTKY+PL FFPKNI FQF+N
Sbjct: 168  AGLTNRASELRTVYYNMPLPKEMVDEDGKPITDYPRNKIRTTKYSPLNFFPKNIMFQFQN 227

Query: 267  VANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPT 326
             ANVYFLVLII+G FQIFGV NPGLA VPLIVIV++T+ KDAIEDSRRT+LDMEVNN  T
Sbjct: 228  FANVYFLVLIILGAFQIFGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRT 287

Query: 327  HILKGVENVNVSNDKVSLWRKFKKANTRVLFRFIHLCQELFTEEGKKQRAQRKRHEMHNK 386
            HIL+GV+N NVS D VSLWR+FKKANTR+L +FI  C+  FTEEG+++R Q KRH + ++
Sbjct: 288  HILEGVDNGNVSVDNVSLWRRFKKANTRLLMKFIEYCKSHFTEEGRQKRRQHKRHILRSQ 347

Query: 387  IRQTQ----TPRNSLDSVGSYRNSMESEFGGDLTERGK--------DDLCLLDPSLPVLP 434
                       RNSLDS+GSYR  M  ++G    E           D+  ++D SLP   
Sbjct: 348  TAAINGGIDMARNSLDSIGSYR--MSGDYGRPSLEYDTVGQSALKTDNANIMDRSLPPRS 405

Query: 435  DCKFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQS 494
            DCKF+KDYWK+V VGDIVR+HNNDEIPA           G CY+ETKNLDGETNLKVR+S
Sbjct: 406  DCKFSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRES 465

Query: 495  LKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRG 554
            LKCSH IRNSR+I RTKF VESEGPH+NLYSYQGN+KWVD + G  KNEPV INNLLLRG
Sbjct: 466  LKCSHSIRNSRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRG 525

Query: 555  CTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGI 614
            CTLRNTKWAMG+VVFTG DTKIMLN+G TPTK SRISRELNLSV +NF  LF++CF + I
Sbjct: 526  CTLRNTKWAMGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAI 585

Query: 615  VNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQA 674
            +NGV Y     SR++FEFG++AGSA+ NG VSFWVA+ILYQS+VPISLYIS+EIIKTAQA
Sbjct: 586  INGVDYDKHPRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA 645

Query: 675  LFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 734
             FIYGDV LYN +LDYPCTPKSW ISDD+GQIEYIFSDKTGTLTQNVMEFKKCTING+SY
Sbjct: 646  AFIYGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISY 705

Query: 735  GRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSK 794
            GRAYTEALAGLRKRQGIDVEEEG  EKE IA+D++ M+  L+ L  NSQ  P+++TF+SK
Sbjct: 706  GRAYTEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISK 765

Query: 795  EFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTAR 854
            EFV D  GA+G+ Q+KC E+FMLALALCH+VLVE NK D + +D KAQSPDEAALV TAR
Sbjct: 766  EFVNDLKGASGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTAR 825

Query: 855  DMGFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLI 914
            D+GFSF+G+TK G+I+++QGVQKE+++LN LEFNSTRKRMSCI+KIP  NP++EPRALLI
Sbjct: 826  DVGFSFIGKTKTGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLI 885

Query: 915  CKGADSIIYSRL-SKN--NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEK 971
            CKGADSIIYSRL +KN  N E LLEKTALHLEQYATEGLRTLCIAQRELSW EY EWN++
Sbjct: 886  CKGADSIIYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKR 945

Query: 972  HEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLT 1031
            ++IAAA++ +RE+++E V+D IERELTLLGGTAIEDRLQDGVP+SI+ L +AGIKLWVLT
Sbjct: 946  YDIAAASVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLT 1005

Query: 1032 GDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSG 1091
            GDKVETAINIGFSCNLLNN+MELLV+K +GDDV  +G+ PAEI ++LI KYL+EKF ++G
Sbjct: 1006 GDKVETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTG 1065

Query: 1092 SYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQ 1151
            S  EL +AKK H+ P G+F V+IDG+ALKLAL  + ++R+FLLLCK CKAVLCCRVSPAQ
Sbjct: 1066 SEMELADAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQ 1125

Query: 1152 KAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYL 1211
            KAAVVKLV  +LDVMTLAIGDGSNDVAMIQSAD+GVGIAGEEGRQAVM SDYAIGQFRYL
Sbjct: 1126 KAAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYL 1185

Query: 1212 TRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAF 1271
            TRLVLVHGRWSY+R+AEMIP FFYKNVIFTL+LFWYG+YNN+DGSYLFEYT+L  +NLAF
Sbjct: 1186 TRLVLVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAF 1245

Query: 1272 TSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPY 1331
            TSLPVIF+GI+DQDV+D VS+V+PQLYR GILR +WNQTKF  YM D +YQS ICFF PY
Sbjct: 1246 TSLPVIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFFFPY 1305

Query: 1332 LCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCI 1391
              Y+K  IV+ NG GLDHR++VGV V ++AVVSCN Y+LLHQYRWDWFS LFI LSC+ +
Sbjct: 1306 CLYHKNQIVSNNGLGLDHRFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLSCIIL 1365

Query: 1392 FAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDID 1451
            F WTG+WSS  +S EF+K+A+ IYG P FW + F GI++CLLPRF  D F + + P D++
Sbjct: 1366 FFWTGVWSSSLTSKEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCFRKFFYPTDVE 1425

Query: 1452 IIRECWKRGDFDHYPEGYDPTDPDRPKVKNAFVYN----KDIEMAQS------STDSIQT 1501
            I+RE W+RGDF HYP GYDPTDP+RPKV  +  +     + I ++QS      S +S+ T
Sbjct: 1426 IVREMWQRGDFSHYPPGYDPTDPNRPKVAKSGKFGERIVEGIHLSQSFGENNFSHESVAT 1485

Query: 1502 EEIPMDELFNSS------------ATSPRSY------------PHNRHQRSSGRPSLEIT 1537
            EEIPM+ L   +            A+SP+                 R + + GR SLE T
Sbjct: 1486 EEIPMNILHTDAGQTIRRDTQDQWASSPKETQDLLFSPRLNQEQEQRQKSNLGRSSLERT 1545

Query: 1538 RAEMRNSNQLDNRYS 1552
            R +M  +NQLDNRYS
Sbjct: 1546 REDMLATNQLDNRYS 1560

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 1975 bits (5116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 983/1538 (63%), Positives = 1183/1538 (76%), Gaps = 69/1538 (4%)

Query: 28   FNDRFVFEQGNQFASNLDGTIDNEADGSKTKLKGRQGSILKNGSTSSPSKIGKKKNQQLT 87
            F+D F FE G +                    +GRQ SILK  +   P + G K    L 
Sbjct: 43   FSDEFQFEVGGR--------------------EGRQPSILK--AERQPQRQGGK----LA 76

Query: 88   FGD-TGKTSDLKNEEFEEISFETTGADDQRSYVNTPIINQGNFAVDEEDEREKDRQLSSA 146
            F   TG+  D  N EF      T     Q    + P+ +             K R+L SA
Sbjct: 77   FATGTGEHVDGANSEFSMTLTPTRVGQPQ----SVPLSDG------------KRRELRSA 120

Query: 147  EDSKHVKRMRWGTRRDKKGKPAMGRAKTLRWTKKNFHNPFADDTNLAAEGHSSDDDNDEN 206
               K +K +RWGT+R + G+P +GRA+TLRW KKN+ N       L  +  S   D D  
Sbjct: 121  ---KEMKILRWGTQRHRTGRP-VGRARTLRWGKKNYDN-------LPEDRGSGGSDTDAG 169

Query: 207  YDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKN 266
                 R  E R +Y+N+PLP ++  E+G   + YPRNKIRTTKYTPL+F PKN+A+QFKN
Sbjct: 170  VAGKSRAAEKRAVYFNMPLPPELTGENGRPVVNYPRNKIRTTKYTPLSFLPKNLAYQFKN 229

Query: 267  VANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPT 326
             AN+YFL+L+ + F  IFGV NP LA +PLI IVV+T  KDA EDSRRTILD+EVNN  +
Sbjct: 230  AANIYFLLLVCLSFVSIFGVTNPALAAIPLIAIVVITGLKDAFEDSRRTILDLEVNNMRS 289

Query: 327  HILKGVENVNVSNDKVSLWRKFKKANTRVLFRFIHLCQELFTEEGKKQRAQRKRHEMHNK 386
            HIL GVEN NVS D VSLWRKFKK NTR+L   +   +E FTE G+++RAQR R E    
Sbjct: 290  HILHGVENNNVSADNVSLWRKFKKLNTRLLIATVRFFRESFTEAGRRRRAQRAREESQMA 349

Query: 387  I-RQTQTPRNSLDSVGSYRNSMESEFGGDLTERGKDDLCLLDPSLPVLPDCKFAKDYWKS 445
              R    PR SLDS+GSYR S++ +  G L     D + +L+ +LP +PDC+F K +WK 
Sbjct: 350  ASRLGSDPRMSLDSMGSYRPSLDFDNIGQLVS--SDQVSVLNRNLPPVPDCRFGKSHWKD 407

Query: 446  VSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRNSR 505
            + VGDIVR+HNNDEIPA           GACYVETKNLDGETNLKVRQSLKCSH IRNS+
Sbjct: 408  IRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRNSK 467

Query: 506  NITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWAMG 565
            +I+R KF VESEGPH+NLYSYQGN KWVD ETG+  NEPVNINN+LLRGC+LRNTKWAMG
Sbjct: 468  DISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWAMG 527

Query: 566  IVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTDNT 625
            IV+FTG DTKIMLNAGVTPTK SRISRELN SV +NF  LFVLC AAG+VNG+YYR D T
Sbjct: 528  IVMFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLAAGLVNGIYYRRDAT 587

Query: 626  SRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVALYN 685
            SR +FEFG++AG+  ANG+++F+VALILYQS+VPISLYISIEIIKTAQA FIYGDV LYN
Sbjct: 588  SRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYGDVLLYN 647

Query: 686  ERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGL 745
             +LDYPCTP++W ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGL
Sbjct: 648  PKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGL 707

Query: 746  RKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGANG 805
            RKRQG+D+EEEGA E+  I +DK+ M+  L  LG+NSQL P  VTFVSKE VQD  GAN 
Sbjct: 708  RKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQDLGGANS 767

Query: 806  ETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTK 865
            + QK+  E+FML+LALCH+V+VEENK++PE +D KAQSPDEAALV TARDMGFSFVGRTK
Sbjct: 768  QEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTK 827

Query: 866  NGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSR 925
            NGVI++IQGVQKE+R+LNVLEFNSTRKRMSCI+KIP+ + N +P+ALL+CKGADS+IYSR
Sbjct: 828  NGVIIEIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSR 887

Query: 926  LSKN-NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDRED 984
            L ++ ND KLLE+TALHLEQ+ATEGLRTLC+AQRE+ W EY  WNE+ E+AAA+L +RE+
Sbjct: 888  LDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREE 947

Query: 985  EMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFS 1044
             +E+VAD IER+L LLGGTAIEDRLQDGVPDSI+ L +AGIKLWVLTGDKVETAINIGFS
Sbjct: 948  ALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFS 1007

Query: 1045 CNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHE 1104
            CNLL ++MELLVIK+SG+DV+  G K +++V  LI KYL+  F M GS EEL  A+K H 
Sbjct: 1008 CNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEELAAARKDHT 1067

Query: 1105 PPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLD 1164
            PP   FGV+IDGDALKLAL  +D++R+FLLLCK CKAVLCCRVSP+QKAAVVKLVK +LD
Sbjct: 1068 PPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESLD 1127

Query: 1165 VMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWSYK 1224
            V+TLAIGDGSNDVAMIQ+AD+G+GIAGEEGRQAVMS+DYAIGQFRYLTRLVLVHGRWSYK
Sbjct: 1128 VVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLVLVHGRWSYK 1187

Query: 1225 RMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILDQ 1284
            R+AEMIP FFYKN+ FTL+LFW+G+ +NYDGSYLFEYTYL  +NLAFTSLPVIFLGI+DQ
Sbjct: 1188 RLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLPVIFLGIMDQ 1247

Query: 1285 DVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQNG 1344
            D +D++S+VVPQLY+VGILR+EW Q KFW Y FD +YQS+ICFF PYLCYY+TG++T+N 
Sbjct: 1248 DASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQSIICFFFPYLCYYRTGLITKNA 1307

Query: 1345 FGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSFTSS 1404
            +GLDHRY  GVFV +IAVVSCN YVL+HQYRWDWF++LFI LSC  +F WTG+WSS T S
Sbjct: 1308 YGLDHRYTFGVFVTSIAVVSCNLYVLIHQYRWDWFTTLFIFLSCGILFFWTGVWSSATYS 1367

Query: 1405 GEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWKRGDFDH 1464
            GEFYK+A  +Y QPVFWA++F G++FCLLPRF  D   + + P+DIDI+RECW RGDFD 
Sbjct: 1368 GEFYKTAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQKLFFPRDIDIVRECWWRGDFDM 1427

Query: 1465 YPEGYDPTDPDRPKVKNAFV---YNKDIEMAQSSTD------SIQTEEIPMDELFNSSAT 1515
            YPE YDPTDP+RP++  +        D E +++ +D      ++ +E+IPM  L + +A 
Sbjct: 1428 YPEDYDPTDPNRPRINVSHTGVDRASDDERSRTGSDLGVTRTTVISEDIPMG-LIDKTAP 1486

Query: 1516 SPRSYPHNR-HQRSSGRPSLEITRAEMRNSNQLDNRYS 1552
              R+ P        S R SLE+TR EM  ++QLD+RYS
Sbjct: 1487 HSRADPTTPLGSEDSARYSLEVTRREMLQTHQLDSRYS 1524

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 1950 bits (5052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 962/1504 (63%), Positives = 1150/1504 (76%), Gaps = 72/1504 (4%)

Query: 108  ETTGADDQRSYVNT--PIINQGNFAVDEEDEREKDRQLSSAEDSKHVKRMRWGTRRDKKG 165
            ETT ADD    +++  P  + G       D+   D      + S+ +KR+R GTRR K  
Sbjct: 57   ETTLADDTDIEISSIQPTPHLGGAKTGMFDDVALDND-DHNDSSREMKRLRMGTRRVKGH 115

Query: 166  KPAMG---RAKTLRWTKKNFHNPFADDTNLAAEGHSSDDDNDENYDKSHRQRETRTIYYN 222
            K   G   R KTL+W KKN  NPF D          S D+ +EN   ++R  + RT+Y+N
Sbjct: 116  KSQFGNMSRNKTLKWAKKNIKNPFDD---------FSRDEEEENDRSTNRADQLRTVYHN 166

Query: 223  LPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQ 282
            LPLPE++LDE+GN  + YPRNKIRTTKYTPL+FFPKN+ FQF+N ANVYFLVLII+G FQ
Sbjct: 167  LPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQ 226

Query: 283  IFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKV 342
            IFGV NPGL+ VPLIVIV++T+ KD IEDSRRTILD+EVNN  THIL+GV N NVS D V
Sbjct: 227  IFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGVVNENVSVDNV 286

Query: 343  SLWRKFKKANTRVLFRFIHLCQELFTEEGKKQRAQRKRHEMHNKIRQTQTPRNSLDSVGS 402
            SLWR+FKKAN+R+L +FI  C+E  TE+GK++R QR+R ++    R    PRNSLDS+ S
Sbjct: 287  SLWRRFKKANSRLLMQFIQWCKERMTEDGKRRRLQRQRRKLRKSTRNGHGPRNSLDSMDS 346

Query: 403  YRNS--------MESEFGGDLTERGKD-DLCLLDPSLPVLPDCKFAKDYWKSVSVGDIVR 453
            YR S        ++ +  G +   G+D D+ ++D +LP   D +FA+DYWKSV VGDIVR
Sbjct: 347  YRPSADYYNRPSLDYDNMGHIV--GEDEDVDIIDRTLPPRTDTRFARDYWKSVKVGDIVR 404

Query: 454  VHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRNSRNITRTKFK 513
            +HNNDEIPA           G CYVETKNLDGETNLKVRQ+LKCS+ I+ SR+I RT+F 
Sbjct: 405  IHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIARTRFW 464

Query: 514  VESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWAMGIVVFTGPD 573
            +ESEGPH+NLYSYQGNLKW D      +NEPV INN+LLRGCTLRNTKWAMGIVVFTG D
Sbjct: 465  IESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDD 524

Query: 574  TKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFG 633
            TKIMLNAGVTPTK SRISRELN SV +NF +LF+LCF +G+ NG+ Y     SR++FEFG
Sbjct: 525  TKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSRDFFEFG 584

Query: 634  SIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCT 693
            ++AG+ A NG VSFWVA+ILYQS+VPISLYIS+EIIKTAQA FIYGDV LYN +LDYPCT
Sbjct: 585  TVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCT 644

Query: 694  PKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDV 753
            PKSW ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDV
Sbjct: 645  PKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDV 704

Query: 754  EEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGANGETQKKCNE 813
            E EG  EKE IA+D+++M+ +L+ L  N+Q  P+ +TF+SKE VQD  G NG+ QKKC E
Sbjct: 705  EAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCE 764

Query: 814  NFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQ 873
            +FMLALALCH+VL E +  +P  ++ KAQSPDEAALV TARD+GF F+G+TK G++V+IQ
Sbjct: 765  HFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQ 824

Query: 874  GVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKN---N 930
            G+QKE+ +LN+LEFNS RKRMSCI+KIP   PN+EPRALLICKGADS+IYSRLS     N
Sbjct: 825  GIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGEN 884

Query: 931  DEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVA 990
            DE LLEKTALHLEQYATEGLRTLC+AQREL+W EY EWN +++IAAA+L +RE+++E V+
Sbjct: 885  DETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVS 944

Query: 991  DVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNN 1050
            D IER+L LLGGTAIEDRLQDGVP+SIA L EAGIKLWVLTGDKVETAINIGFSCNLLNN
Sbjct: 945  DSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNN 1004

Query: 1051 EMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNF 1110
            +MELLV+K +G+DV  YG  P E+V +LI KYL+EKF +SGS  EL+ AK  H  P G+F
Sbjct: 1005 DMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDF 1064

Query: 1111 GVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAI 1170
             V+IDGDALK+AL  DD+KR+FLLLCK CKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAI
Sbjct: 1065 AVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAI 1124

Query: 1171 GDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWSYKRMAEMI 1230
            GDGSNDVAMIQSAD+G+GIAGEEGRQAVM SDYAIGQFRYLTRL+LVHGRWSYKR++EMI
Sbjct: 1125 GDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEMI 1184

Query: 1231 PLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILDQDVNDIV 1290
            P FFYKNVIFTL+LFWYG+YNN+DGSYLFEYTYL  +NLAFTS+PVI LGILDQDVND +
Sbjct: 1185 PEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVNDTI 1244

Query: 1291 SMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQNGFGLDHR 1350
            S+VVPQLYRVGILR EWNQTKF  YMFD +YQSVICFF PYL Y + G+VT+NG GL+HR
Sbjct: 1245 SLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHR 1304

Query: 1351 YWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSFTSSGEFYKS 1410
            Y+VG+ V TIAV +CN Y+L+HQYRWDWFS  FI LSC+ +  WTGIW+S  +S + +K+
Sbjct: 1305 YYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKA 1364

Query: 1411 AAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWKRGDFDHYPEGYD 1470
               IY  P FWA+ F G+ FCLLPRF  D + + + P D+ IIRE WKRGD+DHYP GYD
Sbjct: 1365 GERIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYD 1424

Query: 1471 PTDPDRPKVKNAFVYNKDIEM-----------AQSSTDSIQTEEIPMDELFNSSATSPRS 1519
            PTDP+RPK+     + + +                S DS+ TEEIPM+ +  +  T PR 
Sbjct: 1425 PTDPNRPKISKGAKFGERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIISGTDGT-PRG 1483

Query: 1520 Y----------------PHNRHQ---------------RSSGRPSLEITRAEMRNSNQLD 1548
            +                P    Q                 + R S++ TR  M  + +LD
Sbjct: 1484 FEMSGRTPDIPQTQWESPEREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLANRELD 1543

Query: 1549 NRYS 1552
            NRYS
Sbjct: 1544 NRYS 1547

>Scas_636.16
          Length = 1554

 Score = 1949 bits (5050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 967/1521 (63%), Positives = 1147/1521 (75%), Gaps = 66/1521 (4%)

Query: 83   NQQLTFGDTGKT-SDLKNEEFEEISFETTGADDQRSYVNTPIINQGNFAVDEEDEREKDR 141
            +    F D  KT S LK +       E T  DD  S + TP++        + ++ E + 
Sbjct: 21   DDSFQFEDKDKTNSFLKGDAVTVEDVEETKYDDSSSILPTPVVG----GTAQFEDIELNS 76

Query: 142  QLSSAEDSKHVKRMRWGTRRDKKGKP-AMGRAKTLRWTKKNFHNPFADDTNLAAEGHSSD 200
            +L ++ +++ +KR+R GT+R K+       + KT++W +KN H PF        + H  D
Sbjct: 77   ELPNSSETE-MKRLRLGTKRVKRETNFDRNKTKTIKWAQKNVHIPF--------KKHDED 127

Query: 201  DDNDENYDKS-HRQRETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKN 259
             D D+N     +R  E RTIY+N+PLP+++L EDG   + YPRNKIRTTKYTPLTFFPKN
Sbjct: 128  ADVDDNETGLLNRSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKN 187

Query: 260  IAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDM 319
            +  QF N AN+YFL++II+G FQIFGV NPGLA VPLIVI++LT+ KDAIEDSRRT+LDM
Sbjct: 188  VMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIVIIILTAIKDAIEDSRRTLLDM 247

Query: 320  EVNNAPTHILKGVENVNVSNDKVSLWRKFKKANTRVLFRFIHLCQELFTEEGKKQRAQRK 379
            EVNN  THIL+G EN NV  D VS WRKFKKANT+++ +F     E FT  GK+ R QR+
Sbjct: 248  EVNNTRTHILQGPENPNVPIDNVSSWRKFKKANTKLMLKFFQFINERFTATGKEARKQRQ 307

Query: 380  RHEMH-NKIRQTQTPRNSLDSVGS-------YRNSMESEFGGDLTERGKDDLCLLDPSLP 431
                   K+ +T+ PR SLDS  S       YR S+E        E G  ++ +LDPSLP
Sbjct: 308  MKRRRAKKLGKTELPRTSLDSYQSTRMSADYYRPSLEQSNIDSTFENG--EISVLDPSLP 365

Query: 432  VLPDCKFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKV 491
             + + KFA D+WK+V VGDIVR+HNNDEIPA           G CYVETKNLDGE+NLKV
Sbjct: 366  PMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKV 425

Query: 492  RQSLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLL 551
            RQSL+C++ IRNSR+I RTKF VESEGPH+NLY YQGNLKW+D   G   NEP+ INN+L
Sbjct: 426  RQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNML 485

Query: 552  LRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFA 611
            LRGCTLRNTKWAMGIVVFTG DTK M+NAGVTPTK SRISRELN SV +NF  LF+LC  
Sbjct: 486  LRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLFILCLI 545

Query: 612  AGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKT 671
            AG+ NG YYR    SR++FEFG+IAG+   NG VSFWVA+ILYQS+VPISLYIS+EIIKT
Sbjct: 546  AGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKT 605

Query: 672  AQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING 731
            AQA+FIY DV LYNERLDYPCTPKSW+ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING
Sbjct: 606  AQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING 665

Query: 732  VSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTF 791
            VSYGRAYTEALAGLRKRQGID E+EG +E+EGIAQD+EIM+ +L+ +  NSQ  PE +TF
Sbjct: 666  VSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTF 725

Query: 792  VSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVG 851
            VSKEF QD  G NGE Q+K  ++FMLALALCH+VLVE +K+DP  ++  AQSPDE ALV 
Sbjct: 726  VSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVT 785

Query: 852  TARDMGFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRA 911
            TARDMGFSF+G+TK G++V++QG+QKE+++LN+LEFNS+RKRMSCI+K+P     +EPRA
Sbjct: 786  TARDMGFSFIGKTKQGLLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRA 845

Query: 912  LLICKGADSIIYSRLSKN---NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEW 968
            LLICKGADS+IYSRLS+    NDE LLEKTALHLEQYATEGLRTLC+ QRE+SW EYQEW
Sbjct: 846  LLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEW 905

Query: 969  NEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLW 1028
            NEK+ IAAA+L  RE+E++ VAD+IER+L LLGGTAIEDRLQDGVPDSIA L EAGIKLW
Sbjct: 906  NEKYNIAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLW 965

Query: 1029 VLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQ 1088
            VLTGDKVETAINIGFSCNLLN +MELLVIK +G+DV  +G  P EIV  L+ KYL EKF 
Sbjct: 966  VLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFN 1025

Query: 1089 MSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVS 1148
            M+GS EEL  AKK H PP G F +IIDG+ALK+AL  D +KR+FLLLCK CKAVLCCRVS
Sbjct: 1026 MTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVS 1085

Query: 1149 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQF 1208
            PAQKAAVVKLVK+TLDVMTLAIGDGSNDVAMIQSAD+GVGIAGEEGRQAVM SDYAIGQF
Sbjct: 1086 PAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQF 1145

Query: 1209 RYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFN 1268
            RY+TRLVLVHG+W YKR+AEMIP FFYKNVIFTL+LFWYGV+N++DGSYLFEYTYLT +N
Sbjct: 1146 RYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYN 1205

Query: 1269 LAFTSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFF 1328
            LAFTSLPVIFLGILDQDV+  VSM+VPQLYR GILR EWNQTKF  YMFD +YQSVIC+F
Sbjct: 1206 LAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYF 1265

Query: 1329 LPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSC 1388
             PYL Y KT I+TQNG GLDHRY+VG+ V  IAV SCN YVL+ QYRWDWF++ F  LS 
Sbjct: 1266 FPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLST 1325

Query: 1389 LCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPK 1448
            +  F WTGIWSS  +S EF+K A+ +YG P FWA+ F G LFC+LPRF  D F++   P 
Sbjct: 1326 IVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPS 1385

Query: 1449 DIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNAFVYNK----------DIEMAQSSTDS 1498
            D++IIRE W+ GDF  YP+ YDPTDP++PKV+ A  + +           +  A  S  +
Sbjct: 1386 DVEIIREMWQHGDFARYPDDYDPTDPNKPKVEKAHEWGQYKIVDESIGDAVVCASDSQGT 1445

Query: 1499 IQTEEIPM--------------------------DELFNSSATSPRSYPHNRHQRSSG-R 1531
            I TEEIPM                          D+    S  + R+    R   SS  R
Sbjct: 1446 IVTEEIPMSFLDVKKDSSNQVTREKQVSRDSLDEDDARRDSMNNARNSMQFRPSSSSRVR 1505

Query: 1532 PSLEITRAEMRNSNQLDNRYS 1552
             SL+ TR EM  SNQLD RYS
Sbjct: 1506 TSLDRTRDEMLASNQLDTRYS 1526

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 1881 bits (4873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 931/1506 (61%), Positives = 1141/1506 (75%), Gaps = 68/1506 (4%)

Query: 108  ETTGADDQRSYVNTPII---NQGNFAVDEE------DEREKDRQLSSAEDSK---HVKRM 155
            E    DD  S   TPI+   + G F  D        D+ E+  Q     +SK    +KR+
Sbjct: 57   EEDDMDDDYSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRL 116

Query: 156  RWGTRRDKKG--KPAMGRAKTLRWTKKNFHNPFADDTNLAAEGHSSDDDNDENYDKSHRQ 213
            RWGT+R +K   +  +GR+KTL+W KKN  +P  +   +  E  ++D+    N     + 
Sbjct: 117  RWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLEE--LIGNENEATDETGMRN-----KA 169

Query: 214  RETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFL 273
             E R IY+N PLP+D+LDED      YPRNKIRTTKYTPLTF PKNI  QF N AN+YFL
Sbjct: 170  DELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFL 229

Query: 274  VLIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVE 333
            +LII+G FQIFGV NPG + VPLIVI+++T+ KD IEDSRRT+LD+EVNN  TH+L G+E
Sbjct: 230  ILIILGAFQIFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLTGIE 289

Query: 334  NVNVSNDKVSLWRKFKKANTRVLFRFIHLCQELFTEEGKKQRAQRKRHEMHNKIRQTQTP 393
            N NVS D +SLWR+FKKAN+R++  F+ +C+E  T++G+ ++AQRKR   ++K    +  
Sbjct: 290  NYNVSADDISLWRRFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKF 349

Query: 394  RNSLDSVGS------YRNSMESEFGGDLTERGKDDLCLLDPSLPVLPDCKFAKDYWKSVS 447
            RNSL+S  S       R SM+     D+    +++  L++ +LP   + +F+KDYWK+V 
Sbjct: 350  RNSLNSYRSNRMSRDVRPSMDFRPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVK 409

Query: 448  VGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRNSRNI 507
            VGDIVR+HNN+EIPA           GACYVETKNLDGETNLKVRQS+KC+  IR+S +I
Sbjct: 410  VGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDI 469

Query: 508  TRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWAMGIV 567
             RT+F +ESEGPH+NLYSYQGN +W   E    KNEPVNINNLLLRGCTLRNTKWAMG+V
Sbjct: 470  ARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVV 529

Query: 568  VFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTDNTSR 627
             FTG DTKIMLNAGVTPTK SRIS+ELNLSV  NFALLFVLCF AG+ NG+Y+     SR
Sbjct: 530  AFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSR 589

Query: 628  NYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVALYNER 687
            ++F+FG+  G +A +G VSFWVA+ILYQS+VPISLYIS+EIIKTAQA+FIY DV +YNE+
Sbjct: 590  DFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEK 649

Query: 688  LDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK 747
            LDYPCTPKSW ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK
Sbjct: 650  LDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK 709

Query: 748  RQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGANGET 807
            RQG+DV  E  +EKEGI +D+E M+  L+ L +NSQ   + VTFVSKEFV D  G +G  
Sbjct: 710  RQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSV 769

Query: 808  QKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNG 867
            Q+K  ++FMLALALCH+VL E +K+DP  ++ KAQSPDEAALV TARDMGFSF+ +TK G
Sbjct: 770  QQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEG 829

Query: 868  VIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLS 927
            +++++QG++KE+++LN+LEFNS+RKRMSCI+KIP ++ N +P+ALLICKGADS+IYSRL 
Sbjct: 830  MVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLD 889

Query: 928  KN--NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDE 985
            K   N+E LLEKTALHLEQYATEGLRTLC+AQRELSW+EY+ WN+K++IAAAA+VDRE+E
Sbjct: 890  KTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEE 949

Query: 986  MEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSC 1045
            +EKV+D IER L LLGGTAIEDRLQDGVPDSIA LGEAGIKLWVLTGDKVETAINIGFSC
Sbjct: 950  LEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSC 1009

Query: 1046 NLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEP 1105
            NLLNN+MELLVIK +G DV+  G+ P +IV  LI +YL +KF M+GS EEL++AK  H+ 
Sbjct: 1010 NLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDI 1069

Query: 1106 PTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDV 1165
            P G F VIIDG+ALK AL  +D+KR+FLLLCK CK+VLCCRVSPAQKAAVVKLVKNTLDV
Sbjct: 1070 PRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDV 1129

Query: 1166 MTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWSYKR 1225
            MTLAIGDGSNDVAMIQSA+IGVGIAGEEGRQAVMSSDYAIGQFRYLTRL+LVHG+W YKR
Sbjct: 1130 MTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKR 1189

Query: 1226 MAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILDQD 1285
            +AEMIP FFYKN+IFTL+LFW+G+YN+YDGSYLFEYTYLT +NLAFTS+PVI LGI DQD
Sbjct: 1190 LAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQD 1249

Query: 1286 VNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQNGF 1345
            V+D +S+V PQLYRVGILR EW+QTKF  YM D +YQSVI FF PYL Y +  IVT NG 
Sbjct: 1250 VSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGL 1309

Query: 1346 GLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSFTSSG 1405
            GLDHRY+VGV V  IA +SCN Y+L+ Q  WD F S F+ +S +  F WTGIWSS + S 
Sbjct: 1310 GLDHRYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSN 1369

Query: 1406 EFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWKRGDFDHY 1465
            EFY  AA ++G P FWA++F GI+FCLLPRF  D F R + PKDIDIIRE W RGDFD +
Sbjct: 1370 EFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSF 1429

Query: 1466 PEGYDPTDPDRPKVKNAFV----------YNKDIEMAQSSTDSIQTEEIPM--------- 1506
            P+ YDPTDP+  K+  + +          +N +   + SS++ I +EEIP+         
Sbjct: 1430 PKKYDPTDPEVHKIAMSDIRVFSGAESKEFNSNSNTSSSSSEDILSEEIPLELGKGMNDS 1489

Query: 1507 -----------DELF------NSSATSPRSYPHNR---HQRSSGRPSLEITRAEMRNSNQ 1546
                       DE+       +S+  +  +    R   + R+S R SL+ TR +M  +NQ
Sbjct: 1490 GKKSEYESGVGDEILKYYLGKDSNRNTILTDNQKRLSTYSRASNRTSLDRTREDMLATNQ 1549

Query: 1547 LDNRYS 1552
            LD R+S
Sbjct: 1550 LDTRFS 1555

>Kwal_26.7070
          Length = 1315

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1088 (36%), Positives = 597/1088 (54%), Gaps = 92/1088 (8%)

Query: 392  TPRNSLDSVGSYR----NSMESEFGGDLTERGKDDLCLLDPSLPVLPDC--KFAKDYWKS 445
            TP N   ++G+       S   E   DL +R + D  L D    V  +    F    W +
Sbjct: 242  TPTNRYTTIGTLLIVLIVSAIKEIVEDL-KRAQSDSELNDSRAQVFSEQLQDFTLSKWVN 300

Query: 446  VSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRNSR 505
            +SVGDI++V++ + IPA           G CY+ET NLDGETNLK++Q+   +    +  
Sbjct: 301  ISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKD 360

Query: 506  NITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWAMG 565
            ++   + KV SE P+S+LY+Y+G +    +   L   +      ++LRG TLRNT W  G
Sbjct: 361  DLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQ------MVLRGATLRNTAWIYG 414

Query: 566  IVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTDNT 625
            +VVFTG +TK+M NA  TP K + + R +N+ +   F +L VL   + I N +   +D  
Sbjct: 415  LVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAE 474

Query: 626  SRNYFEF-GSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVALY 684
               Y    G+         ++++W   IL+ ++VPISL++++E+IK  QA  I  D+ LY
Sbjct: 475  HLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAYMIASDLDLY 531

Query: 685  NERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAG 744
            +E  D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK C+I G    + Y E +  
Sbjct: 532  DEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAG----KCYIETIP- 586

Query: 745  LRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGAN 804
                     E++ A  ++GI                        + F   + +++T    
Sbjct: 587  ---------EDKAATTEDGI-----------------------EIGFRKFDSMKETLNDT 614

Query: 805  GETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRT 864
             +       +F+  LA CHTV+ E  +D    + ++A SPDE ALV  A  +G+ F+ R 
Sbjct: 615  QDPDSHIINDFLTLLATCHTVIPEFQEDGS--IKYQAASPDEGALVEGAASLGYKFIIRK 672

Query: 865  KNGVIVDIQ--GVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSII 922
             N V V I+  G ++EY+LLN+ EFNSTRKRMS I ++P    N E +  L CKGAD++I
Sbjct: 673  PNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP----NGEIK--LFCKGADTVI 726

Query: 923  YSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDR 982
              RL K  +   +E T  HLE YA EGLRTLC+A R ++  EY EW + ++ A+  L DR
Sbjct: 727  LERL-KAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDR 785

Query: 983  EDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIG 1042
              +++  A++IE++L LLG TAIED+LQDGVP++I TL +AGIK+WVLTGD+ ETA+NIG
Sbjct: 786  AQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIG 845

Query: 1043 FSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKV 1102
             SC LL+ +M LL+I               E  K    K L EK +    ++       +
Sbjct: 846  MSCRLLSEDMNLLIIN--------------EEDKEATRKNLTEKLKAISDHQ-------I 884

Query: 1103 HEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNT 1162
             +    +  ++IDG +L  AL  D ++   L + K CKAV+CCRVSP QKA VVK+VK  
Sbjct: 885  SQQDMNSLALVIDGKSLGFALEAD-LEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRK 943

Query: 1163 LDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWS 1222
             D + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D+AI QF+YL +L+LVHG WS
Sbjct: 944  TDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWS 1003

Query: 1223 YKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGIL 1282
            Y+R+++ I   FYKN+   ++ FWY   N Y G  + E   +T +N+ FT LP   +G+ 
Sbjct: 1004 YQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVF 1063

Query: 1283 DQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQ 1342
            DQ V+  +    PQLY++G     ++   FW ++ +  Y S + F    L Y    ++  
Sbjct: 1064 DQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNS 1123

Query: 1343 NGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSF- 1401
            +G   DH  W GV + T +V+       L   +W  F++  I  S +    +  I++S  
Sbjct: 1124 HGETADHWAW-GVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASIL 1182

Query: 1402 ---TSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWK 1458
                 S E+Y   +H+YG   FW +      F L+       + RTY P+   +++E  K
Sbjct: 1183 PHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQK 1242

Query: 1459 RGDFDHYP 1466
                D+ P
Sbjct: 1243 YNIGDYRP 1250

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 68/150 (45%), Gaps = 15/150 (10%)

Query: 195 EGHSSDD-DNDENYDKSHRQRETRTIYYNLPL------------PEDIL--DEDGNSTIY 239
           E H+ DD  ND+ Y KS  + + + I+    L            P  I   D++ N    
Sbjct: 137 EMHNYDDLGNDDRYAKSRNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYINDKEANRARG 196

Query: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299
           +  N I TTKY   TF PK +  +F   AN++FL    +         N       L+++
Sbjct: 197 FGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIV 256

Query: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHIL 329
           +++++ K+ +ED +R   D E+N++   + 
Sbjct: 257 LIVSAIKEIVEDLKRAQSDSELNDSRAQVF 286

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1037 (37%), Positives = 580/1037 (55%), Gaps = 86/1037 (8%)

Query: 437  KFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLK 496
            +F +  W  ++VGDI+RV + + IPA           G CY+ET NLDGETNLK++Q+ +
Sbjct: 297  EFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQ 356

Query: 497  CSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCT 556
             +    + + + +   +V+SE P+S+LY+Y+G +      T      P++ + +LLRG T
Sbjct: 357  ETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTM------TLNGSTFPLSPDQMLLRGAT 410

Query: 557  LRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVN 616
            LRNT W  G++VFTG +TK+M NA  TP K + + R +N+ +   F +L VL   +   N
Sbjct: 411  LRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGN 470

Query: 617  GVYYRTDNTSRNYFEF-GSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQAL 675
             +  + D+    Y    G+         +++FW   IL+ ++VPISL++++E+IK  QA 
Sbjct: 471  VIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILFSNLVPISLFVTVEMIKYYQAY 527

Query: 676  FIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 735
             I  D+ LY+E  D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK  +I G    
Sbjct: 528  MIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAG---- 583

Query: 736  RAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKE 795
            R Y E +           E+  A  ++GI    EI   + + L ++    PE+       
Sbjct: 584  RCYIETIP----------EDRRATVEDGI----EIGFHSFESL-KDKMTDPED------- 621

Query: 796  FVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARD 855
               D AG   E        F+  LA CHTV+ E   D    + ++A SPDE ALV  A D
Sbjct: 622  ---DEAGIVIE--------FLTLLATCHTVIPETQSDG--TIKYQAASPDEGALVQGAAD 668

Query: 856  MGFSFVGRTKNGVIVDIQ-GVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLI 914
            +GF F  R  N V +      Q EY+LLN+ EFNSTRKRMS I ++P  +        L 
Sbjct: 669  LGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK------LF 722

Query: 915  CKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEI 974
            CKGAD++I  RL    +   ++ T  HLE YA EGLRTLCIA R +  KEY+EW++ +E 
Sbjct: 723  CKGADTVILERLDSEFN-PYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEA 781

Query: 975  AAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDK 1034
            A+  + DR +E+++ A++IE +L  LG TAIED+LQ+GVP++I  L EAG+K+WVLTGD+
Sbjct: 782  ASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDR 841

Query: 1035 VETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYE 1094
             ETAINIG SC LL+ +M LL++               E  K      LQ K        
Sbjct: 842  QETAINIGMSCRLLSEDMNLLIVN--------------EETKEDTRTNLQSKLNAI---- 883

Query: 1095 ELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAA 1154
               E+ ++ +    +  ++IDG +L  AL  +D++ +FL + K CKAV+CCRVSP QKA 
Sbjct: 884  ---ESHQISQQDMNSLALVIDGKSLGYALE-EDLEDQFLTIGKLCKAVICCRVSPLQKAL 939

Query: 1155 VVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRL 1214
            VVK+VK     + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D+AIGQFR+L +L
Sbjct: 940  VVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKL 999

Query: 1215 VLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSL 1274
            ++VHG WSY+R++  I   FYKN+   ++ FWY   N + G  + E   LT +N+ FT +
Sbjct: 1000 LIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVM 1059

Query: 1275 PVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCY 1334
            P   +GI DQ V   +    PQLY++G     ++ T FW ++ +  Y S + F    L Y
Sbjct: 1060 PPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFY 1119

Query: 1335 YKTGIVTQNGFGLDHRYW-VGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSC---LC 1390
                 +   G   DH  W VG++  +I +V     ++  Q  W  F+ + I  S    L 
Sbjct: 1120 RYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ--WTKFTLVAIPGSLVIWLL 1177

Query: 1391 IFA-WTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKD 1449
             F  ++ ++     S E+Y    H+YG   FW +     +F LL  F    + RTY P+ 
Sbjct: 1178 FFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYSPES 1237

Query: 1450 IDIIRECWKRGDFDHYP 1466
              +++E  K    D+ P
Sbjct: 1238 YHVVQEMQKYNISDYRP 1254

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 69/148 (46%), Gaps = 13/148 (8%)

Query: 195 EGHSSDDDNDENYDKSHRQRETRTIYYNLPL-----------PEDIL--DEDGNSTIYYP 241
           E +  D  N   Y+ S R+ + + ++    L           P  IL  D   NS   Y 
Sbjct: 144 EMNDYDQSNTNRYESSTRKFDIKVLFNRYILRKGKTSCKSDEPRTILLNDSSANSRFGYR 203

Query: 242 RNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVV 301
            N I TTKY   TF PK +  +F   AN++FL   I+         N       L+V+++
Sbjct: 204 DNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVVLI 263

Query: 302 LTSFKDAIEDSRRTILDMEVNNAPTHIL 329
           +++ K+++ED +R+  D E+N++   +L
Sbjct: 264 VSAVKESVEDLKRSNADKELNHSLCDVL 291

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1039 (37%), Positives = 579/1039 (55%), Gaps = 91/1039 (8%)

Query: 438  FAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKC 497
            F +  W  + VGDI+RV++ + IPA           G CY+ET NLDGETNLK++Q+   
Sbjct: 277  FIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTE 336

Query: 498  SHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTL 557
            +  I +SR +   K  + SE P+S+LY+Y+G L+    +       P++   ++LRG TL
Sbjct: 337  TAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKI------PLSPEQMILRGATL 390

Query: 558  RNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNG 617
            RNT W  GIV+FTG +TK+M NA  TP K + + + +N+ +   F +L VL   + I N 
Sbjct: 391  RNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNV 450

Query: 618  VYYRTDNTSRNYFEF-GSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALF 676
            +    D    +Y    G+          ++FW   IL+ ++VPISL++++E+IK  QA  
Sbjct: 451  IMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 507

Query: 677  IYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 736
            I  D+ LY E  D P   K+ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G    R
Sbjct: 508  IGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAG----R 563

Query: 737  AYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEF 796
             Y E +           E++ A  ++GI                        V + S + 
Sbjct: 564  CYAEHIP----------EDKAATFEDGI-----------------------EVGYRSFDD 590

Query: 797  VQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDM 856
            ++     N +  K  +E F+  LA CHTV+ E   D    + ++A SPDE ALV     +
Sbjct: 591  LKKQLTTNSDDCKIIDE-FLTLLATCHTVIPEFQADGS--IKYQAASPDEGALVEGGALL 647

Query: 857  GFSFVGRTKNGVIVDI-QGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLIC 915
            G+ F+ R  N V + I +  ++EY+LLN+ EFNSTRKRMS I + P ++        L+C
Sbjct: 648  GYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK------LLC 701

Query: 916  KGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIA 975
            KGADS+I  RLS+  +   ++ T  HLE YATEGLRTLC+A +++   EY  WN+K+  A
Sbjct: 702  KGADSVILERLSETGN-FYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDA 760

Query: 976  AAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKV 1035
            A  L  R ++++ VA+ IE  LTL+G TAIED+LQ+GVPD+I TL EAGIK+WVLTGDK 
Sbjct: 761  ATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQ 820

Query: 1036 ETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEE 1095
            ETAINIG SC LL+ +M LL+I              +E  K    + ++EK  ++  +E 
Sbjct: 821  ETAINIGMSCRLLSEDMNLLII--------------SEETKEATRRNMEEK--LAALHEH 864

Query: 1096 LEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAV 1155
                  + E       ++IDG +L  AL  D ++  FL + K CKAV+CCRVSP QKA V
Sbjct: 865  -----SLSEHDMNTLALVIDGHSLSFALEAD-LEDYFLAIGKMCKAVICCRVSPLQKALV 918

Query: 1156 VKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLV 1215
            VK+VK   + + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D ++GQFR+L +L+
Sbjct: 919  VKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLL 978

Query: 1216 LVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLP 1275
            LVHG WSY+R++  I   FYKN    ++ FWY   N + G  + E   ++L+N+ FT LP
Sbjct: 979  LVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLP 1038

Query: 1276 VIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYY 1335
               +G+ DQ VN  +    PQLY++G     ++ + FW ++ +  Y S + F    L Y 
Sbjct: 1039 PFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYR 1098

Query: 1336 KTGIVTQNGFGLDHRYW-VGVFVATIAVVSCNTYVLLHQYRWDWFS------SLFIALSC 1388
                + ++G   DH  W + ++ +++ +V     ++ +Q  W  F+      SLF  L  
Sbjct: 1099 YGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQ--WTKFTLFAIPGSLFFWLIF 1156

Query: 1389 LCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPK 1448
              I+    I+     S E++    H YG   FW  +     F L   F    + R Y P+
Sbjct: 1157 FPIYG--SIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPE 1214

Query: 1449 DIDIIRECWKRGDFDHYPE 1467
               +I+E  K    D+ P 
Sbjct: 1215 SYHLIQEMQKYNVSDYRPH 1233

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 67/144 (46%), Gaps = 14/144 (9%)

Query: 199 SDDDNDENYDKSHRQRETRTIY--YNL------------PLPEDILDEDGNSTIYYPRNK 244
           S  + D+N+ KS  + + + ++  Y L            P    I D + N+   Y  N 
Sbjct: 126 STGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPREIHISDRESNNRFGYIDNH 185

Query: 245 IRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTS 304
           I TTKY   TF PK +  +F   AN++FL    +         N       L+V++++++
Sbjct: 186 ISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVVLIVSA 245

Query: 305 FKDAIEDSRRTILDMEVNNAPTHI 328
            K+++ED +R   D E+NN+   I
Sbjct: 246 IKESVEDLKRASSDNELNNSKAEI 269

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/1038 (37%), Positives = 568/1038 (54%), Gaps = 87/1038 (8%)

Query: 438  FAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKC 497
            F +  W  + VGDI+RV + + IPA           G CY+ET NLDGETNLK++QS   
Sbjct: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353

Query: 498  SHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTL 557
            +    + + +     KV SE P+S+LY+Y+G +   DR+       P++ + ++LRG TL
Sbjct: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQI------PLSPDQMILRGATL 407

Query: 558  RNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNG 617
            RNT W  G+V+FTG +TK++ NA  TP K + + + +N  +   F +L VL   + I N 
Sbjct: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNV 467

Query: 618  VYYRTDNTSRNYFEF-GSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALF 676
            +    D    +Y    G+          ++FW   IL+ ++VPISL++++E+IK  QA  
Sbjct: 468  IMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524

Query: 677  IYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 736
            I  D+ LY E+ D P   ++ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G     
Sbjct: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAG----H 580

Query: 737  AYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEF 796
             Y + +           E++ A  ++GI                        V +   + 
Sbjct: 581  CYIDKIP----------EDKTATVEDGI-----------------------EVGYRKFDD 607

Query: 797  VQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDM 856
            ++       +       +F+  LA CHTV+ E   D    + ++A SPDE ALV    D+
Sbjct: 608  LKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGS--IKYQAASPDEGALVQGGADL 665

Query: 857  GFSFVGRTKNGVIVDIQ--GVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLI 914
            G+ F+ R  N V V ++  G +KEY+LLN+ EFNSTRKRMS I + P      +    L 
Sbjct: 666  GYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFP------DGSIKLF 719

Query: 915  CKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEI 974
            CKGAD++I  RL    ++  +E T  HLE YA+EGLRTLC+A R++S  EY+EWN  +  
Sbjct: 720  CKGADTVILERLDDEANQ-YVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNE 778

Query: 975  AAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDK 1034
            AA  L +R +++++ A++IE+ L L+G TAIED+LQDGVP++I TL EAGIK+WVLTGD+
Sbjct: 779  AATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDR 838

Query: 1035 VETAINIGFSCNLLNNEMELLVI-KASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSY 1093
             ETAINIG SC LL+ +M LL+I + + DD +          +NL+     EK       
Sbjct: 839  QETAINIGMSCRLLSEDMNLLIINEETRDDTE----------RNLL-----EKINALN-- 881

Query: 1094 EELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKA 1153
               E     H+    +  ++IDG +L  AL   +++   L + K CKAV+CCRVSP QKA
Sbjct: 882  ---EHQLSTHD--MKSLALVIDGKSLGFALE-PELEDYLLTVAKLCKAVICCRVSPLQKA 935

Query: 1154 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTR 1213
             VVK+VK     + LAI  G+NDV+MIQ+A +GVGI+G EG QA  S+D A+GQF++L +
Sbjct: 936  LVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKK 995

Query: 1214 LVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTS 1273
            L+LVHG WSY+R++  I   FYKN    ++ FWY   N + G  + E   ++ +NL FT 
Sbjct: 996  LLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTV 1055

Query: 1274 LPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLC 1333
             P   +G+ DQ V+  +    PQLY++G     ++   FW ++ +  + S I F    L 
Sbjct: 1056 WPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILI 1115

Query: 1334 YYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFA 1393
            Y     +  +G   DH  W GV V T +V+       L   +W  F+ + I  S L    
Sbjct: 1116 YRYGFALNMHGELADHWSW-GVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLI 1174

Query: 1394 WTGIWSSF----TSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKD 1449
            +  I++S       S E+Y    H YG  VFW  +    +F L+  F    + R Y P+ 
Sbjct: 1175 FFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPET 1234

Query: 1450 IDIIRECWKRGDFDHYPE 1467
              +I+E  K    D  P 
Sbjct: 1235 YHVIQEMQKYNISDSRPH 1252

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 14/145 (9%)

Query: 199 SDDDNDENYDKSHRQRETRTIYYNLPLPEDILDEDGN--------------STIYYPRNK 244
           ++++ D+NY  S  +   + ++    L +++ D +GN              S+  Y  N 
Sbjct: 143 TNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSLANSSFGYSDNH 202

Query: 245 IRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTS 304
           I TTKY   TF PK +  +F   AN++FL    +         N       L+V++++++
Sbjct: 203 ISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVSA 262

Query: 305 FKDAIEDSRRTILDMEVNNAPTHIL 329
            K+ IED +R   D E+NN+   I 
Sbjct: 263 MKECIEDIKRANSDKELNNSTAEIF 287

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1120 (35%), Positives = 593/1120 (52%), Gaps = 125/1120 (11%)

Query: 437  KFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLK 496
            +F    W  ++VGDI+RV + + IPA           G CY+ET NLDGETNLK++Q+  
Sbjct: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348

Query: 497  CSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNE-PVNINNLLLRGC 555
             +  I + R ++  + K+ SE P+++LY+Y+G +        L  N  P++ + +LLRG 
Sbjct: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMI-------LHNNRIPLSPDQILLRGA 401

Query: 556  TLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIV 615
            TLRNT W  GIV+FTG +TK+  NA  TP K + + R +NL +   F +L  L   +   
Sbjct: 402  TLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFG 461

Query: 616  NGV--YYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQ 673
            N +  Y + +N S  Y +  ++      N +++FW   IL+ ++VPISL++++E+IK  Q
Sbjct: 462  NLIVMYNQKENLSYLYLQGTNMVALFFKN-ILTFW---ILFSNLVPISLFVTVEMIKYYQ 517

Query: 674  ALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVS 733
            A  I  D+ L++E  + P   ++ ++ ++LGQIEYIFSDKTGTLTQNVMEFK C+I G  
Sbjct: 518  AYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG-- 575

Query: 734  YGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVS 793
              R Y +++           E++ A   EGI                        V + +
Sbjct: 576  --RCYIQSIP----------EDKDAAFDEGI-----------------------EVGYRT 600

Query: 794  KEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTA 853
             + + +     G       + F+  L++CHTV+ E  ++    + ++A SPDE ALV  A
Sbjct: 601  YDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGS--IKYQAASPDEGALVQGA 658

Query: 854  RDMGFSFVGRTKNGVIVDIQGVQKE--YRLLNVLEFNSTRKRMSCILKIPSENPNEEPRA 911
             D+G+ F+ R  N V +  + + +E  Y LLN+ EFNSTRKRMS I + P  +       
Sbjct: 659  ADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIR----- 713

Query: 912  LLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEK 971
             L+CKGAD++I  RL+  ++   +  T  HLE YA EGLRTLCIA R +   EY+EW++ 
Sbjct: 714  -LLCKGADTVILERLAATSN-PYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKL 771

Query: 972  HEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLT 1031
            ++ AA  + +R +E++KVA++IE+ L LLG TAIED+LQDGVP++I TL +AGIK+WVLT
Sbjct: 772  YDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLT 831

Query: 1032 GDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSG 1091
            GD+ ETAINIG SC LL+ +M LL++               E  K      L +K +   
Sbjct: 832  GDRQETAINIGMSCKLLSEDMNLLIVN--------------EDTKESTRNNLIDKLRAIN 877

Query: 1092 SYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLL-LCKRCKAVLCCRVSPA 1150
             ++       + +       ++IDG +L  AL  D    EFLL + K C+AV+CCRVSP 
Sbjct: 878  DHQ-------ISQQDMNTLALVIDGKSLGFALEPD--LEEFLLAIGKMCRAVICCRVSPL 928

Query: 1151 QKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRY 1210
            QKA VVK+VK     + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D+A+GQF+Y
Sbjct: 929  QKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFKY 988

Query: 1211 LTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLA 1270
            L +L+LVHG WSY+R+++ I   FYKN+   ++ FWY +YN + G  + E   LT +N  
Sbjct: 989  LKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTFYNWG 1048

Query: 1271 FTSLP---------VIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMY 1321
             T+ P             G+L++D          Q   VG     W  T F     +  Y
Sbjct: 1049 GTAAPPGPPKRRDQFERSGLLNRDA---------QSCTVGQKGQFWPATIFRGSAINGNY 1099

Query: 1322 QSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSS 1381
             + I      + Y        +G   DH  W GV +   +++       L   +W  F+ 
Sbjct: 1100 HNWITIDGWIMDYRYGAAGAMHGETADHWVW-GVAIQPTSIIFVLGKAALITNQWTKFTV 1158

Query: 1382 LFIALSCLCIFAWTGIWS----SFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFA 1437
            L I  S +    +  I++        S E+Y   +H+YG   FWA+ +   +  LL    
Sbjct: 1159 LAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVLPVLALLRDLL 1218

Query: 1438 ADTFLRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNAFVYNKDIEMAQSSTD 1497
               + RTY P+   +++E  K          YD +D +RP+++      + +   Q    
Sbjct: 1219 WKYYKRTYTPESYHVVQEMQK----------YDISD-NRPRIEQFQKAIRKVRQVQRMKK 1267

Query: 1498 S-----IQTEEIPMDELFNSSATSPRSYPHNRHQRSSGRP 1532
                   Q+EE   D +     T+ +   H   Q  S  P
Sbjct: 1268 QRGFAFSQSEEAGQDRIVRMYDTTQKRGTHGELQDPSMNP 1307

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 55/110 (50%), Gaps = 8/110 (7%)

Query: 215 ETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLV 274
           E R IY N        +   N  + Y  N I TTKY   TF PK +  +F   AN++FL 
Sbjct: 177 EPRVIYIN--------ERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLF 228

Query: 275 LIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNA 324
             I+         N       LIV++V+++ K+++ED +R+  D E+N++
Sbjct: 229 TSIIQQVPNVTPTNRFTTIGTLIVVLVVSAIKESVEDLKRSNSDKELNHS 278

>Kwal_56.23467
          Length = 280

 Score =  334 bits (856), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 155/263 (58%), Positives = 190/263 (72%), Gaps = 18/263 (6%)

Query: 1303 LRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAV 1362
            +RSEWN TKFWLYM D +YQSVI FF P+L YYKTG+V+ NG GLDHRYWVG+ V +IA 
Sbjct: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60

Query: 1363 VSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWA 1422
            VSCN Y+L+HQ+RWDWFS+LFIALSCL ++ WTGIWS+FT+SGEFYKSAAH+YG P++WA
Sbjct: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120

Query: 1423 IMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNA 1482
            I F G+LFCLLPRF  D F + + PKDIDIIRE W +G FD YPE YDPTDP+RP++  A
Sbjct: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180

Query: 1483 -------FV-----YNKDIEMA-QSSTDSIQTEEIPMDELFNSSATSPRSYPHNRHQRSS 1529
                   +V     Y   I  A   S D++ TEEIPM     +   +P  +    H RS+
Sbjct: 181  DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPM-TFMEADDNNPEPF----HPRSN 235

Query: 1530 GRPSLEITRAEMRNSNQLDNRYS 1552
             R SL+ TR +MR SN+LD RYS
Sbjct: 236  IRTSLDRTRMQMRASNELDGRYS 258

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  332 bits (852), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 252/894 (28%), Positives = 438/894 (48%), Gaps = 132/894 (14%)

Query: 444  KSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRN 503
            K + VGD+++VH  D IPA           G  +++T  LDGET+ K+R  + C      
Sbjct: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACPLTQNL 325

Query: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563
            S N    +  + +  P  +++ + G + + D  +      P++++N L     L ++ + 
Sbjct: 326  SENDLINRISITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFC 380

Query: 564  MGIVVFTGPDTKIMLNAGVTPTKVSRISRELN----LSVFMNFALLFVLCFAAGIVNGVY 619
            +  VV+TG DT+  +N      K   +  E+N    +     FAL  +L   AG  N  +
Sbjct: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDW 440

Query: 620  YRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYG 679
            Y                        +     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 441  Y------------------------IDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 476

Query: 680  DVALYNERLDYPCT-PKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 738
            D  +       P T  ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY    
Sbjct: 477  DKTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY---- 525

Query: 739  TEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQ 798
                      + +D+  +     + +   K   L N K+    ++   ++++F  ++ + 
Sbjct: 526  --------TSETLDIVSDYV---QSLVSSKNDSLNNSKVALSTTR---KDMSFRVRDMI- 570

Query: 799  DTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGF 858
                              L LA+CH V      D+   + ++A SPDE A+V     +G 
Sbjct: 571  ------------------LTLAICHNVTPTFEDDE---LTYQAASPDEIAIVKFTESVGL 609

Query: 859  SFVGRTKNGV--IVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICK 916
            S   R ++ +  + +  G    Y +L V  FNS  KRM  I++   E  +E      + K
Sbjct: 610  SLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVR--DEQLDE---YWFMQK 664

Query: 917  GADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAA 976
            GAD+++ S++ ++ND  L E+T       A EGLRTL I +++L+ K Y+++ +++  A+
Sbjct: 665  GADTVM-SKIVESNDW-LEEETG----NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDAS 718

Query: 977  AALVDREDEMEKV-ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKV 1035
             ++++R+ +M +V    +E +L LLG T +ED+LQ  V  SI  L  AGIK+W+LTGDKV
Sbjct: 719  LSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 778

Query: 1036 ETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEE 1095
            ETA  +  S  L++    +  I           ++P                   G++ +
Sbjct: 779  ETARCVSISAKLISRGQYVHTITKV--------TRP------------------EGAFNQ 812

Query: 1096 LEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAV 1155
            LE  K        N  ++IDG++L + L++   ++EF  +      V+ CR +P QKA V
Sbjct: 813  LEYLK-----INRNACLLIDGESLGMFLKH--YEQEFFDVVVHLPTVIACRCTPQQKADV 865

Query: 1156 VKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLV 1215
              +++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++D++I QF +LT L+
Sbjct: 866  ALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELL 925

Query: 1216 LVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLP 1275
            L HGR SYKR A++     ++ +I  +    Y + + ++   L++   +  +   +T  P
Sbjct: 926  LWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAP 985

Query: 1276 VIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQ-SVICFF 1328
            V  L  LD D+ + ++ + P+LY+        +   F++++  +++Q SVI  F
Sbjct: 986  VFSLT-LDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLF 1038

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%)

Query: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299
           Y  N++   KY  +TF P  +  QFK   N+YFLV+ +        +       VPL  +
Sbjct: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229

Query: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHIL 329
           + +T  K+AI+D +R   D E NN   H++
Sbjct: 230 LTVTMAKEAIDDIQRRRRDRESNNELYHVI 259

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  329 bits (844), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 253/893 (28%), Positives = 434/893 (48%), Gaps = 138/893 (15%)

Query: 444  KSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRN 503
            K + VGD++++     +PA           G  +++T  LDGET+ K+R  + C+     
Sbjct: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNL 319

Query: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563
            + +    K  + +  P  +++S+ G + + D  T       + I+N L     L ++ + 
Sbjct: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTS-----GLTIDNTLWANTVLASSGFC 374

Query: 564  MGIVVFTGPDTKIMLNA-------GVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVN 616
            +G V++TG DT+  +N        G+   +++ IS+ L   VF+   LL V    AG+ N
Sbjct: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVF---AGLHN 431

Query: 617  GVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALF 676
              +Y                        V     LIL+ +++P+SL +++++ K+  A  
Sbjct: 432  DDWY------------------------VDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQ 467

Query: 677  IYGDVALYNERLDYPCT-PKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 735
            I  D  +       P T  ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY 
Sbjct: 468  IEHDKTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYT 520

Query: 736  RAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKE 795
                + ++                  +G+ + K   + NL   G  S  R +  T V   
Sbjct: 521  TETADIVSDY---------------IQGMIESKNDSVTNL---GPRSTTRKDAATHVI-- 560

Query: 796  FVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARD 855
                              + +  LA+CH V      D+   + ++A SPDE A+V     
Sbjct: 561  ------------------DLITTLAICHNVTPTFEDDE---LTYQAASPDEIAIVKFTES 599

Query: 856  MGFSFVGRTKNG--VIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALL 913
            +G S   R ++   ++ +  G    Y +L +  FNS  KRM  I+        ++ +   
Sbjct: 600  VGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWF 654

Query: 914  ICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHE 973
            + KGAD+++ +R+  NND  L E+T       A EGLRTL I +++L+ K Y+++ +++E
Sbjct: 655  LQKGADTVM-NRIVANNDW-LEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYE 708

Query: 974  IAAAALVDREDEMEK-VADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTG 1032
              +A++ +RE EM   ++  +E +L LLG T +ED+LQ  V  SI  L  AGIK+W+LTG
Sbjct: 709  EVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTG 768

Query: 1033 DKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGS 1092
            DKVETA  +  S  L++    + V+           SKP                   G+
Sbjct: 769  DKVETARCVSISAKLISRGQYVHVVTKL--------SKP------------------EGA 802

Query: 1093 YEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQK 1152
            + +LE  K        N  ++IDG++L + L+    ++EF  +      V+ CR +P QK
Sbjct: 803  FNQLEYLK-----VNKNACLLIDGESLGMFLKY--YRQEFFDVVVHLPTVIACRCTPQQK 855

Query: 1153 AAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLT 1212
            A V  +++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++D++I QF +LT
Sbjct: 856  ADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLT 915

Query: 1213 RLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFT 1272
             L+L HGR SYKR A++     ++ +I  +    + V + ++   L++   +  +   +T
Sbjct: 916  ELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYT 975

Query: 1273 SLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVI 1325
              PV  L  LD D+++ ++ + P+LY+        +   F++++  + YQ ++
Sbjct: 976  MAPVFSL-TLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLV 1027

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 234 GNSTIY----YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANP 289
           G + +Y    +P N++   KY  +TF P  +  QFK   N+YFL++ +        +   
Sbjct: 154 GTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYL 213

Query: 290 GLATVPLIVIVVLTSFKDA 308
               VPL  ++ +T  K+A
Sbjct: 214 SSYVVPLAFVLTVTMAKEA 232

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  325 bits (832), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 248/884 (28%), Positives = 433/884 (48%), Gaps = 129/884 (14%)

Query: 444  KSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRN 503
            K + VGD++++H    IPA           G  +++T  LDGET+ K+R  + CS     
Sbjct: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLR--VACSLTQNL 321

Query: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563
            S +    K  + +  P  +++ + G L + D  +       ++++N +     L +    
Sbjct: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSN-----ALSVDNTMWANTVLASVGSC 376

Query: 564  MGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTD 623
            +G VV+TG DT+  +N  ++  K   +  E+N       +L  +LC    +++ V     
Sbjct: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEIN-------SLSKILCACVFVLSIV----- 424

Query: 624  NTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVAL 683
                      + AG    +  V     LIL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 425  --------LVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476

Query: 684  YNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 743
             +  +      ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 477  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY--------- 521

Query: 744  GLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGA 803
                           ++   I  D       ++ L  +S   P           Q TA  
Sbjct: 522  --------------TMDTMDIVTDY------VQELVSSSTTTP---------MPQSTAKK 552

Query: 804  NGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGR 863
            +   + +   + ++ LA+CH V      +D E + ++A SPDE A+V     +G S   R
Sbjct: 553  DLPNRVR---DLVVTLAICHNV--TPTFEDGE-LTYQAASPDEIAIVKFTESVGLSLFKR 606

Query: 864  TKNGVIVDIQ--GVQKEYRLLNVLEFNSTRKRMSCIL--KIPSENPNEEPRALLICKGAD 919
             ++ V +  Q      EY +L V  FNS  KRM  I+  K+  E+         + KGAD
Sbjct: 607  DRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEH-------WFMQKGAD 659

Query: 920  SIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAAL 979
            +++ +R+ ++ND   L++    +   A EGLRTL I +++LS K Y+++ +++  A+ ++
Sbjct: 660  TVM-ARIVQSND--WLDE---EVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSM 713

Query: 980  VDREDEMEKVADV-IERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETA 1038
            ++R++ M  V    +E  L LLG T +ED+LQ+ V  SI  L  AG+K+W+LTGDKVETA
Sbjct: 714  LNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETA 773

Query: 1039 INIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEE 1098
              +  S  L++    +  +           S+P                   G+   LE 
Sbjct: 774  RCVSISAKLISRGQYVHTVTKL--------SRP------------------EGALNALEY 807

Query: 1099 AKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKL 1158
             K        +  ++IDG++L + L     K+EF  +     AV+ CR +P QKA V  L
Sbjct: 808  LKI-----NKSSCLLIDGESLGMFLTY--YKQEFFDIVVDLPAVIACRCTPQQKADVALL 860

Query: 1159 VKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVH 1218
            ++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++D+++ QF +LT+L+L H
Sbjct: 861  IREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWH 920

Query: 1219 GRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIF 1278
            GR SYKR A++     ++ +I ++    Y V + ++   L++   +  +   +T  PV  
Sbjct: 921  GRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFS 980

Query: 1279 LGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQ 1322
            L  LD D+++ ++ + P+LY+     +  +   F++++  +++Q
Sbjct: 981  L-TLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQ 1023

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 110/258 (42%), Gaps = 33/258 (12%)

Query: 100 EEFEEISFETTGADDQRSYVNTPIINQGNFAVDEEDEREKDRQLSSAEDSKHVKRMRWGT 159
           E FE  + +  G DD +S+ ++         V   ++  K+  LSS  D++ +     GT
Sbjct: 54  ENFEMRTIDQDG-DDTQSFKHS--------RVSSLNDSAKNTHLSSGRDTQPL----IGT 100

Query: 160 RRDKKGKPAMGRAKTLRWTK--KNFHNPFADDTNLAAEGHSSDDDNDENYDKSHRQRETR 217
            ++       G  ++  W+K  +    P   D +     +SS +  D+     H +RE  
Sbjct: 101 TQEPWSNNQQGSNQS-PWSKFIRLIKTPTTTDLSKYRSTNSSIELTDQ-----HVEREIH 154

Query: 218 TIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLII 277
                 P    I D++      YP N I   KY P+TF P  +  QFK   N+YFL++ +
Sbjct: 155 ------PDTTPIYDKNK-----YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVAL 203

Query: 278 MGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNV 337
                   +       VPL  ++++T  K+A++D +R   D E NN    +L   + V  
Sbjct: 204 SQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPS 263

Query: 338 SNDKVSLWRKFKKANTRV 355
            + KV    K  K  TR+
Sbjct: 264 KDLKVGDLIKIHKG-TRI 280

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  324 bits (830), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 242/889 (27%), Positives = 432/889 (48%), Gaps = 132/889 (14%)

Query: 444  KSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRN 503
            K++ VGD+V++H +  IPA           G  +V+T  LDGET+ K+R +   +  +  
Sbjct: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQ 345

Query: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563
               +T  K  + +  P  +++ + G L +         + P++++N L     L ++   
Sbjct: 346  DEMLT--KVHITASAPEKSIHMFTGKLTYKG------SSAPLSVDNTLWANTVLASSGTC 397

Query: 564  MGIVVFTGPDTKIMLNAGVTPTKVSRISRELN----LSVFMNFALLFVLCFAAGIVNGVY 619
            +  V++TG DT+  +N   +  K   +  E+N    +     F L  +L    G+ +  +
Sbjct: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKW 457

Query: 620  YRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYG 679
            Y                        V     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 458  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIES 493

Query: 680  DVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739
            D ++ +  +      ++ TI +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY     
Sbjct: 494  DKSIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY----- 542

Query: 740  EALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQD 799
                               +E   +  D       ++ L   + +    V          
Sbjct: 543  ------------------TMETMDMVTDY------IQTLTSPANMGAAGVA--------- 569

Query: 800  TAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFS 859
              G+  E  ++   + ++ LA CH V    N +D E + ++A SPDE A+V     +G S
Sbjct: 570  VTGSRKEVSQRV-RDLVVTLATCHNV--TPNFEDNE-LAYQAASPDEIAIVKFTERVGLS 625

Query: 860  FVGRTKNGVIV--DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKG 917
               R ++ + +  +  GV  +Y +L+V  F S  KRM  I++  ++N         + KG
Sbjct: 626  LFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKN-----EIWFLQKG 680

Query: 918  ADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAA 977
            AD+++ S++ ++ND   LE+    +   A EGLRTL IA+++LS + Y++++++++ A+ 
Sbjct: 681  ADTVM-SKIVQSND--WLEE---EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASL 734

Query: 978  ALVDREDEM-EKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVE 1036
            ++++R++ M E V   +E  L LLG T +ED+LQ  V  SI  L  AG+K+W+LTGDKVE
Sbjct: 735  SMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVE 794

Query: 1037 TAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEEL 1096
            TA  +  S  L++                          +   +  + +  +  G+   L
Sbjct: 795  TARCVCVSAKLIS--------------------------RGQYVHTITKLTRRDGALSRL 828

Query: 1097 EEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVV 1156
            E  K        N  ++IDGD+L  A+     + EF  +      V+ CR +P QKA V 
Sbjct: 829  EYLKA-----NRNSCLLIDGDSL--AIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVA 881

Query: 1157 KLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVL 1216
             L++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++DY+I QF +LT+L+L
Sbjct: 882  LLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLL 941

Query: 1217 VHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPV 1276
             HGR SYKR A++     ++ ++ ++    Y + +N     L++   +  +   +T  PV
Sbjct: 942  WHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPV 1001

Query: 1277 IFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVI 1325
              L  LD D+++ ++   P+LY+        +   F++++  +++Q  +
Sbjct: 1002 FSL-TLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAV 1049

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 52/111 (46%)

Query: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299
           YP N I   KY  +TF P  +  QFK   N+YFL++ +        +       VPL  +
Sbjct: 188 YPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFV 247

Query: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKK 350
           +V+T  K+A++D +R   D E NN    +L   + V   N +V    K  K
Sbjct: 248 LVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGDLVKLHK 298

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  328 bits (840), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 208/613 (33%), Positives = 334/613 (54%), Gaps = 57/613 (9%)

Query: 911  ALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNE 970
             LL   G+D++I      +N+E +LEKT   +E ++TEGLRTL  A + +S +++++W  
Sbjct: 940  VLLNYIGSDALI------SNEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRT 993

Query: 971  KHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVL 1030
            ++  A  +L +R+ ++++V   IE EL LLG TAIED+LQ+GV ++I  +  AGIK+W+L
Sbjct: 994  RYHEAKTSLSERKQKIDEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWML 1053

Query: 1031 TGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMS 1090
            TGDK ETAINIG+SC L+++   ++++  S +              N+I K       M+
Sbjct: 1054 TGDKRETAINIGYSCKLIHDYSTVVILTTSDE--------------NIISK-------MN 1092

Query: 1091 GSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPA 1150
               +E++     H        ++IDG  L +   N  +   F  LC +  +V+CCR SPA
Sbjct: 1093 AISQEVDSGNVAH------CVIVIDGATLAMFEDNPTLMSVFTELCTKTDSVVCCRASPA 1146

Query: 1151 QKAAVVKLVKNT-LDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFR 1209
            QKA +V  ++NT   ++TLAIGDG+ND+AMIQSADIGVGIAG+EG QA  S+DY+IGQFR
Sbjct: 1147 QKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFR 1206

Query: 1210 YLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNL 1269
            ++ +L+LVHGR++Y R A+ I   FYK + F L+   Y  Y  + G+ L+E   L+++N 
Sbjct: 1207 FILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNT 1266

Query: 1270 AFTSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFL 1329
             FTSLPV+ +G+ ++D+  +  + VP+LY +G L   +N + F  ++F     ++I  FL
Sbjct: 1267 LFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTANALIITFL 1326

Query: 1330 PYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCL 1389
              + + +T +     + L    +V  F AT+A+++     +  + R +W +   + LSC 
Sbjct: 1327 NIVAWGETSLSDNTLYPLG---FVN-FSATVALINVKAQFIEMRNR-NWLAFTSVILSCG 1381

Query: 1390 CIFAWTGIWSSFTSSGEFYKSA---AHIYGQPV-FWAIMFAGILFCLLPRFAADTFLRTY 1445
                W         S   Y       H +G+ + FW       +  ++      TF    
Sbjct: 1382 GWLVWCCALPILNRSDGIYDVTYGLYHHFGRDITFWCTSLILAVLPIIVDVVYKTFKIML 1441

Query: 1446 MPKDIDI---------IRECWKRGDFDHYPEGYDPTDPDRPKVKNAFVYNKDIEMAQSST 1496
             P D DI         IR+  + G ++   +G+  T     + ++ F   KDI   +S +
Sbjct: 1442 APSDSDIFAELEQKSEIRKKLELGAYNEMKQGWTWT-----QDQSTFDKYKDIVFNRSRS 1496

Query: 1497 DSIQTEEIPMDEL 1509
             S  TE   M  L
Sbjct: 1497 ASSATEVNSMTNL 1509

 Score =  235 bits (600), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 164/554 (29%), Positives = 288/554 (51%), Gaps = 75/554 (13%)

Query: 435 DCKFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVR-Q 493
           + +  +  WK + VGD V +  +D +PA              ++ET  LDGETNLK +  
Sbjct: 255 NVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVP 314

Query: 494 SLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLR 553
             + + + +++  +     +V  E P+++LY+++GNL+ ++  +  +K  P+  +N++ R
Sbjct: 315 HPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLE-LNSGSSSKKKYPLGPDNVIYR 373

Query: 554 GCTLRNTKWAMGIVVFTGPDTKIMLNAGVTP-TKVSRISRELNLSVFMNFALLFVLCFAA 612
           G  +RNT+  +G+V+FTG ++KI +NA   P TK  ++ R++N+ V     ++  +   +
Sbjct: 374 GSIIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFS 433

Query: 613 GIVNGVYY-RTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKT 671
            + + +   R  N ++ ++     AG+A    ++SF   +I+Y +++P+SLY+++E+IK 
Sbjct: 434 YLGHTIQIKRYVNNNKAWYLLQEDAGTAPT--IMSF---IIMYNTIIPLSLYVTMELIKV 488

Query: 672 AQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING 731
           AQ+  +  D+ +Y+   D PC  ++ TI ++LGQ+ YIFSDKTGTLT N M F+K +  G
Sbjct: 489 AQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCG 548

Query: 732 VSYGRAYTEAL-----AGLRKRQGIDV------------------------------EEE 756
            S+    T+ +     A L  +  IDV                              +  
Sbjct: 549 TSWVHNATQDISEFKPAQLSNKNDIDVISIDDQSFLSKLGYTSQSNPKRYMDINDFPDRR 608

Query: 757 GALEKEGIAQDKEIMLANLKIL---------GENSQLR---PENV--TFVSKEFVQDTAG 802
            ++E +G A  K     +++ L           NSQ     PE++  TF    ++Q    
Sbjct: 609 TSVEYKGNATVKYTGRPSMRSLYVPPKKETNASNSQDASDIPEDIKSTFELIYYIQSNPK 668

Query: 803 ANGETQKKCNENFMLALALCHTVL---VEENKDDPEIMDFKAQSPDEAALVGTARDMGFS 859
           +    + K    F+L+LA+CH  L    EE  D+ +I+++++ SPDE ALV  ARDMG+ 
Sbjct: 669 SLFAKKAKM---FILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYI 725

Query: 860 FVGRTKNGVIV-------DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRAL 912
              R  N + +       D     + + +L +++FNS RKRMS I+++P     E+ R L
Sbjct: 726 VYNRNANILTLKTFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPE----EKDRVL 781

Query: 913 LICKGADSIIYSRL 926
           L CKGAD++I  RL
Sbjct: 782 LFCKGADNVILERL 795

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%)

Query: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299
           Y  N I +++YT ++FFP+ +  QF  +ANVYF ++ I+     +         VPL V 
Sbjct: 123 YCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCVF 182

Query: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHILK 330
           + ++  ++A +D RR  LD E NN  T +L+
Sbjct: 183 MAISMAREAYDDYRRHKLDKEENNKLTKVLQ 213

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  326 bits (836), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 196/542 (36%), Positives = 298/542 (54%), Gaps = 45/542 (8%)

Query: 930  NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKV 989
            N+E +LEKT   +++++TEGLRTL  + + +  +EY+ W  K+  A  +L +R  ++ +V
Sbjct: 932  NEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEV 991

Query: 990  ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1049
               IE +L LLG TAIED+LQ+GVP++I  +  AGIK+W+LTGDK ETAINIG++C L+ 
Sbjct: 992  GGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIY 1051

Query: 1050 NEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGN 1109
            +   ++++K + D              NLI K       M+   EEL+  K  H      
Sbjct: 1052 DYSTVVILKKNDD--------------NLISK-------MTALGEELDTGKIAH------ 1084

Query: 1110 FGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVK-NTLDVMTL 1168
              ++IDG +L +   N  +   F+ LC +  +V+CCR SP+QKA +V  ++    D++TL
Sbjct: 1085 CVLVIDGASLAVFENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTL 1144

Query: 1169 AIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWSYKRMAE 1228
            AIGDG+ND+AMIQSADIGVGI G+EG QA  SSDY+I QFRYL +L+ VHGR++Y R ++
Sbjct: 1145 AIGDGANDIAMIQSADIGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSK 1204

Query: 1229 MIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILDQDVND 1288
             +   FYK V+F L+   Y     + G+ L+E   L++FN  FTSLPVI +G+ ++D+  
Sbjct: 1205 FVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKP 1264

Query: 1289 IVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQNGFGLD 1348
            +  + VP+LY +G     +N   F ++M  A   SV+  FL +  +   G   Q+   + 
Sbjct: 1265 MTLLAVPELYTMGQKCQAFNLKIFLVWMLTAAGISVLITFLNFEIW---GFTAQSDNSI- 1320

Query: 1349 HRYWVGVF----VATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSFTSS 1404
              Y +GV     +  +  V C  ++      W  F+SL I  SC+    W  +       
Sbjct: 1321 --YPIGVINFTSICFLINVKCQ-FIETRNRNWLAFASLLI--SCIGWILWCCLLPGIYGE 1375

Query: 1405 GEFYKSAAHIYGQ----PVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWKRG 1460
               Y     +Y Q      +WA     I+F ++      TF     P D DI  E  ++ 
Sbjct: 1376 NAIYDVLIGLYHQFGRDITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQKD 1435

Query: 1461 DF 1462
            D 
Sbjct: 1436 DI 1437

 Score =  197 bits (500), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 252/506 (49%), Gaps = 75/506 (14%)

Query: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299
           Y  N I +++YT  +F P+ +  QF  +AN YFL++ I+     +         VPL + 
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHILK-GVENVNVSNDKVSLWRKFKKANTRVLFR 358
           + ++  ++A +D +R  LD E NN  T +L  G ++  + +D +                
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSI---------------- 219

Query: 359 FIHLCQELFTEEGKKQRAQRKRHEMHNKIRQTQTPRNSLDSVGSYRNSMESEFGGDLTER 418
                                 + + N          S D++ S  NSM +    D+TE 
Sbjct: 220 ----------------------YSLSN------VSARSTDAILSDFNSMHNL--NDVTEP 249

Query: 419 GKDD----LCLLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXG 474
              D    L LL        D    K  WK + VG+ V ++++D +PA            
Sbjct: 250 SYTDHFTNLNLLRSQF----DIHIKKKEWKDLKVGEFVLLNSDDWVPADILLLSTDGENN 305

Query: 475 ACYVETKNLDGETNLKVRQSL-KCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWV 533
             +VET  LDGETNLK +  L + +  + ++  ++        E P+++LY+++G ++ +
Sbjct: 306 EAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSATTTLEDPNNDLYNFEGTVE-I 364

Query: 534 DRETGLEKNEPVNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTP-TKVSRISR 592
           D E       P+  +N++ RG  LRNT+  +GIV+FTG +TKI +NA   P TK  ++  
Sbjct: 365 DGEL-----YPLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNPRTKAPKLQG 419

Query: 593 ELNLSV-FMNFALLFVLCFA---AGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFW 648
           ++NL V FM F +  +  F+     I+   Y   DN +R ++ F   AG+A    ++SF 
Sbjct: 420 KINLIVLFMVFVVAAMAMFSYLGQHILKKNY--VDN-NRAWYLFQEDAGTAPT--IMSF- 473

Query: 649 VALILYQSVVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEY 708
             +I+Y +++P+SLY++ EIIK  Q+  +  D+ +Y+   D PC  ++ TI ++LGQ+ Y
Sbjct: 474 --IIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQVSY 531

Query: 709 IFSDKTGTLTQNVMEFKKCTINGVSY 734
           IFSDKTGTLT N M F+K +I G S+
Sbjct: 532 IFSDKTGTLTDNKMIFRKFSICGSSW 557

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 86/143 (60%), Gaps = 14/143 (9%)

Query: 815 FMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIV---- 870
           F+L+LALCHT L ++  D  + + +++ SPDE ALV  ARDMGF    R  + + +    
Sbjct: 672 FILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSIATYP 731

Query: 871 ---DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRL- 926
              D Q + ++Y +L  + F+S RKRMS  +K+    PN++ R LLICKGAD++I  RL 
Sbjct: 732 NGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKM----PNDDDRVLLICKGADNVILERLR 787

Query: 927 -SKNNDEKLLEKTALHLEQYATE 948
            S+    K+LE+  L +EQ   E
Sbjct: 788 NSELAQNKVLEQQNL-IEQRKLE 809

>Scas_704.38
          Length = 1161

 Score =  320 bits (820), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 253/873 (28%), Positives = 421/873 (48%), Gaps = 149/873 (17%)

Query: 444  KSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRN 503
            K + VGD++++   D +PA           G  +++T  LDGET+ K+R +   +     
Sbjct: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALT----- 332

Query: 504  SRNITR----TKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRN 559
             +N+T      K  + +  P   ++++ G + + D  +      P++I+N L     L +
Sbjct: 333  -QNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLAS 386

Query: 560  TKWAMGIVVFTGPDTKIMLNA-------GVTPTKVSRISRELNLSVFMNFALLFVLCFAA 612
            T + +G VV+TG DT+  +N        G+   +++ IS+ L  SVF   AL  +L   A
Sbjct: 387  TGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVF---ALSIILVVFA 443

Query: 613  GIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTA 672
            G  N  +Y                        +     LIL+ +++P+SL +++++ K+ 
Sbjct: 444  GFHNSDWY------------------------LDVMRYLILFSTIIPVSLRVNLDLAKSV 479

Query: 673  QALFIYGDVALYNERLDYPCT-PKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING 731
             A  I  D  +       P T  ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  
Sbjct: 480  YAHQIEHDDTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGT 532

Query: 732  VSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTF 791
            VSY                         E   I  D    L N             N   
Sbjct: 533  VSYTS-----------------------ETLDIVSDYVDALVN-----------SSNSAN 558

Query: 792  VSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVG 851
             S + V  T+  +   + +   + ++ LA+CH V      D+   + ++A SPDE A+V 
Sbjct: 559  PSGKSVPSTSRKDLSARVR---DMVVTLAICHNVTPTFEDDE---LTYQAASPDEIAIVK 612

Query: 852  TARDMGFSFVGRTKNGV--IVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEP 909
                +G S   R ++ +  +    G    Y +L V  FNS  KRM  I+     +  ++ 
Sbjct: 613  FTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIV-----HDEQKD 667

Query: 910  RALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWN 969
                + KGAD+++ +R+ +NND  L E+T       A EGLRTL + +++LS   Y ++ 
Sbjct: 668  EYWFMQKGADTVM-ARIVENNDW-LEEETG----NMAREGLRTLVVGRKKLSRNIYDQFK 721

Query: 970  EKHEIAAAALVDREDEMEKV-ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLW 1028
            + ++ A+ ++V+R+ +M  V    +E +L LLG T +ED+LQ+ V  SI  L  AGIK+W
Sbjct: 722  KDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIW 781

Query: 1029 VLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQ 1088
            +LTGDKVETA  +  S  L++    + +I           +KP                 
Sbjct: 782  MLTGDKVETARCVSISAKLISRGQYVHIITKL--------TKP----------------- 816

Query: 1089 MSGSYEELEEAKKVHEPPTGNFG--VIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCR 1146
              G+  +LE  K        N G  ++IDG++L + LR    KREF  +      V+ CR
Sbjct: 817  -EGALNQLEYLKV-------NKGACLLIDGESLGMFLRY--YKREFFDVVICLPTVVACR 866

Query: 1147 VSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIG 1206
             +P QKA V  +++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++D++I 
Sbjct: 867  CTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT 926

Query: 1207 QFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTL 1266
            +F +LT L+L HGR SYKR A++     ++ ++  +    Y + + ++   L++   +  
Sbjct: 927  EFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVG 986

Query: 1267 FNLAFTSLPVIFLGILDQDVNDIVSMVVPQLYR 1299
            +   +T  PV F   LD D+ + ++ + P+LY+
Sbjct: 987  YATCYTMAPV-FSMTLDHDIEESLTKIYPELYK 1018

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 53/113 (46%)

Query: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299
           YP N+I   KY   TF P  +  QFK   N+YFLV+ +        +       VPL  +
Sbjct: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239

Query: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKAN 352
           + +T  K+A++D +R   D E N+   H+L   + V   + KV    K  K +
Sbjct: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGD 292

>Kwal_23.5789
          Length = 1133

 Score =  315 bits (808), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 248/889 (27%), Positives = 426/889 (47%), Gaps = 134/889 (15%)

Query: 444  KSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRN 503
            K + VGD++++      PA           G  +++T  LDGET+ K+R  + C      
Sbjct: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311

Query: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563
            S++    +  + +  P  ++ ++ G L +     G  +++P++++N +       +   A
Sbjct: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366

Query: 564  MGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFA----AGIVNGVY 619
            +  VV+TG DT+  +N  ++  K   +  E+N    +  A +F+L  A    AG  N  +
Sbjct: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDW 426

Query: 620  YRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYG 679
            Y                        V     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 427  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEH 462

Query: 680  DVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739
            D  +    +      ++ TI +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY     
Sbjct: 463  DSTIPETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY----- 511

Query: 740  EALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQD 799
                               ++   I  D       ++ + +N  L    V   SK   +D
Sbjct: 512  ------------------TMDTMDIVTDY------VRAMSDN--LNSSAVPSASK---KD 542

Query: 800  TAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFS 859
              G           + +L LALCH V      +D E + ++A SPDE A+V     +G +
Sbjct: 543  LPGRV--------RDLVLTLALCHQV--TPTFEDGE-LTYQAASPDEIAIVKFTESVGLT 591

Query: 860  FVGRTKNGVIV--DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKG 917
               R ++ + +  D  G   EY +L+V  FNS  KRM  ++        ++     + KG
Sbjct: 592  LFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQKG 646

Query: 918  ADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAA 977
            AD ++ S++ + ND  L E+T       A EGLRTL I ++ LS K  Q + + +E A+ 
Sbjct: 647  AD-VVMSKIVQKNDW-LEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASL 700

Query: 978  ALVDREDEMEKV-ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVE 1036
             +++RE  M  V +  +E +L +LG T +ED+LQ+ V  SI  L  AGIK+W+LTGDKVE
Sbjct: 701  MMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVE 760

Query: 1037 TAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEEL 1096
            TA  +  S  L++    +  +           +KP                   G+   L
Sbjct: 761  TARCVSISAKLVSRGQYVHTVTKV--------NKP------------------EGALTHL 794

Query: 1097 EEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVV 1156
            E  K        N  ++IDG++L L L  +  +++F  +     AV+ CR +P QKA V 
Sbjct: 795  ELLKI-----NTNSCLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKADVA 847

Query: 1157 KLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVL 1216
              ++         IGDG NDV+MIQSAD+GVGI G+EG+QA +++D++I QF +L++L+L
Sbjct: 848  TFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLL 907

Query: 1217 VHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPV 1276
             HGR SYKR A++     ++ ++ ++    Y + + ++   L++   +  +   +T  PV
Sbjct: 908  WHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPV 967

Query: 1277 IFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVI 1325
              L  LD D+++ ++   P+LY+        +   F++++  +++Q  +
Sbjct: 968  FSL-TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 50/103 (48%)

Query: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299
           Y  N I   KY P+TF PK +  QFK   N+YFL++ +        +       VPL  +
Sbjct: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215

Query: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKV 342
           + +T  K+A++D +R   D E NN    +L   + V   + KV
Sbjct: 216 LTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKV 258

>Kwal_23.3556
          Length = 1597

 Score =  318 bits (815), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 190/561 (33%), Positives = 303/561 (54%), Gaps = 41/561 (7%)

Query: 902  SENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELS 961
            ++ P E    LL     +  I+S     N+E +LE+T   +E ++T GLRTL  + + + 
Sbjct: 924  AKTPPEVLGPLLDDNSIEEYIWSEDLIQNEEFVLERTLQAIEDFSTSGLRTLLYSYKWIP 983

Query: 962  WKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLG 1021
             ++Y++W++K+  A  +L +R+++M  V +++E  L LLG TAIED+LQ+GV D+I  + 
Sbjct: 984  SEDYEKWSKKYHAAKTSLENRKEKMHSVGELVETSLHLLGATAIEDKLQEGVADAIDKIR 1043

Query: 1022 EAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILK 1081
             AGIK+W+LTGDK ETAINIG+SCNL+++   ++++ A  +++                 
Sbjct: 1044 RAGIKMWMLTGDKRETAINIGYSCNLIHDYSTVVILSAKDENIS---------------- 1087

Query: 1082 YLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKA 1141
                  +++   +E+E     H        V+IDG  L     N  +   F+ LC +  +
Sbjct: 1088 -----SKLTAVSQEIERGNIAH------CVVVIDGSTLTTFESNPTLMSVFVELCTKTDS 1136

Query: 1142 VLCCRVSPAQKAAVVKLVKNT-LDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMS 1200
            V+CCR SP+QKA +V  ++NT   ++TLAIGDG+ND+AMIQSADIGVGIAG+EG QA  S
Sbjct: 1137 VICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRS 1196

Query: 1201 SDYAIGQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFE 1260
            SDY+I QFR+L +L+LVHGR++Y R  + +   FYK ++F L+   Y  +  + G+ L+E
Sbjct: 1197 SDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYE 1256

Query: 1261 YTYLTLFNLAFTSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAM 1320
               L++FN  FTSLPV+ +G+ ++D+  +  + +P+LY +G L   +N   F  +MF A 
Sbjct: 1257 PWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAA 1316

Query: 1321 YQSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGV--FVATIAVVSCNTYVLLHQYRWDW 1378
              S+I  FL +       I   +    +  Y +GV  F A I +V+     LL  +  + 
Sbjct: 1317 LNSLIITFLNW------KIWAVSSLSDNTVYPIGVINFTAIITLVNVKCQ-LLETHNRNV 1369

Query: 1379 FSSLFIALSCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQ----PVFWAIMFAGILFCLLP 1434
             +   + +S      W  +     S    Y     +Y Q      FW      ++  L+ 
Sbjct: 1370 LAICSLVISVGGWLLWCCLLPGIYSEDGMYDVLTGLYFQFGNDITFWCACLVLVVLPLII 1429

Query: 1435 RFAADTFLRTYMPKDIDIIRE 1455
                 T      P D +I  E
Sbjct: 1430 DVVFKTVKIMIFPSDSEISME 1450

 Score =  283 bits (725), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 218/769 (28%), Positives = 378/769 (49%), Gaps = 110/769 (14%)

Query: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299
           Y  N I +++YT  TF P+ +  QF  +AN YF ++ ++     +         VPL++ 
Sbjct: 108 YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIF 167

Query: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKANTRVLFRF 359
           + ++  ++A +D RR  LD E N+    +L     V  S+       +F + N+      
Sbjct: 168 MGISMSREAWDDFRRHKLDREENDKTARVL-----VKSSSPHT----EFSRPNS------ 212

Query: 360 IHLCQELFTEEGKKQRAQRKRHEMHNKIRQTQTPRNSLDSVGSYRNSMESEFGGDLTERG 419
                 L++    +Q A       +  +  T     S +   +  + ++S++G +  E+ 
Sbjct: 213 ------LYSLPQWQQSATSTSMLTNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKK 266

Query: 420 KDDLCLLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVE 479
                                  WK + VGD V +  ++ +PA             C+VE
Sbjct: 267 -----------------------WKDIKVGDYVVLEQDEWVPADMLVLTCSDEKNECFVE 303

Query: 480 TKNLDGETNLKVRQSL-KCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETG 538
           T  LDGETNLK +Q L + S +++ +  +T  K KV  E P+ +L++++GNL+ +    G
Sbjct: 304 TMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDPNIDLHNFEGNLELL----G 359

Query: 539 LEKNEPVNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTP-TKVSRISRELNLS 597
             +   +  ++++ RG  +RNT  A+G+VVFTG +TKI +NA   P  K  ++ R +NL 
Sbjct: 360 ENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIKNPRIKAPKLQRAINLI 419

Query: 598 V-FMNFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQS 656
           V FM F +  +  F+      +  +  + +R ++ F S AG A    V+SF   +I+Y +
Sbjct: 420 VLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLFNSDAGLAPT--VMSF---IIMYNT 474

Query: 657 VVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGT 716
           ++P+SLY+++EIIK  Q+  +  D+ +Y+   + PC  ++ TI ++LGQ+ YIFSDKTGT
Sbjct: 475 LIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGT 534

Query: 717 LTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID--------VEEEGALEKEGIAQDK 768
           LT N M F+  ++ G S+   +  A   L K +  D        V++   L+  G A D+
Sbjct: 535 LTDNKMVFRALSVCGSSWIHDFDPAAEKLTKSESSDSNTVEVVSVDDRSFLQNFG-AADR 593

Query: 769 EI---MLANLKILGENSQLRPENVTFVSKEFVQDTAGANGETQKKC-------------- 811
           ++      ++   G +S +     +  S+   +D      E +K                
Sbjct: 594 KVPSNHKTSIDYKGNSSAIYTGRPSMASRICEEDKNPKKIEPEKSSKTGLRSSTELIRYI 653

Query: 812 --NEN---------FMLALALCHTVLVEENK--DDPEIMDFKAQSPDEAALVGTARDMGF 858
             N N         F+L+LALCH  L + +   +  + ++++A SPDE ALV  ARDMG+
Sbjct: 654 QQNPNTHFAKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGY 713

Query: 859 SFVGRTKNGVIV-------DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRA 911
           + + R  + + +       D +    +Y +LN +EF+S RKRMS ++++    P+EE R 
Sbjct: 714 AVMNRNSDVLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRL----PHEENRI 769

Query: 912 LLICKGADSIIYSRLSKNN--DEKLLEKTALHLEQYATEGLRTLCIAQR 958
           LLICKGAD++I  RL  ++  ++K++E      E+ A E    L + QR
Sbjct: 770 LLICKGADNVILERLHNSDLANQKIVELQETTSERKAAEA--DLVLKQR 816

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  317 bits (813), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 189/552 (34%), Positives = 299/552 (54%), Gaps = 45/552 (8%)

Query: 917  GADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAA 976
            G+D +I       N+E ++E+T   +++++TEGLRTL  A + +   +Y+ WN+++  A 
Sbjct: 1006 GSDELIL------NEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAK 1059

Query: 977  AALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVE 1036
             +L DR+ ++++    IE  L LLG TAIED+LQDGV ++I  +  AGIK+W+LTGDK E
Sbjct: 1060 TSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRE 1119

Query: 1037 TAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEEL 1096
            TAINIG+SC L+ +   ++++  + +              N+I K       M+   +E+
Sbjct: 1120 TAINIGYSCMLIKDYSTVVILTTTDE--------------NIISK-------MNAVSQEV 1158

Query: 1097 EEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVV 1156
            +     H        V+IDG  + +   N      F+ LC +  +V+CCR SP+QKA +V
Sbjct: 1159 DSGNIAH------CVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMV 1212

Query: 1157 KLVKNT-LDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLV 1215
              ++NT  +++TLAIGDG+ND+AMIQSADIGVGIAG+EG QA   SDY+IGQFR+L +L+
Sbjct: 1213 SNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLL 1272

Query: 1216 LVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLP 1275
             VHGR++Y R ++ +   FYK + F  +   Y  Y  + GS L+E   L++FN  FTSLP
Sbjct: 1273 FVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLP 1332

Query: 1276 VIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYY 1335
            V+ +G+ ++D+  +  + VP+LY  G L   +N   F  ++  A   S+I  FL  + + 
Sbjct: 1333 VLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWG 1392

Query: 1336 KTGIVTQNGFGLDHRYWVGVFVATIAVVSCNT-YVLLHQYRWDWFSSLFIALSCLCIFAW 1394
             + +     + L     +  F A +A+++  + +V +H   W  F+S  + LSC     W
Sbjct: 1393 MSSLSDNTMYPLG----LINFTAIVALINVKSQFVEMHNRNWLAFTS--VVLSCGGWLVW 1446

Query: 1395 TGIWSSFTSSGEFYKSAAHIYGQ----PVFWAIMFAGILFCLLPRFAADTFLRTYMPKDI 1450
                    ++ + Y  A   Y        FW       L  +       TF     P D 
Sbjct: 1447 CCALPILNNTDQIYDVAYGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDS 1506

Query: 1451 DIIRECWKRGDF 1462
            DI  E  ++ D 
Sbjct: 1507 DIFAELEQKSDI 1518

 Score =  177 bits (448), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 172/297 (57%), Gaps = 12/297 (4%)

Query: 443 WKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSL-KCSHMI 501
           W+ + VGD V +  +D +PA             C+VET  LDGETNLK +Q   + + + 
Sbjct: 299 WEKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLT 358

Query: 502 RNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTK 561
           + +  +     +V  E P+ +LY+++GNL+  +         P+  +N++ RG  LRNT+
Sbjct: 359 KAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQ 418

Query: 562 WAMGIVVFTGPDTKIMLNAGVTP-TKVSRISRELNLS-VFMNF--ALLFVLCFAAGIVNG 617
             +G+V+F+G +TKI +NA   P TK  ++ R++N+  VFM F  A + +  +   +++ 
Sbjct: 419 NVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHK 478

Query: 618 VYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFI 677
             Y   N +   F+    A +  A  ++SF   +I+Y +V+P+SLY+++EIIK  Q+  +
Sbjct: 479 KKYIDQNKAWYLFQ----ADAGVAPTIMSF---IIMYNTVIPLSLYVTMEIIKVVQSKMM 531

Query: 678 YGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 734
             D+ +Y+   + PC  ++ TI ++LGQ+ YIFSDKTGTLT N M F+K ++ G S+
Sbjct: 532 EWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSW 588

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 2/101 (1%)

Query: 229 ILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVAN 288
           ++DE  N    Y  N+I +++YT  +F P+ +  QF  +AN YF ++ ++     +    
Sbjct: 129 LIDERFNKP--YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTG 186

Query: 289 PGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHIL 329
                +PL V + ++  ++A +D RR  LD E NN P  +L
Sbjct: 187 TYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVL 227

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  315 bits (808), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 203/579 (35%), Positives = 313/579 (54%), Gaps = 58/579 (10%)

Query: 930  NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKV 989
            N+E ++E+T   ++ + TEGLRTL  + + +  +EY+ WN ++  A AALV+R ++M+ V
Sbjct: 933  NEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTV 992

Query: 990  ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1049
             ++IER+LTLLG   IED+LQ+GVPD+I  L  AGIK+W+LTGDK ETAINIG+SC L++
Sbjct: 993  GEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH 1052

Query: 1050 NEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGN 1109
            +   ++++  + +++    SK   I                   +E+E     H      
Sbjct: 1053 DYSTVIILAPNDENM---ASKITTIT------------------QEIEAGNVAH------ 1085

Query: 1110 FGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVV-KLVKNTLDVMTL 1168
              V+IDG  L +   N  +   F+ LC +  +V+CCR SP+QKA +V K+ K    ++TL
Sbjct: 1086 CVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTL 1145

Query: 1169 AIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWSYKRMAE 1228
            AIGDG+ND+AMIQSADIGV I G+EG QA  SSDY+I QFRYL +L+LVHGR++Y R ++
Sbjct: 1146 AIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSK 1205

Query: 1229 MIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILDQDVND 1288
             +   FYK  +F L+   + +   + G+  +E   LT+FN  FTSLPV+ +G+ ++D+  
Sbjct: 1206 FVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKS 1265

Query: 1289 IVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQNGFGLD 1348
            +  + +P+LY  G     +N   F  +M  A   SVI  F  + C+    +  Q+   L 
Sbjct: 1266 VTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVIICFTNWQCW---SLTAQSDNTL- 1321

Query: 1349 HRYWVGVFVATIAVVSCNTYVLLHQY---RWDWFSSLFIALS---CLCIFAWTGIWSSFT 1402
              Y +G+   T  VV  N    L +     W  F+S FI++    C C+     I+   T
Sbjct: 1322 --YPIGLINYTAVVVLVNVKCQLLEMANRNWLAFASFFISVCGWLCWCLLL-PAIYKE-T 1377

Query: 1403 SSGEFYKSAAHIYGQPV-FWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWKR-- 1459
               +  +   H +G  + FWA     +L  ++      T      P D +I  E  +R  
Sbjct: 1378 LVYDVREGLYHQFGPDITFWATNLVLVLLPVMLDLLFKTCKVIIYPSDTEIFAELEQRDA 1437

Query: 1460 -------GDFDHYPEGY----DPTDPDRPKVKNAFVYNK 1487
                   G F+   +G+    DP  P   ++ N  + NK
Sbjct: 1438 VRKKLEFGAFNELKQGWTWQRDP--PTIKRLMNKAIGNK 1474

 Score =  174 bits (441), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 171/295 (57%), Gaps = 9/295 (3%)

Query: 443 WKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSL-KCSHMI 501
           WK V VG+ V ++ +D +PA             CYVET  LDGETNLK +  L K +   
Sbjct: 241 WKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKCKHVLPKIASQT 300

Query: 502 RNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTK 561
           R +  +   +     E P+ +LY+++G ++ V+ ++G ++   + ++N+L RG  +RNT+
Sbjct: 301 RTASGLATFRGMTTVEDPNIDLYNFEGKIE-VETDSGEQQAYSIGLDNVLFRGSIIRNTQ 359

Query: 562 WAMGIVVFTGPDTKIMLNAGVTP-TKVSRISRELNLSVFMNFALLFVLCFAA-GIVNGVY 619
             +G+VVFTG +TKI +NA   P  K  ++  ++NL V     ++ +  F + G+     
Sbjct: 360 TVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSFLSFGLQRFFK 419

Query: 620 YRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYG 679
            R  ++ R ++     AG A    ++SF   +I+Y +++P+SLY+++EIIK  Q+  +  
Sbjct: 420 NREVDSDRAWYLMKVDAGLAPT--IMSF---IIMYNTLIPLSLYVTMEIIKDMQSRLMEW 474

Query: 680 DVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 734
           D+ +Y+   +  CT ++ TI ++LGQ+ YIFSDKTGTLT N M F+K +  G ++
Sbjct: 475 DIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGTAW 529

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 80/127 (62%), Gaps = 15/127 (11%)

Query: 815 FMLALALCHTVLVEENKD----DPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIV 870
           F+LALALCHT L ++ +     D + +++++ SPDE ALV  ARDMG+  + R  + + +
Sbjct: 653 FILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTI 712

Query: 871 -------DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIY 923
                  +   V ++Y +LN ++F+S RKRMS ++++  ++P    + LLICKGAD++I 
Sbjct: 713 KTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRM-HQHPE---KVLLICKGADNVIL 768

Query: 924 SRLSKNN 930
            RL  ++
Sbjct: 769 ERLHNSD 775

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 50/109 (45%)

Query: 233 DGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLA 292
           D  S + Y  N I +++Y+  +F P+ +  QF  V N YF  + I+     +        
Sbjct: 103 DRRSGLPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTT 162

Query: 293 TVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDK 341
            VPL + + ++  ++  ED RR  LD E NN    +L    +    ++K
Sbjct: 163 IVPLSIFMGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNK 211

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  308 bits (788), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 247/894 (27%), Positives = 425/894 (47%), Gaps = 145/894 (16%)

Query: 444  KSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKCSHMIRN 503
            K + VGDI+++     +PA           G  +++T  LDGET+ K+R  L CS     
Sbjct: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328

Query: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563
            + N       + +  P  +++++ G + + D  +      P++++N +     L ++   
Sbjct: 329  TENDLLNNITITASAPEHSIHNFLGKITYKDSTSS-----PLSVDNTMWENTVLASSAAC 383

Query: 564  MGIVVFTGPDTKIMLNAGVTPTKVSRISRELN-LSVFMN---FALLFVLCFAAGIVNGVY 619
            +  +V+TG +T+  LN   +  K   +  E+N LS  +    F L  +L   AG  N  +
Sbjct: 384  ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDW 443

Query: 620  YRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYG 679
            Y                        V     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 444  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEH 479

Query: 680  DVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739
            D  + +  +      ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  VS    YT
Sbjct: 480  DKQIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVS----YT 529

Query: 740  EALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQD 799
                                E   I  D                       F+     + 
Sbjct: 530  N-------------------ETMDIVTD-----------------------FIQSMNSRT 547

Query: 800  TAGANGETQKKCNE---NFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDM 856
            +      T+K  ++   + +  LA+CH V      +D E + ++A SPDE A+V     +
Sbjct: 548  SNSTPTTTRKNISDRVIDLVTTLAICHNV--TPTFEDGE-LTYQAASPDEIAIVKFTESV 604

Query: 857  GFSFVGRTKNGVIV--DIQGVQKEYRLLNVLEFNSTRKRMSCIL--KIPSENPNEEPRAL 912
            G S   R ++ + +  D  G++ EY +  +  FNS  KRM  I+  K+  E         
Sbjct: 605  GLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQE-------YW 657

Query: 913  LICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKH 972
             + KGAD+++ S + +N  + L E+T+      ATEGLRTL I +++LS   ++++ +++
Sbjct: 658  FLQKGADTVMSSIVVRN--DWLEEETS----NMATEGLRTLVIGRKKLSTNLFEQFEKEY 711

Query: 973  EIAAAALVDREDEMEKVA-DVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLT 1031
              A+  ++DRE  M+ V    +E +L LLG T +ED+LQ  V  SI  L  AGIK+W+LT
Sbjct: 712  SEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 771

Query: 1032 GDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSG 1091
            GDKVETA  +  S  L++    +  +           +KP   + +  L+YLQ       
Sbjct: 772  GDKVETARCVSISAKLISRGQYVHTVTKV--------NKPEGALHH--LEYLQVN----- 816

Query: 1092 SYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQ 1151
                             N  ++IDG++L L L+      EF  +      V+ CR +P Q
Sbjct: 817  ----------------QNSCLLIDGESLGLYLQY--FPDEFFDIVVNLPTVVACRCTPQQ 858

Query: 1152 KAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYL 1211
            KA V   ++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++D++I QF +L
Sbjct: 859  KADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHL 918

Query: 1212 TRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAF 1271
            T+L+L HGR SYK  A++     ++ +I ++    Y + + ++   L++   +  +   +
Sbjct: 919  TKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCY 978

Query: 1272 TSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVI 1325
            T  PV  L  LD D+++ ++ + P+LY+   L    +   F++++  +++Q  +
Sbjct: 979  TMAPVFSL-TLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCV 1031

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 41/84 (48%)

Query: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299
           YP N I   KY P TF P  +  QFK   N+YFL++ +        +       VPL  +
Sbjct: 173 YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232

Query: 300 VVLTSFKDAIEDSRRTILDMEVNN 323
           + +T  K+A++D  R   D E NN
Sbjct: 233 LTVTMSKEAMDDINRRKRDREANN 256

>Scas_669.3
          Length = 1638

 Score =  303 bits (775), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 201/595 (33%), Positives = 323/595 (54%), Gaps = 62/595 (10%)

Query: 930  NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKV 989
            ND  ++EKT   +++++TEGLRTL  + + +  +EYQ+W +++  A  +L +R+ ++ +V
Sbjct: 987  NDGYVIEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEV 1046

Query: 990  ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1049
             + IE++L LLG TAIED+LQ+GV ++I  +  AGIK+W+LTGDK ETAINIG+SC L+ 
Sbjct: 1047 GEEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIY 1106

Query: 1050 NEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGN 1109
             +   +VI A GD+             N+I K       M+   +E++     H      
Sbjct: 1107 -DYSTVVILAKGDE-------------NIISK-------MNAISQEVDSGNVAH------ 1139

Query: 1110 FGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNT-LDVMTL 1168
              +IIDG  L +   N  +   F+ LC +  +V+CCR SP+QK+ +V  ++N+  +++TL
Sbjct: 1140 CVIIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTL 1199

Query: 1169 AIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWSYKRMAE 1228
            AIGDG+ND+AMIQSADIG+GI G+EG QA  ++DY+I QFR++ +L+LVHGR++Y R A+
Sbjct: 1200 AIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQFRFILKLLLVHGRYNYIRTAK 1259

Query: 1229 MIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILDQDVND 1288
             I   F+K + F L+   +  Y  + GS L+E   L++FN  FTSLPV+ +G+ ++D+  
Sbjct: 1260 FILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKP 1319

Query: 1289 IVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQNGFGLD 1348
            +  + +P+LY +G L   +N   F  ++  A   +++  FL  + + +T +        D
Sbjct: 1320 MTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLITFLNIIIWGETALS-------D 1372

Query: 1349 HR-YWVGV--FVATIAVVSCNT-YVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSFTSS 1404
            H  Y +GV  F A +A+V+    ++ ++   W  F+S  + LSC     W         S
Sbjct: 1373 HTMYPLGVINFTAIVALVNVKCQFIEMNNRNWVVFTS--VILSCGGWLVWCCALPILNRS 1430

Query: 1405 GEFYKSA----AHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDI-------- 1452
               Y        H      +W   F   +  +       TF     P D DI        
Sbjct: 1431 DVIYDVPYGFFYHFGKDITWWCSCFVLAVLPITIDIVYQTFKTMIWPSDADIFSVLEQKS 1490

Query: 1453 -IRECWKRGDFDHYPEGYD-PTDPDRPKVKNAFV-YNKDIEMAQSSTDSIQTEEI 1504
             IR+  + G ++   +G+    DP      NAF  Y + I  A S + S   EE+
Sbjct: 1491 EIRKKLEMGAYNEMKQGWTWEHDP------NAFKRYKEKILTAHSRSGSYTDEEM 1539

 Score =  193 bits (490), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 148/514 (28%), Positives = 233/514 (45%), Gaps = 78/514 (15%)

Query: 229 ILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVAN 288
           ++DE  +S   Y  N I +++YT  +FFPK +  QF  VANVYF V+ I+          
Sbjct: 131 LIDERTSSV--YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMI------- 181

Query: 289 PGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKF 348
           PG +T      +V                       P  I  G+     + D     R  
Sbjct: 182 PGWSTTGTYTTIV-----------------------PLCIFMGISMAREAWDDFRRHRLD 218

Query: 349 KKANTRVLFRFIHLCQELFTEEGKKQRAQRKRHEMHNKIRQTQTPRNSLDSVGSYRNSME 408
           K+ N +        C  L  E   K      +      I        S DS   Y N+  
Sbjct: 219 KEENNKT-------CSILTKEFSNKPMPDDAQLPSRQNIDNL-----SNDSNTDYLNTKF 266

Query: 409 SEFGGDLTERGKDDLCLLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPAXXXXXX 468
           + F                P L      +  +  W ++ VGD V +  ++ +PA      
Sbjct: 267 NNF----------------PFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLT 310

Query: 469 XXXXXGACYVETKNLDGETNLKVRQ------SLKCSHMIRNSRNITRTKFKVESEGPHSN 522
                  C+VET  LDGETNLKV+Q       L CS     +  +      +  E P+S+
Sbjct: 311 SDGDNNECFVETMALDGETNLKVKQPHPELNKLACS-----ASGLANINALITVEDPNSD 365

Query: 523 LYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGV 582
           LY+++GNL+  D      K  PV  +N+  RG  +RNT   +G+V++TG +TKI +NA  
Sbjct: 366 LYNFEGNLELTDNNNNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALN 425

Query: 583 TP-TKVSRISRELNLSV-FMNFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAA 640
            P TK  ++ + +N+ + FM F +  +  F+   +  V         N   +     + A
Sbjct: 426 NPRTKAPKLQKNINIIITFMVFVVAVISLFS--YLGHVLQNKKAIDENQAWYLLTKDAGA 483

Query: 641 ANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTIS 700
           A  ++SF   +I+Y +++P+SLY+++EIIK  Q+  +  D+ +Y+   + PC  ++ TI 
Sbjct: 484 APTIMSF---IIMYNTIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATIL 540

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 734
           ++LGQ+ Y+FSDKTGTLT N M F+K +I G S+
Sbjct: 541 EELGQVSYMFSDKTGTLTDNKMIFRKFSICGSSW 574

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 104/190 (54%), Gaps = 47/190 (24%)

Query: 815 FMLALALCHTVLVEEN---KDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIVD 871
           F+L+LALCHT L +++   +   +++++++ SPDE ALV  ARD+G+  + +  + + + 
Sbjct: 702 FILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADVLTIK 761

Query: 872 I-------QGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYS 924
                   + + ++Y++LN ++FNS RKRMS ++K P E PN   + LLICKGAD++I  
Sbjct: 762 TYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTPDE-PN---KVLLICKGADNMILE 817

Query: 925 RLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWN----EKHEIAAAALV 980
           RL                               R+L++++ ++ N    E+ E+ A  ++
Sbjct: 818 RLQ-----------------------------DRDLAYQKMEDINRNTRERKELEAGLVI 848

Query: 981 DREDEMEKVA 990
           ++   +E++A
Sbjct: 849 EQRKSLERMA 858

>Scas_505.4
          Length = 1025

 Score =  229 bits (583), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 200/372 (53%), Gaps = 8/372 (2%)

Query: 1101 KVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVK 1160
            K+ +       ++IDG +L  AL +D ++   L L K CKAV+CCRVSP QKA VVK+VK
Sbjct: 549  KLSQHEMNTLALVIDGKSLSYALESD-LEDYLLALGKICKAVVCCRVSPLQKALVVKMVK 607

Query: 1161 NTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGR 1220
                 + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D A+GQFR+L +L+LVHG 
Sbjct: 608  RKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGS 667

Query: 1221 WSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLG 1280
            WSY+R++  I   FYKN    ++ FW+   N + G  + E   ++ +N+ FT  P   +G
Sbjct: 668  WSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIG 727

Query: 1281 ILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIV 1340
            + DQ V+  +    PQLY++G     ++   FW ++ +  Y S + +    L Y     +
Sbjct: 728  VFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMAL 787

Query: 1341 TQNGFGLDHRYW-VGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWS 1399
              +G   DH  W + V+ ++I +V     ++ +Q  W  F+   I  S +    +  I++
Sbjct: 788  NMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ--WTKFTLFAIPGSFIFWMIFFPIYA 845

Query: 1400 SF----TSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRE 1455
            S       S E++    H YG   FW  +    +F L+  F    + R Y P+   +++E
Sbjct: 846  SVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQE 905

Query: 1456 CWKRGDFDHYPE 1467
              K    D+ P 
Sbjct: 906  MQKFNISDNRPH 917

 Score =  142 bits (359), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 111/193 (57%), Gaps = 6/193 (3%)

Query: 438 FAKDYWKSVSVGDIVRVHNNDEIPAXXXXXXXXXXXGACYVETKNLDGETNLKVRQSLKC 497
           F +  W  +  GD++RV + + IPA           G CY+ET NLDGETNLK++Q+   
Sbjct: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392

Query: 498 SHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTL 557
           +  + +SR +   K KV SE P+S+LY+Y+G L++ +R+       P++   ++LRG TL
Sbjct: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI------PLSPEQMILRGATL 446

Query: 558 RNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNG 617
           RNT W  G+V+FTG +TK+M NA  TP K + + R +NL +   F +L VL   + + N 
Sbjct: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALFGVLIVLVLISSLGNA 506

Query: 618 VYYRTDNTSRNYF 630
           +   T     +Y 
Sbjct: 507 IISSTQEKHLSYL 519

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 8/112 (7%)

Query: 217 RTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLI 276
           R IY N        D   N    Y  N I TTKY   TF PK +  +F   AN++FL   
Sbjct: 222 REIYLN--------DRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTA 273

Query: 277 IMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNAPTHI 328
            +         N       L+V++++++FK++IED +R   D E+NN+ T I
Sbjct: 274 AIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEI 325

>Scas_89.1
          Length = 271

 Score =  152 bits (384), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 154/286 (53%), Gaps = 34/286 (11%)

Query: 965  YQEWNEKHEIAAAALVDREDEMEKVADV-IERELTLLGGTAIEDRLQDGVPDSIATLGEA 1023
            Y ++ +++  A+ ++++ ++ M  V    +E  L LLG T +ED+LQ+ V  SI  L  A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 1024 GIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYL 1083
            G+K+W+LTGDKVETA  +  S  L++    +  +           S+P            
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKL--------SRP------------ 101

Query: 1084 QEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVL 1143
                   G+   LE  K        +  ++IDG++L + L     K+EF  +     AV+
Sbjct: 102  ------EGALNALEYLK-----INKSSCLLIDGESLGMFLTY--YKQEFFDIVVDLPAVI 148

Query: 1144 CCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDY 1203
             CR +P QKA V  L++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++D+
Sbjct: 149  ACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADF 208

Query: 1204 AIGQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGV 1249
            ++ QF +LT+L+L HGR SYKR A++     ++ +I ++    Y V
Sbjct: 209  SVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSV 254

>Kwal_26.9207
          Length = 1469

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 102/425 (24%), Positives = 178/425 (41%), Gaps = 96/425 (22%)

Query: 812  NENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKN----- 866
            + NF+++L  CH++ V + +   + +DFK       +     +D  F  +   +N     
Sbjct: 842  SRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTL 901

Query: 867  ----GVIVDIQGVQKE-----------YRLLNVL---EFNSTRKRMSCILKIPSENPNEE 908
                G+   +     E           + LL V+   EF S  +RMS I+K     P  E
Sbjct: 902  PENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVK-----PYGE 956

Query: 909  PRALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQREL---SWKEY 965
                   KGA  +I    +K+      E+    L+QY   G R +  A + L   +W+  
Sbjct: 957  NVFWGFTKGAPEVISEICNKSTLPANYEQI---LQQYTHNGYRVIACAGKTLPKRTWRFA 1013

Query: 966  QEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGI 1025
            Q+            V RE+        +E  +  LG    E++L+     ++A+L +AGI
Sbjct: 1014 QK------------VSREE--------VESNMEFLGFVVFENKLKPSTTPTLASLQDAGI 1053

Query: 1026 KLWVLTGDKVETAINIGFSCNL----------LNNEM---ELLVIKASGDDVDIYGSKPA 1072
            +  + TGD V TAI++G    L          +N+ M   E L+I    DD D+      
Sbjct: 1054 RSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDL------ 1107

Query: 1073 EIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREF 1132
             I+  + L+       M+GS                ++ + + GD  +L  +N++V  E 
Sbjct: 1108 -ILDGVTLE------PMNGS---------------SDYTIAVTGDVFRLLFKNNEVLPES 1145

Query: 1133 LLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGE 1192
             +     K+ +  R+SP +K  +V  ++  LD +    GDG+ND   +++AD+GV ++  
Sbjct: 1146 YINMVLLKSSIYARMSPDEKHELVGQLQG-LDYVVGFCGDGANDCGALKAADVGVSLSEA 1204

Query: 1193 EGRQA 1197
            E   A
Sbjct: 1205 EASVA 1209

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 144/318 (45%), Gaps = 41/318 (12%)

Query: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTAL 940
            ++   EF S  +RMS I+K  SEN       +   KGA  +I+   SK      L+  AL
Sbjct: 912  IVRSFEFLSNLRRMSVIVKPFSEN-----VFMSFTKGAPEVIFELCSKQTLP--LDYEAL 964

Query: 941  HLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLL 1000
             L  Y   G R +  A ++L+    Q W    +++      RE+        IE  L  L
Sbjct: 965  -LHHYTHNGYRVIACAGKKLT---RQSWLYSQKVS------REE--------IESNLEFL 1006

Query: 1001 GGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKAS 1060
            G    E++L+    +++ +L  A I+  + TGD V TAI++G    L+ +     V  + 
Sbjct: 1007 GFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPR---VFVSV 1063

Query: 1061 GDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAK-KVHEPPTGNFGVIIDGDAL 1119
             +D+D   S+  +I+             ++ S + L+    +     T ++ + + G+  
Sbjct: 1064 INDIDT--SQEGDIITWQ---------NVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVF 1112

Query: 1120 KLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAM 1179
            +L  + D  + E ++     K  +  R+SP +K  +V+ ++ ++       GDG+ND   
Sbjct: 1113 RLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDGANDCGA 1171

Query: 1180 IQSADIGVGIAGEEGRQA 1197
            +++ADIG+ ++  E   A
Sbjct: 1172 LKAADIGISLSEAEASVA 1189

>Scas_665.30
          Length = 1439

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 140/322 (43%), Gaps = 48/322 (14%)

Query: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTAL 940
            ++   EF S  +RMS I+K     P+ E       KGA  +I    +K       E+   
Sbjct: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVITQICNKATLPANFEEM-- 756

Query: 941  HLEQYATEGLRTLCIAQREL---SWKEYQEWNEKHEIAAAALVDREDEMEKVADVIEREL 997
             L  Y  +G R +  A R L   +W   Q+            V RE+        +E  +
Sbjct: 757  -LNYYTHKGYRVIACAGRVLPRNTWLYSQK------------VSREE--------VESNM 795

Query: 998  TLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVI 1057
              LG    E++L+     ++ TL EA I+  + TGD V TAI++G  CNL+ ++    V 
Sbjct: 796  EFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKK---VY 852

Query: 1058 KASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGD 1117
              S +++D  G        ++I + +        S   L     ++   + ++ + I GD
Sbjct: 853  VPSLEEIDSTGQ------TSIIWRDVDNMDDTLDSRTLL----PINNSSSTSYTLAITGD 902

Query: 1118 ALKLAL--RNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1175
              ++     N+ +  +++      K  +  R+SP +K  +++ ++  L+      GDG+N
Sbjct: 903  IFRIIFGDENNSISEDYINTV-LLKGTIYARMSPDEKHELMEQLQR-LNYTVGFCGDGAN 960

Query: 1176 DVAMIQSADIGVGIAGEEGRQA 1197
            D   +++AD+G+ ++  E   A
Sbjct: 961  DCGALKAADVGISLSEAEASVA 982

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 136/320 (42%), Gaps = 46/320 (14%)

Query: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTAL 940
            ++   EF S  +RMS I+K     PN E       KGA  +I   +   N   L      
Sbjct: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVI---IDICNPATLPSDYDD 967

Query: 941  HLEQYATEGLRTLCIAQREL---SWKEYQEWNEKHEIAAAALVDREDEMEKVADVIEREL 997
             L  Y   G R +  A + L   +W   Q+            V RE+        +E  +
Sbjct: 968  ILNFYTHSGYRVIACAGKTLPKNTWLYSQK------------VRREE--------VESNM 1007

Query: 998  TLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVI 1057
              LG    +++L+D    +++ L  A I+  + TGD V TAI++G  C L+  E  + V 
Sbjct: 1008 EFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLI-TEDRVYVP 1066

Query: 1058 KASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGD 1117
              +  D+ +        + N   +++ + F +    + +++        +G + + I G+
Sbjct: 1067 TVAYSDMTVQPVIHWNEISN--AEHILDTFTL----QPIDDY-------SGPYTLAITGE 1113

Query: 1118 ALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDV 1177
              ++   N D   E  +     K  +  R+SP +K  +V+ ++  +D      GDG+ND 
Sbjct: 1114 VFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDGANDC 1172

Query: 1178 AMIQSADIGVGIAGEEGRQA 1197
              +++AD+G+ ++  E   A
Sbjct: 1173 GALKAADVGISLSEAEASVA 1192

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 81/330 (24%), Positives = 133/330 (40%), Gaps = 66/330 (20%)

Query: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTAL 940
            ++   EF S  +RMS I+K   EN           KGA  +I    +     K   +   
Sbjct: 903  VIRSFEFLSELRRMSVIVKGFKENTYWS-----FTKGAPEVIADICNPATIPKDFHEL-- 955

Query: 941  HLEQYATEGLRTLCIAQREL---SWKEYQEWNEKHEIAAAALVDREDEMEKVADVIEREL 997
             L  Y   G R +  A + L   SW   Q+            V RE+        +E  L
Sbjct: 956  -LHHYTHNGFRIIACAGKTLPKSSWLYSQK------------VSREE--------VEDNL 994

Query: 998  TLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNL---------- 1047
              LG    E++L+     ++  L  A I+  + TGD V TA+++G    L          
Sbjct: 995  EFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPF 1054

Query: 1048 LNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPT 1107
            LN+ +E      S  DVD  GS    ++  + LK L +                    P 
Sbjct: 1055 LNDNLEESRHLLSWRDVDEEGS----VLDAVTLKPLND--------------------PE 1090

Query: 1108 GNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMT 1167
             ++ + I GD  ++  RND++  +  +     K  +  R+SP +K  +V+ ++  LD   
Sbjct: 1091 KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-LDYNV 1149

Query: 1168 LAIGDGSNDVAMIQSADIGVGIAGEEGRQA 1197
               GDG+ND   +++A+IG+ ++  E   A
Sbjct: 1150 GFCGDGANDCGALKAANIGISLSEAEASVA 1179

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 140/322 (43%), Gaps = 50/322 (15%)

Query: 885  LEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQ 944
             EF S  +RMS I+K      N +       KGA  +I    +K+      E+    L  
Sbjct: 932  FEFLSELRRMSVIVKT-----NNDDVYWSFTKGAPEVISEICNKSTLPADFEEV---LRC 983

Query: 945  YATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTA 1004
            Y   G R +  A + L  + +  +++K        V RE+        +E  L  LG   
Sbjct: 984  YTHNGYRVIACAGKTLPKRTWL-YSQK--------VSREE--------VESNLEFLGFII 1026

Query: 1005 IEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDV 1064
             +++L+    +++ +L +A I+  + TGD + TAI++G    L+       V   S +D 
Sbjct: 1027 FQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR---VYVPSINDT 1083

Query: 1065 DIYG---------SKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIID 1115
             ++G         ++P +I+    LK ++     + S E L E          N+ + + 
Sbjct: 1084 PLHGEPVIVWRDVNEPDKILDTKTLKPVKLG---NNSVESLREC---------NYTLAVS 1131

Query: 1116 GDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1175
            GD  +L  R+++   E  L      + +  R+SP +K  ++  ++  LD      GDG+N
Sbjct: 1132 GDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK-LDYTVGFCGDGAN 1190

Query: 1176 DVAMIQSADIGVGIAGEEGRQA 1197
            D   +++AD+G+ ++  E   A
Sbjct: 1191 DCGALKAADVGISLSEAEASVA 1212

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 83/371 (22%), Positives = 157/371 (42%), Gaps = 44/371 (11%)

Query: 703  LGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKE 762
            +G    + SDKTGTLT+NVM   +       +  + +  ++  RK     V EE      
Sbjct: 436  MGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENC--SS 493

Query: 763  GIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLALALC 822
             +  D   +LAN+ +          +  F ++++ ++    NG      N +F+      
Sbjct: 494  SLRND---LLANIVL---------NSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSR 541

Query: 823  HTVLVEENKDDPEIMDFK-----AQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQGVQK 877
             +   + N++D E   FK      Q P   +   TA           + G +  ++    
Sbjct: 542  LSFFKKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQPM 601

Query: 878  EY----RLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLS--KNND 931
            E     +++  + F S+RK    ++K   E  N++P      KGA  I+    S  +N+D
Sbjct: 602  EKFNIEKVVQTIPFESSRKWAGLVVKY-KEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSD 660

Query: 932  EKLLE-------KTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDRED 984
            + L E       +T   ++  A++ LR + +A ++    E   W  +       L D++ 
Sbjct: 661  DTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFC--ECDSWPPEQ------LRDKDS 712

Query: 985  EMEKVADVI---ERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINI 1041
                  D++   ++ L L G   I+D L+ GV +S+     AG+ + ++TGD + TA  I
Sbjct: 713  PNIAALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAI 772

Query: 1042 GFSCNLLNNEM 1052
              +C +L+ ++
Sbjct: 773  ARNCAILSTDI 783

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 1143 LCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIG--VGIAGEE-GRQA-- 1197
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ AD+G  +GI+G E  R+A  
Sbjct: 813  VLARSSPEDKRLLVETLKGMGDVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASD 871

Query: 1198 --VMSSDYA 1204
              +M+ D++
Sbjct: 872  IILMTDDFS 880

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 84/375 (22%), Positives = 155/375 (41%), Gaps = 58/375 (15%)

Query: 701  DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALE 760
            + +G    + SDKTGTLT+N+M   + T+     GRA  + +     +  +  +++ +  
Sbjct: 397  ETMGSATAVCSDKTGTLTENIMTVVRGTL-----GRAGFDDIGADPSKSNLVFKKKCSDL 451

Query: 761  KEGIAQDKEIMLANLKILGENSQLRPENVTFV----SKEFVQDTAGANGETQKKCNENFM 816
               +  D  ++  N           P N   +     +  ++       + +    EN  
Sbjct: 452  LRTVIYDNIVL--NSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKKKPDDEENL- 508

Query: 817  LALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTAR-DMGFSFVGRTKNGVIVDIQGV 875
                L H     E + +P I      S  E AL+  AR   G  F      G +   +G 
Sbjct: 509  ----LAHAA---EGRQEPYI-----GSKTETALLSLARKSFGLKF------GALQSFRGH 550

Query: 876  QKEY----RLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNN- 930
             ++      ++ ++ F S+RK  + ++K+ S   NE  +  L  KGA  I+    +  N 
Sbjct: 551  PEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNV 610

Query: 931  --------DEKLLEKTALHLEQYATEGLRTLCIAQREL---SW--KEYQEWNEKHEIAAA 977
                    D+K  +     +   A + LR + +A  +     W  KE  +    HE  A 
Sbjct: 611  CNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAV 670

Query: 978  ALVD-REDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVE 1036
             L+D ++  +E         LTL     I+D L++ V +S+A   +AG+ + ++TGD + 
Sbjct: 671  KLIDPKKPHLEG--------LTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLL 722

Query: 1037 TAINIGFSCNLLNNE 1051
            TA  I  +C +L+++
Sbjct: 723  TAKAIARNCGILSSK 737

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 135/311 (43%), Gaps = 53/311 (17%)

Query: 880  RLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRL-SKNNDEKLLEKT 938
            R+L   +F+S+ KR + I        ++  R     KGA   I  RL S  +D   + K+
Sbjct: 573  RILRRFQFSSSLKRSASI-------ASQSNRFFAAVKGAPETIRERLNSVPSDYDDIYKS 625

Query: 939  ALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELT 998
                  +   G R L +A ++L      + +          +DR        D IE  LT
Sbjct: 626  ------FTRSGSRVLALAYKDLPKMSNSQIDN---------IDR--------DEIETGLT 662

Query: 999  LLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIK 1058
                      L+D   ++I  L E+  +  ++TGD   TA+++     +++ E  +L   
Sbjct: 663  FGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLIL--- 719

Query: 1059 ASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDA 1118
                D  I GS  A +++++    ++     + +++E E  +K        + + + G A
Sbjct: 720  ----DEPIDGSSHALVMRDVNETIVKPFNPDADTFDEKEIFQK--------YDLAVTGHA 767

Query: 1119 LKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVA 1178
            LKL L+     R+ +         +  RVSP+QK  ++  +K+ +   TL  GDG+NDV 
Sbjct: 768  LKL-LQGHKQLRDVIR-----HTWIYARVSPSQKEFILITLKD-MGYQTLMCGDGTNDVG 820

Query: 1179 MIQSADIGVGI 1189
             ++ A +G+ +
Sbjct: 821  ALKQAHVGIAL 831

>Kwal_47.17547
          Length = 1240

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 86/379 (22%), Positives = 155/379 (40%), Gaps = 57/379 (15%)

Query: 701  DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALE 760
            + +G    + SDKTGTLT+N M   K  +    +  A  E++        +D+    A+ 
Sbjct: 420  ETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEA--ESVGPSDSETDVDL----AIA 473

Query: 761  KEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGANGETQK---------KC 811
             E   + K+ +L N+ +          +  F +KE  +D         K         + 
Sbjct: 474  NECSEELKKDVLTNITL---------NSTAFENKENEEDKVSNENPFHKPRKSLFPWSRN 524

Query: 812  NENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIVD 871
            N++   A A     LVE    D     F     + A L    +++G   +   ++    D
Sbjct: 525  NKSKKPATA---KELVENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEP--D 579

Query: 872  IQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRL--SKN 929
              G++K   ++ ++ F S+RK    ++K      N   R     KGA  ++  R    + 
Sbjct: 580  CLGIEK---IVQIIPFESSRKWGGIVVKYK----NGLHR--FYIKGAAELLLRRCMQKRA 630

Query: 930  NDEKL-------LEKTALHLEQYATEGLRTLCIAQREL----SWKEYQEWNEKHEIAAAA 978
            +D KL        ++ +  +   A E LR + +A R+     +W   +  +E    AA+ 
Sbjct: 631  SDSKLTLISQKDFDEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASP 690

Query: 979  ------LVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTG 1032
                   V R D + + A  +   + L G   I+D L+ GV  S+    +AG+ + ++TG
Sbjct: 691  DLLFGDEVSRSDSVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTG 750

Query: 1033 DKVETAINIGFSCNLLNNE 1051
            D + TA  I   C++L+ E
Sbjct: 751  DNILTATAIAKKCSILSEE 769

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 69/154 (44%), Gaps = 19/154 (12%)

Query: 1143 LCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIG--VGIAGEE-GRQA-- 1197
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ AD+G  +GIAG E  R+A  
Sbjct: 800  VLARSSPEDKRILVETLKKMGDVVAVT-GDGTNDAPALKLADVGFSMGIAGTEVAREASD 858

Query: 1198 --VMSSDYA--IGQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNY 1253
              +M+ D++  +   ++        GR     + + I      NV   +  F   V ++ 
Sbjct: 859  IILMTDDFSAIVNAIKW--------GRCVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSE 910

Query: 1254 DGSYLFEYTYLTLFNLAFTSLPVIFLGILDQDVN 1287
            + S L     L + NL   +L  + L     D N
Sbjct: 911  EASVLTAVQLLWV-NLIMDTLAALALATDKPDEN 943

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 130/323 (40%), Gaps = 59/323 (18%)

Query: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRL---SKNNDEKLLEK 937
            +L   +F+S  KR S +          + +     KGA   I  RL     N DE     
Sbjct: 574  ILRRFQFSSALKRSSSV-------ATHDGKLYSAVKGAPETIRERLFTIPANYDEIY--- 623

Query: 938  TALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIEREL 997
                 + +   G R L +A ++L         EK   +     DRE          ER+L
Sbjct: 624  -----KSFTRSGSRVLALASKKL---------EKMSQSQIEDADREH--------FERDL 661

Query: 998  TLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVI 1057
               G       L+    ++I  L E+  +  ++TGD   TA+++     ++  E  ++ +
Sbjct: 662  EFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIVDM 721

Query: 1058 KASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGD 1117
              +G+D D    +  E   +      ++ F+  G +++ + A   H             +
Sbjct: 722  VDNGND-DKLVFRNVEETLSFEFVVSKDSFEKYGIFDKYDLAVTGHAL-----------E 769

Query: 1118 ALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDV 1177
            ALK   +  D+ R          A +  RVSPAQK  ++  +K+ +   TL  GDG+NDV
Sbjct: 770  ALKGHHQLQDLIRH---------AWIYARVSPAQKEFILNNLKD-MGYQTLMCGDGTNDV 819

Query: 1178 AMIQSADIGVGI--AGEEGRQAV 1198
              ++ A +GV +    EEG + V
Sbjct: 820  GALKQAHVGVALLNGTEEGLKKV 842

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 136/321 (42%), Gaps = 63/321 (19%)

Query: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSK-NNDEKLLEKTA 939
            +L   +F+S  KR S I    + +  +   A+   KGA   I  RLS+   D   + K+ 
Sbjct: 577  ILRRFQFSSALKRSSTI----AVHNKQHYSAV---KGAPETIRERLSQVPTDYDQVYKS- 628

Query: 940  LHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTL 999
                 +   G R L +A ++L                +  + + +++E+  + +E +L  
Sbjct: 629  -----FTRAGSRVLALASKKLP---------------SMSIKQIEKLER--EAVESDLEF 666

Query: 1000 LGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKA 1059
             G       L+D   ++I  L E+  +  ++TGD   TA+++     ++  E  +L    
Sbjct: 667  KGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLIL---- 722

Query: 1060 SGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDAL 1119
               D  I GS  A + +N+    +        ++E        H      + + + G AL
Sbjct: 723  ---DEPIDGSSHALVFRNIEETIVNPFNPEKDTFE--------HSKLFAKYDIAVTGHAL 771

Query: 1120 KL----ALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1175
            +L    +  N+ ++  ++            RVSPAQK  ++  +K+ +   TL  GDG+N
Sbjct: 772  QLLSGHSQLNELIRHTWVY----------ARVSPAQKEFIMNSLKD-MGYQTLMCGDGTN 820

Query: 1176 DVAMIQSADIGVGI--AGEEG 1194
            DV  ++ A +G+ +    EEG
Sbjct: 821  DVGALKQAHVGIALLNGTEEG 841

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 116/287 (40%), Gaps = 56/287 (19%)

Query: 915  CKGADSIIYSRLS---KNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEK 971
             KGA   I  RLS   KN DE          + +   G R L +A + L      + ++ 
Sbjct: 603  VKGAPETIRERLSDIPKNYDEIY--------KSFTRSGSRVLALASKSLPKMSQSKIDD- 653

Query: 972  HEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLT 1031
                    ++R+D        +E ELT  G       L+D   ++I  L E+  +  ++T
Sbjct: 654  --------LNRDD--------VESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMIT 697

Query: 1032 GDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSG 1091
            GD   TA+++     ++  E  +L      DD              L+ + ++E   +  
Sbjct: 698  GDNPLTAVHVAKEVGIVFGETLILDRAGKSDD------------NQLLFRDVEETVSIP- 744

Query: 1092 SYEELEEAKKV--HEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSP 1149
                 + +K    H      + + + G AL  AL      R+ L         +  RVSP
Sbjct: 745  ----FDPSKDTFDHSKLFDRYDIAVTGYALN-ALEGHSQLRDLLR-----HTWVYARVSP 794

Query: 1150 AQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGI--AGEEG 1194
            +QK  ++  +K+ +   TL  GDG+NDV  ++ A +G+ +    EEG
Sbjct: 795  SQKEFLLNTLKD-MGYQTLMCGDGTNDVGALKQAHVGIALLNGTEEG 840

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 91/188 (48%), Gaps = 28/188 (14%)

Query: 880  RLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLS--KNND------ 931
            +++ V+ F S+RK  +  +++     N+  R     KGA  I+    S  +N+D      
Sbjct: 631  KVVQVIPFESSRKWGAIAVQLAD---NKGYR--FYAKGAAEILLKVCSNQRNSDNSIVPM 685

Query: 932  -EKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKH-------EIAAAALVDRE 983
             + L +++   ++  A+  LRT+ +  R+     ++EW  K         IA+  LV   
Sbjct: 686  NQDLYDESFKKIQDMASHALRTISLVHRD-----FKEWPPKEFADSTDPSIASPDLVMGH 740

Query: 984  DEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGF 1043
            +   K  ++    +TL     ++D L++GV +S+     AG+ + ++TGD + TA  I  
Sbjct: 741  ELDHK--NLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISR 798

Query: 1044 SCNLLNNE 1051
            +CN+L+ E
Sbjct: 799  NCNILSEE 806

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 1140 KAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIG--VGIAGEE-GRQ 1196
            K  +  R SP  K  +V+ +K   +V+ +  GDG+ND   ++ AD+G  +GI+G E  R+
Sbjct: 834  KLRVLARSSPEDKRILVETLKKMGEVVAVT-GDGTNDAPALKLADVGFSMGISGTEVARE 892

Query: 1197 A----VMSSDY 1203
            A    +M+ D+
Sbjct: 893  ASDIILMTDDF 903

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 142/671 (21%), Positives = 253/671 (37%), Gaps = 156/671 (23%)

Query: 650  ALILYQSVVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYI 709
            A+ +  S++P SL + + I  +A A  +     +   +LD           + LG +  I
Sbjct: 317  AICVALSMIPSSLVVVLTITMSAGAK-VMATRHVIIRKLDS---------LEALGAVNDI 366

Query: 710  FSDKTGTLTQNVMEFKKC------TINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEG 763
             SDKTGTLTQ  M  K+       TIN  +    +   +  ++        +    ++E 
Sbjct: 367  CSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEED 426

Query: 764  IAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLALALCH 823
            +      M+ + K      +L P NV+  ++     T                  LA   
Sbjct: 427  VG-----MITDFKSKYYADELGPLNVSLFTQWLYTAT------------------LANIA 463

Query: 824  TVLVEENKDDPEIMDFKAQS-PDEAAL--VGTARDMGFSFVGRTKNGVIVDIQGVQKEYR 880
            TV       DPE  D+KA   P E A+    T  D+    +    N    D + +  +  
Sbjct: 464  TVF-----RDPETQDWKAHGDPTEIAIQVFATRMDLPRRVLTGEDND---DEKNIHNDIT 515

Query: 881  LLNVLE--FNSTRKRMSCILKIPSENPNEEPRALL---ICKGADSIIYSRLSKNND---- 931
              +V E  F+S+ KRMS I K       EEP+A +     KGA    + R+ +  +    
Sbjct: 516  FEHVAEYPFDSSVKRMSAIYK-----NVEEPKAPIYEVFTKGA----FERVLQCCNSWYT 566

Query: 932  ----------EKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVD 981
                      E+ LE    +++  ++EGLR L  A++  +  ++                
Sbjct: 567  TPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNESQF--------------TI 612

Query: 982  REDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINI 1041
             +D++ K  D +E  LT LG   I D  +     ++     AGI + +LTGD   TA +I
Sbjct: 613  NKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSI 672

Query: 1042 GFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKK 1101
                 +L + +                  P E+V  +++         +  ++ L + K+
Sbjct: 673  AQEVGILPHNLY---------------HYPKEVVNFMVMT--------ATDFDALSD-KE 708

Query: 1102 VHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLV-- 1159
            + E P                           L+  RC        +P  K  +++ +  
Sbjct: 709  IDELPV------------------------LPLVIARC--------APQTKVRMIEALHR 736

Query: 1160 KNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLV-H 1218
            +N    MT   GDG ND   ++ A++G+ +       A  +SD  +    + + L  V  
Sbjct: 737  RNRFCAMT---GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEE 793

Query: 1219 GRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYL-TLFNLAFTS-LPV 1276
            GR     + + +     +NV   L L     + + +G  +F  + +  L+ +  TS  P 
Sbjct: 794  GRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVEVLWVIVVTSCFPA 853

Query: 1277 IFLGILDQDVN 1287
            + LG+   +V+
Sbjct: 854  MGLGLEKANVD 864

>Scas_583.14*
          Length = 875

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/348 (22%), Positives = 133/348 (38%), Gaps = 68/348 (19%)

Query: 857  GFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICK 916
            G  F  R K G          + ++L   +F+S  KR S +        + + +     K
Sbjct: 216  GNDFTSRPKTG----------KLQILRRFQFSSALKRSSSV-------ASHKDKLFTAVK 258

Query: 917  GADSIIYSRLS---KNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHE 973
            GA   I  RL+   KN DE          + +   G R L +A + L     ++ ++   
Sbjct: 259  GAPETIRERLAVVPKNYDEIY--------KSFTRSGSRVLALASKSLPNLSSKQLDD--- 307

Query: 974  IAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGD 1033
                  +DR        D IE  LT  G       L+    ++I  L E+  +  ++TGD
Sbjct: 308  ------LDR--------DEIETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGD 353

Query: 1034 KVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSY 1093
               TA+++     ++  E  +L    +  D  +      E +K +      +KF      
Sbjct: 354  NPLTAVHVAKEVAIVTGETLILDKSETVGDGKLLFFNVEETIK-IPFDPASDKFD----- 407

Query: 1094 EELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKA 1153
                     H      + + + G AL L   +  +K     L +     +  RVSP+QK 
Sbjct: 408  ---------HRELFDKYDIAVTGYALNLLEDHSQLKD----LIRH--TWVYARVSPSQKE 452

Query: 1154 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA-GEEGRQAVMS 1200
             ++  +K  +   TL  GDG+NDV  ++ A +GV +  G E     M+
Sbjct: 453  FILNNLKE-MGYQTLMCGDGTNDVGALKQAHVGVALLNGTEESMTAMA 499

>Kwal_23.3160
          Length = 1100

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 124/539 (23%), Positives = 201/539 (37%), Gaps = 94/539 (17%)

Query: 549  NLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVL 608
            NL     T+   + A GIVV TG +T+I   A       S IS++ N + + N  +    
Sbjct: 213  NLAFASSTVSKGR-ATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAA 271

Query: 609  CFAA--GIVNGV-YYRTDNTSRNYFEFGSIAGSAAANGVVSFWV-------ALILYQSVV 658
               +  G   G   +R  +       F ++  +        F V       A+ +  S++
Sbjct: 272  TIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVNKEVAIYAICVAVSMI 331

Query: 659  PISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLT 718
            P SL + + I  +  A  I     +   +LD           + LG +  + SDKTGTLT
Sbjct: 332  PSSLVVVLTITMSVGAK-IMATRNVVVRKLDS---------LEALGAVNDVCSDKTGTLT 381

Query: 719  QNVM--------EFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEI 770
            Q  M         F   T++  S     T+    L  R      +  + E  GI    + 
Sbjct: 382  QGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKN 441

Query: 771  MLANLKI-LGENSQL--------RPENVTFVSKEFVQDTAGANGETQKKCNENFMLALAL 821
               N K+  G NS+L           N+  V ++   +   A+G+  +   + F   L +
Sbjct: 442  KFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDM 501

Query: 822  CHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQGVQKEYRL 881
                L  E+K D E         DE A +G                       V+  Y+ 
Sbjct: 502  PRNALTAEDKSDSE--------SDEDAALGE------------------KTSSVEPHYKH 535

Query: 882  LNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSK-------NNDEKL 934
            +    F+S+ KRMS +      + +E+    +  KGA   +    +K        +D K 
Sbjct: 536  IAEFPFDSSIKRMSAVYV----SLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKP 591

Query: 935  L-----EKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKV 989
            +     E+   ++E  ++EGLR L  A +  S+ E Q           AL   ED + K 
Sbjct: 592  MTEEDKEEVFKNVETLSSEGLRVLAFATK--SFTESQ-----------ALKVSED-LRKN 637

Query: 990  ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLL 1048
             D +E +L   G   I D  +     ++    +AGI + +LTGD   TA  I     +L
Sbjct: 638  RDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGIL 696

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 103/423 (24%), Positives = 164/423 (38%), Gaps = 76/423 (17%)

Query: 650  ALILYQSVVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYI 709
            A+ +  S++P SL + + I  +A A  +     +   +LD           + LG +  I
Sbjct: 317  AICVAISMIPSSLVVVLTITMSAGAK-VMATRNVIVRKLDS---------LEALGAVNDI 366

Query: 710  FSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKE 769
             SDKTGTLTQ  M  K+  I    +G               I V+E        I    E
Sbjct: 367  CSDKTGTLTQGKMIAKQVWIP--QFGT--------------ITVQESNEPFNPTIG---E 407

Query: 770  IMLANLKILGENSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEE 829
            I L       +      E+V  +     +  AG  G       + ++    L +   V +
Sbjct: 408  IHLIPKFSPYQYKHDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQ 467

Query: 830  NKDDPEIMDFKAQS-PDEAALVGTARDMGFS---FVGRTKNGVIVDIQGVQKEYRLLNVL 885
               D E  D+KA   P E A+   A  M        G  K+    D +  +      +V 
Sbjct: 468  ---DSETQDWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKD----DEKDARANSSFEHVA 520

Query: 886  EF--NSTRKRMSCILKIPSENPNEEPRALLICKGADSIIY--------------SRLSKN 929
            EF  +S+ KRMS I K  +E+P   P   +  KGA   +               S LSK 
Sbjct: 521  EFPFDSSVKRMSAIYK-NTEDP-ATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKE 578

Query: 930  NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKV 989
            +    LE    +++  ++EGLR L  A++  +  E+                 +D++ K 
Sbjct: 579  D----LETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLLKE 620

Query: 990  ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1049
             D +E +LT LG   I D  +     ++    +AGI + +LTGD   TA +I     +L 
Sbjct: 621  RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILP 680

Query: 1050 NEM 1052
            + +
Sbjct: 681  HNL 683

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 79/185 (42%), Gaps = 45/185 (24%)

Query: 871  DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNN 930
            ++  V+ EY  +  L FNS RK M+  ++      + E +  L  KGA    + R+   +
Sbjct: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGA----FERILDKS 513

Query: 931  DEKLLEK------TALHLEQ-------YATEGLRTLCIAQRELSWKEYQEWNEKHEIAAA 977
               L EK      TA H E         A+EGLR L  A+R ++             +++
Sbjct: 514  SSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTD------------SSS 561

Query: 978  ALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVET 1037
             LV  ED++         +L   G   + D  +  V  +I    + GI + ++TGD   T
Sbjct: 562  KLV--EDDIS--------DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENT 611

Query: 1038 AINIG 1042
            A+NI 
Sbjct: 612  AVNIA 616

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA 1190
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ ADIGV + 
Sbjct: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 92/199 (46%), Gaps = 49/199 (24%)

Query: 882  LNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGA-DSIIYSRLS-----------KN 929
            +N + FNS RK M+    + + + N+  + ++  KGA + I+   ++           K 
Sbjct: 460  INEIPFNSKRKFMA----VKTIDAND--KVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513

Query: 930  NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEY-QEWNEKHEIAAAALVDREDEMEK 988
            ND+ ++   A+ L   A+EGLRTL  A+ E+S     +E+NE                  
Sbjct: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEVSATHGDKEFNE------------------ 552

Query: 989  VADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIG--FSCN 1046
              D++E  LT  G  A+ D  +  V  +I  L +  + + ++TGD   TA++I       
Sbjct: 553  --DMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIP 609

Query: 1047 LLNNEMELLVIKASGDDVD 1065
            ++N E  +L    SGD +D
Sbjct: 610  VINPEYSVL----SGDKLD 624

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA------GEEGRQAV 1198
             R +P  K  +V+ ++   D++ +  GDG ND   ++ ADIGV +        +E    V
Sbjct: 642  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV 700

Query: 1199 MSSD 1202
            ++ D
Sbjct: 701  LTDD 704

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGA 758
           + LG +  I SDKTGTLT N M   K    G    +    AL+ +++R  I +E++ A
Sbjct: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERP-IKMEQDVA 411

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 82/195 (42%), Gaps = 48/195 (24%)

Query: 885  LEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSK------------NNDE 932
            L FNS RK M+    +  ++P    + ++  KGA   I  R +             ++ +
Sbjct: 483  LTFNSKRKYMA----VKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538

Query: 933  KLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADV 992
             L+   A   +  A+EGLRTL  AQ E S  +                        + D 
Sbjct: 539  SLINDCA---KSLASEGLRTLAFAQLECSTNK-----------------------PMNDS 572

Query: 993  IERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIG--FSCNLLNN 1050
              + LT +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI       ++N 
Sbjct: 573  TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINP 632

Query: 1051 EMELLVIKASGDDVD 1065
            E+ +L    +GD +D
Sbjct: 633  EISVL----TGDRLD 643

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA------GEEGRQAV 1198
             R +P  K  +V+ ++   D++ +  GDG ND   ++ ADIGV +        +E    V
Sbjct: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMGHMGTDVAKEASDMV 719

Query: 1199 MSSD 1202
            ++ D
Sbjct: 720  LTDD 723

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 81/189 (42%), Gaps = 26/189 (13%)

Query: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSR---LSKNNDEKLLEK 937
            ++ ++ F S+RK    ++++   N           KGA   I+     +  +ND+ +   
Sbjct: 574  IVQMIPFESSRKWAGLVVRLVDGNYR------FFIKGASETIFKSCHYMRSSNDDVIKLS 627

Query: 938  TALHLEQY------ATEGLRTLCIAQREL----SWKEYQEWNEKHEIAAAALVDREDEME 987
               H E +      A++ LRT+ +A ++     SW   +  +      A+  +   DE  
Sbjct: 628  PQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYV 687

Query: 988  KVA----DVIERE---LTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAIN 1040
              A     +I      L L G   I D L+ GV +S+    ++G+ + ++TGD + T   
Sbjct: 688  PTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRA 747

Query: 1041 IGFSCNLLN 1049
            I  +C +L+
Sbjct: 748  IARACGILS 756

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 8/71 (11%)

Query: 1140 KAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADI-------GVGIAGE 1192
            K  +  R SP  K   V ++K   +V+ +  GDG+ND   +  AD+       G G+A E
Sbjct: 786  KLKVLARSSPEDKRIFVDILKKMNEVVAVT-GDGTNDAPALTLADVGFSMGISGTGVARE 844

Query: 1193 EGRQAVMSSDY 1203
                 +M+ D+
Sbjct: 845  ASDIILMTDDF 855

>Scas_297.1
          Length = 800

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 1143 LCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIG--VGIAGEE-GRQA-- 1197
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ AD+G  +GI+G E  R+A  
Sbjct: 51   VMARSSPEDKRLLVETLKGMGDVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASD 109

Query: 1198 --VMSSDYA 1204
              +M+ D+A
Sbjct: 110  IILMTDDFA 118

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 77/191 (40%), Gaps = 39/191 (20%)

Query: 885  LEFNSTRKRMSCILKIPSENPNEEPRALLICKGA------DSIIYSRLSKNNDEKLLEKT 938
            L FNS RK M+  +  P +N     +  +  KGA       S  Y +      EKL E  
Sbjct: 475  LPFNSKRKLMATKILNPVDN-----KCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQ 529

Query: 939  ALHLEQ----YATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIE 994
               + +     A+EGLR    A+  LS                      D    + + + 
Sbjct: 530  KATINECANSMASEGLRVFGFAKLTLS----------------------DSSTPLTEDLI 567

Query: 995  RELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMEL 1054
            ++LT  G   + D  +  V  +I  L + G+ + ++TGD   TA+NI     +   + +L
Sbjct: 568  KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKL 627

Query: 1055 LVIKASGDDVD 1065
             V+  SGD +D
Sbjct: 628  SVL--SGDKLD 636

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 88/200 (44%), Gaps = 52/200 (26%)

Query: 542 NEPVNINNLLLRGC-----TLRNTKWAMGIVVFTGPDTKI-----MLN---AGVTPTKVS 588
           ++P +I  +  R C     TL       GIVV TG +T       M+N      TP +++
Sbjct: 223 DQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLT 282

Query: 589 --RISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVS 646
             ++ ++L+L   ++F ++ ++C   GI+ G         R++ E   I+        VS
Sbjct: 283 MDKLGKDLSL---VSFIVIGMICLV-GIIQG---------RSWLEMFQIS--------VS 321

Query: 647 FWVALILYQSVVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQI 706
             VA I     + +++ +++ +++ A+   I         RL     P   T    LG +
Sbjct: 322 LAVAAIPEGLPIIVTVTLALGVLRMAKRKAIV-------RRL-----PSVET----LGSV 365

Query: 707 EYIFSDKTGTLTQNVMEFKK 726
             I SDKTGTLT N M   K
Sbjct: 366 NVICSDKTGTLTSNHMTVSK 385

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA------GEEGRQAV 1198
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ +DIGV +        +E    V
Sbjct: 654  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMV 712

Query: 1199 MSSD 1202
            ++ D
Sbjct: 713  LTDD 716

>Scas_710.41
          Length = 904

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGID 752
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 354 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAATRKKKGLD 407

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 82/208 (39%), Gaps = 54/208 (25%)

Query: 878  EYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNND--EKLL 935
            +Y++L    F+   K+++ ++K P      E   +   KGA   +   + +++   E + 
Sbjct: 429  KYKILEFHPFDPVSKKVTAVVKSP------EGETITCVKGAPLFVLKTVEEDHPVPEDVH 482

Query: 936  EKTALHLEQYATEGLRTLCIAQR--ELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVI 993
            E     + + A+ G R+L +A++  E  W+                              
Sbjct: 483  ENYENKVAELASRGFRSLGVARKRGEGYWE------------------------------ 512

Query: 994  ERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKV----ETAINIGFSCNLLN 1049
                 +LG     D  +D    +IA     G+++ +LTGD V    ET+  +G   N+ N
Sbjct: 513  -----ILGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYN 567

Query: 1050 NEMELLVIKASGDDVDIYGSKPAEIVKN 1077
             E   L         D+ GS+ A+ V+N
Sbjct: 568  AEKLGLGGGG-----DMPGSELADFVEN 590

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDVEEEGA 758
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D  ++  
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLDAIDKAF 410

Query: 759 LE 760
           L+
Sbjct: 411 LK 412

>Kwal_14.1498
          Length = 939

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 78/181 (43%), Gaps = 47/181 (25%)

Query: 556 TLRNTKWAMGIVVFTGPDTKI-----MLNAGVTP-----TKVSRISRELNLSVFMNFALL 605
           TL       GIV+ T  +T       M+NA   P     T + ++ ++L+   FM+F ++
Sbjct: 237 TLVREGHGRGIVIGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGKDLS---FMSFIVI 293

Query: 606 FVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYIS 665
            ++C   G++ G         R++ E   I+        VS  VA I     + +++ ++
Sbjct: 294 GIICLI-GVIQG---------RSWLEMFQIS--------VSLAVAAIPEGLPIIVTVTLA 335

Query: 666 IEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFK 725
           + +++ A+   I         RL     P   T    LG +  I SDKTGTLT N M   
Sbjct: 336 LGVLRMAKRRAII-------RRL-----PSVET----LGSVNVICSDKTGTLTANHMSVN 379

Query: 726 K 726
           K
Sbjct: 380 K 380

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 81/192 (42%), Gaps = 42/192 (21%)

Query: 885  LEFNSTRKRMSCILKIPSENPNEEPRALLICKGA-DSIIYSRLSKNNDEKLLEKTALHLE 943
            + FNS RK M+  +K+   N     + ++  KGA + I+       N E  + K   +L 
Sbjct: 465  ISFNSKRKFMA--VKVKEANG----KFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLR 518

Query: 944  Q--------YATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIER 995
            Q         A++GLRTL  AQ ELS    ++  E             D++         
Sbjct: 519  QAITDSADALASDGLRTLAFAQLELSNGNSKKLTE-------------DDING------- 558

Query: 996  ELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIG--FSCNLLNNEME 1053
             LT  G   + D  +  V  ++  L E  + + ++TGD   TA++I       ++N E  
Sbjct: 559  -LTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGIPVVNPETA 617

Query: 1054 LLVIKASGDDVD 1065
            +L    +GD +D
Sbjct: 618  VL----TGDKLD 625

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA------GEEGRQAV 1198
             R +P  K  +V+ ++   D++ +  GDG ND   ++ ADIGV +        +E    V
Sbjct: 643  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV 701

Query: 1199 MSSD 1202
            ++ D
Sbjct: 702  LTDD 705

>Scas_688.1
          Length = 913

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGIDVEEEGA 758
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D  ++  
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLDAIDKAF 421

Query: 759 LE 760
           L+
Sbjct: 422 LK 423

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 83/206 (40%), Gaps = 50/206 (24%)

Query: 878  EYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNND--EKLL 935
            +Y++L    F+   K+++ +++ P      E   ++  KGA   +   + +++   E + 
Sbjct: 437  KYKVLEFHPFDPVSKKVTAVVESP------EGERIICVKGAPLFVLKTVEEDHPIPEDIH 490

Query: 936  EKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIER 995
            E     + + A+ G R L +A++           E H                       
Sbjct: 491  ENYENKVAELASRGFRALGVARKR---------GEGH----------------------- 518

Query: 996  ELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKV----ETAINIGFSCNLLNNE 1051
               +LG     D  +D   +++A     G+++ +LTGD V    ET   +G   N+ N E
Sbjct: 519  -WEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNVYNAE 577

Query: 1052 MELLVIKASGDDVDIYGSKPAEIVKN 1077
               L +   G   D+ GS+ A+ V+N
Sbjct: 578  R--LGLSGGG---DMPGSELADFVEN 598

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDVEEEGA 758
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D  ++  
Sbjct: 396 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLDAIDKAF 455

Query: 759 LE 760
           L+
Sbjct: 456 LK 457

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGIDVEEEGA 758
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D  ++  
Sbjct: 367 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLDAIDKAF 426

Query: 759 LE 760
           L+
Sbjct: 427 LK 428

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGIDVEEEGA 758
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D  ++  
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASRKKKGLDAIDKAF 407

Query: 759 LE 760
           L+
Sbjct: 408 LK 409

>Kwal_47.17522
          Length = 899

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGIDVEEEGA 758
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D  ++  
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKKKGLDAIDKAF 407

Query: 759 LE 760
           L+
Sbjct: 408 LK 409

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 1140 KAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGV--GIAGEEGRQA 1197
            K  +  R +P  K  +VK ++   D++ +  GDG ND   ++ ADIG+  GI+G +  + 
Sbjct: 645  KVNIFARATPENKLNIVKALRKRGDIVAMT-GDGVNDAPALKLADIGIAMGISGTDVAKE 703

Query: 1198 V 1198
            V
Sbjct: 704  V 704

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 68/169 (40%), Gaps = 42/169 (24%)

Query: 885  LEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLS---------KNNDE--K 933
            L FNS RK M+       ++  E    +L  KGA   I  + S         +  DE  K
Sbjct: 474  LSFNSKRKYMAI------KSSKESGEHVLYIKGAFERILDKSSYYLDKAGEVREFDEHSK 527

Query: 934  LLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVI 993
            ++   A H    A++GLRT+  A     +K     N          V  ED++       
Sbjct: 528  VMVLEAAH--SCASDGLRTIACA-----FKPTDSDN----------VISEDDING----- 565

Query: 994  ERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIG 1042
               LT  G   + D  +  V  SI  L   G+ + ++TGD V TA++I 
Sbjct: 566  ---LTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIA 611

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGIDVEEEGA 758
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D  ++  
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAASRKKKGLDAIDKAF 407

Query: 759 LE 760
           L+
Sbjct: 408 LK 409

>Scas_707.48*
          Length = 741

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 43/184 (23%)

Query: 871  DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLS--- 927
            D+  ++  ++ +  + FNS RK M+  +KI     N E +  L  KGA   + S+ S   
Sbjct: 456  DLSDIRPTFKKVQEIPFNSKRKFMA--VKIV----NSEGKYSLCVKGAFEKVLSQCSHYL 509

Query: 928  --KNNDEKLLE-------KTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAA 978
              K   EKL +       +TA  L   A+EGLR L  A+  L               +  
Sbjct: 510  NQKGKTEKLTQGQRDVIIETANSL---ASEGLRMLAFAKTTLP-------------DSPT 553

Query: 979  LVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETA 1038
            L+  E     V D+I       G   + D  +  V  +I  L + G+ + ++TGD   TA
Sbjct: 554  LLTEE----SVGDLI-----FTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTA 604

Query: 1039 INIG 1042
            +NI 
Sbjct: 605  VNIA 608

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYA 1204
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ ADIGV +    GR   M +D A
Sbjct: 647  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLADIGVSM----GR---MGTDVA 698

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 1143 LCCRVSPAQKAAVVKLVK------NTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQ 1196
            +   V P +KAA VK ++      N    +   +GDG ND   + +AD+G+ +A   G +
Sbjct: 972  VIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGIALA--SGSE 1029

Query: 1197 AVMSS 1201
              M+S
Sbjct: 1030 LAMTS 1034

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 13/108 (12%)

Query: 941  HLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLL 1000
            +++  ++EGLR L  A +     +  E             ++  ++ K  D  E  LT L
Sbjct: 591  NIDSMSSEGLRVLAFANKSYPKSDVNE-------------EKLQKILKERDYAETGLTFL 637

Query: 1001 GGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLL 1048
            G   I D  ++    ++    +AGI + +LTGD   TA  I     +L
Sbjct: 638  GLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGIL 685

>YNL272C (SEC2) [4337] chr14 complement(126803..129082) Guanine
            nucleotide exchange factor with coiled-coil domain
            essential for vesicular transport to the plasma membrane
            [2280 bp, 759 aa]
          Length = 759

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 941  HLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLL 1000
            HLE+   + L+T  IA ++ + + Y +  E +      L DR+DE++++ + I +E  L 
Sbjct: 30   HLEEQLNKSLKT--IASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELR 87

Query: 1001 GGTAIE-DRLQDGVPDSIATL 1020
                 E D+L   V D  A+L
Sbjct: 88   TKAEEEADKLNKEVEDLTASL 108

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
           with similarity to transcription factors, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 48/103 (46%), Gaps = 11/103 (10%)

Query: 684 YNERLDYPCTPKSWTISD-DLGQIEYIFSDKTGTLTQNVMEF--KKCTINGVSYGRAYTE 740
           +N +L+  C   S + +D +    ++I   K   L +   +    KC I   +Y  AYT+
Sbjct: 333 HNAKLESECDSSSHSDADLEKHDTDFISPSKFRELVKTPQDLYDNKCLIKPHNYKLAYTK 392

Query: 741 ALAGLRKR--------QGIDVEEEGALEKEGIAQDKEIMLANL 775
            L  LRK+        +   V++E + +K  +  D E+++ ++
Sbjct: 393 LLTTLRKKFLEGAEIDKSASVKDEHSTQKHNLRYDLEVIIRSI 435

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 48/118 (40%), Gaps = 14/118 (11%)

Query: 935  LEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIE 994
            LE    +++  + EGLR L  A + +  +E +   E+              + K  D +E
Sbjct: 586  LEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------------LTKDRDFVE 631

Query: 995  RELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEM 1052
             +L   G   I D  +     ++     AGI + +LTGD   TA  I     +L + +
Sbjct: 632  SDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNL 689

>YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters [3150 bp, 1049 aa]
          Length = 1049

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 1224 KRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILD 1283
            K M+E++PL     ++ +L ++     N  D ++      L LFNL   SL ++ +GI+ 
Sbjct: 873  KIMSEVVPLRVVPPILLSLIVYPMTGLNMKDNAFFKCIGILILFNLGI-SLEILTIGIIF 931

Query: 1284 QDVNDIV 1290
            +D+N+ +
Sbjct: 932  EDLNNSI 938

>Scas_515.4
          Length = 1114

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 50/113 (44%), Gaps = 23/113 (20%)

Query: 585 TKVSRISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGV 644
           + V++I+  + L+  M F ++ + CF   I     +R    S NYF+        A +G 
Sbjct: 421 SDVNKIASFITLTFLMTFIVMNLACFLLEIAAAPNFR---PSFNYFD-----RYTALSGA 472

Query: 645 VSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSW 697
           +   +A+I+   V   +L +++ +      LF+          + Y C PKSW
Sbjct: 473 ILSIIAMIVVDGVTASALMLAMGM------LFLV---------IHYVCPPKSW 510

>KLLA0D04554g complement(385733..388801) similar to sp|P25371
            Saccharomyces cerevisiae YCR011c ADP1 ATP-dependent
            permease, start by similarity
          Length = 1022

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 13/89 (14%)

Query: 1211 LTRLVLVHGRWSY----------KRMAEMIPLFFYKNVIFTLSLF-WYGVYNNYDGSYLF 1259
            L RL+ +  R ++          K ++++IPL     ++  L L+   G+  N +G + F
Sbjct: 823  LERLIFIKERSNHYYSPLAYYISKILSDIIPLRVVPPILLGLILYPLVGLNMNDNGFFKF 882

Query: 1260 EYTYLTLFNLAFTSLPVIFLGILDQDVND 1288
            E   L LFNLA  SL ++ +GI+ +D+N+
Sbjct: 883  E-GILILFNLAI-SLEILTVGIIFEDLNN 909

>Scas_317.1
          Length = 357

 Score = 31.6 bits (70), Expect = 5.4,   Method: Composition-based stats.
 Identities = 53/233 (22%), Positives = 91/233 (39%), Gaps = 51/233 (21%)

Query: 1206 GQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLT 1265
            G  RY T+  LV    S+K     I    +K ++   ++  + VY            Y T
Sbjct: 112  GDNRYYTKQELVESEVSFKEFVIEITARPFKLMVLEPAVLAFNVY--------IAVCYGT 163

Query: 1266 LFNLAFTSLPVIFLGI------------LDQDVNDIVSMVVPQLYRVGILRSEWNQTKFW 1313
             F L F + P++F+GI            L   V  IV+ VV  ++   ++R ++    F 
Sbjct: 164  -FYLFFEAFPIVFIGIYHFTLVEMGFAYLGFCVGCIVAYVVLLVFLAKVIRPKFQNNNFT 222

Query: 1314 LYMFDAMYQSVICFFLP---YLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVL 1370
               F  +   V C+ LP   +L  +  G+           +W+   +A I  V C     
Sbjct: 223  PEAFLLLAMGV-CWSLPLSLFLFGWTAGV-----------HWILPIIAQIFFVLC----- 265

Query: 1371 LHQYRWDWFSSLFIALSCLCIFAWTGIWSSFTSSG---EFYKSAAHIYGQPVF 1420
                 ++ F S F  L+ +C   +    S F S+G     +  A  ++GQ ++
Sbjct: 266  ----VFNLFQSTFSYLA-ICYPRYMA--SVFASNGFCRSVFACAFPLFGQAMY 311

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 1147 VSPAQKAAVVKLVKNT--LDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYA 1204
            V P  KA  ++ ++ T    V    +GDG ND   I +AD+G+ +A      A++S D+ 
Sbjct: 1065 VLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASGSDL-AMISCDFV 1123

Query: 1205 I 1205
            +
Sbjct: 1124 L 1124

>KLLA0C15785g complement(1367880..1374743) similar to sp|P38111
            Saccharomyces cerevisiae YBR136w ESR1 cell cycle
            checkpoint protein, start by similarity
          Length = 2287

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 1068 GSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLAL 1123
             +  +E+VK+  +K L+  +     YEEL    KVH P T  F V  DGD L + +
Sbjct: 1406 STTSSELVKSSNMKMLKSMYS-HQLYEELLMKVKVHLPETKGFLVDNDGDLLNMGI 1460

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 52,814,912
Number of extensions: 2474583
Number of successful extensions: 8653
Number of sequences better than 10.0: 129
Number of HSP's gapped: 8767
Number of HSP's successfully gapped: 200
Length of query: 1552
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1437
Effective length of database: 12,615,039
Effective search space: 18127811043
Effective search space used: 18127811043
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)