Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17622g1591578261e-115
YDR092W (UBC13)1531497195e-99
Scas_636.15*1531537075e-97
Kwal_56.234821491396981e-95
Sklu_1838.21631446963e-95
CAGL0G08063g1491496935e-95
AGR121C1541516641e-90
YDR059C (UBC5)1481433672e-45
AER173C1471433593e-44
KLLA0E12595g1481483552e-43
YBR082C (UBC4)1481433542e-43
CAGL0E04752g1471433542e-43
Scas_635.14*1481433532e-43
Kwal_27.124012361313394e-40
YDR177W (UBC1)2151503281e-38
Sklu_1817.22151453183e-37
Scas_682.102141473184e-37
CAGL0E00671g2131453141e-36
ADR169C2111543114e-36
Kwal_23.64852151453062e-35
CAGL0I00352g1671372911e-33
Scas_563.81711412883e-33
KLLA0C18656g2281452924e-33
KLLA0C05632g1641372841e-32
YGL058W (RAD6)1721372851e-32
AAR156C1701372851e-32
Kwal_14.18281521252718e-31
YOR339C (UBC11)1561292691e-30
Sklu_2299.51541252657e-30
Kwal_26.70091611482511e-27
Sklu_2410.41611312482e-27
KLLA0A11198g2021222504e-27
AEL045W2111502481e-26
Kwal_34.161742131212471e-26
CAGL0M03399g2141222472e-26
YEL012W (UBC8)2181212453e-26
ABR059W1651252327e-25
CAGL0M07568g1651252301e-24
YMR022W (QRI8)1651252283e-24
Scas_694.332311282314e-24
Kwal_26.82241651252241e-23
Scas_621.41931022252e-23
Scas_709.491651252205e-23
AER056C1571512171e-22
CAGL0D00814g1571512171e-22
Sklu_2411.72331382211e-22
Kwal_23.42271221212122e-22
KLLA0E07711g1651252153e-22
KLLA0E04983g1571222118e-22
KLLA0C17248g184902112e-21
YLR306W (UBC12)188962033e-20
CAGL0D06468g187862006e-20
YDL064W (UBC9)1571221934e-19
ADL035C2001021947e-19
Sklu_1826.31611021856e-18
KLLA0D09196g2921111864e-17
Kwal_55.212461601011796e-17
Scas_712.591711001771e-16
YDR054C (CDC34)2951021812e-16
KLLA0E20493g2511141802e-16
Kwal_27.104442781041785e-16
CAGL0E04598g2951021785e-16
Scas_635.182731021769e-16
AGL203C2701021741e-15
Scas_718.342581021732e-15
Sklu_2136.52721021732e-15
AGR372W2421141713e-15
YER100W (UBC6)2501141714e-15
Kwal_27.108372461121688e-15
Scas_599.162241141652e-14
CAGL0I10450g1621071594e-14
AFR314W155991585e-14
Sklu_2425.62511141627e-14
CAGL0I05478g2461141592e-13
YGR133W (PEX4)1831361552e-13
Scas_609.72401141495e-12
KLLA0E03916g1581051421e-11
Scas_551.9153891183e-08
Kwal_27.11182101871102e-07
YGL087C (MMS2)137801017e-06
CAGL0H03157g139125991e-05
KLLA0E19217g13982982e-05
Scas_720.10*13482954e-05
AFL064W13887948e-05
Kwal_23.4090205036670.74
Scas_719.33204536622.5
KLLA0F23507g48722596.6
KLLA0B02717g204736596.7
AFL181C22271587.0
Sklu_2323.177318597.5
CAGL0I04290g42284587.7
YKL182W (FAS1)205136597.7
KLLA0E22220g38329589.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17622g
         (157 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17622g join(1555873..1555902,1556004..1556453) highly simi...   322   e-115
YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599) Ubiqu...   281   5e-99
Scas_636.15*                                                          276   5e-97
Kwal_56.23482                                                         273   1e-95
Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement        272   3e-95
CAGL0G08063g 761662..762111 highly similar to sp|P52490 Saccharo...   271   5e-95
AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH] (977487..9...   260   1e-90
YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..5697...   145   2e-45
AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C (...   142   3e-44
KLLA0E12595g join(1117022..1117068,1117342..1117741) highly simi...   141   2e-43
YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..4071...   140   2e-43
CAGL0E04752g complement(455965..456408) highly similar to sp|P15...   140   2e-43
Scas_635.14*                                                          140   2e-43
Kwal_27.12401                                                         135   4e-40
YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugatin...   130   1e-38
Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement         127   3e-37
Scas_682.10                                                           127   4e-37
CAGL0E00671g complement(61460..62101) highly similar to sp|P2173...   125   1e-36
ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH] (1000736.....   124   4e-36
Kwal_23.6485                                                          122   2e-35
CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomy...   116   1e-33
Scas_563.8                                                            115   3e-33
KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces...   117   4e-33
KLLA0C05632g complement(503484..503978) highly similar to sp|P06...   114   1e-32
YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugatin...   114   1e-32
AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH] (626372..626...   114   1e-32
Kwal_14.1828                                                          108   8e-31
YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein ...   108   1e-30
Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement      106   7e-30
Kwal_26.7009                                                          101   1e-27
Sklu_2410.4 YOR339C, Contig c2410 15549-16034                         100   2e-27
KLLA0A11198g join(complement(974525..974529),complement(973755.....   100   4e-27
AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH] complement(...   100   1e-26
Kwal_34.16174                                                         100   1e-26
CAGL0M03399g complement(389650..390294) highly similar to sp|P28...   100   2e-26
YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551) Ubiqu...    99   3e-26
ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH] complement(5...    94   7e-25
CAGL0M07568g complement(758110..758607) highly similar to sp|Q02...    93   1e-24
YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugati...    92   3e-24
Scas_694.33                                                            94   4e-24
Kwal_26.8224                                                           91   1e-23
Scas_621.4                                                             91   2e-23
Scas_709.49                                                            89   5e-23
AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH] (741224..74...    88   1e-22
CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomy...    88   1e-22
Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement       90   1e-22
Kwal_23.4227                                                           86   2e-22
KLLA0E07711g complement(693694..694191) highly similar to sp|Q02...    87   3e-22
KLLA0E04983g 443446..443919 highly similar to sp|P50623 Saccharo...    86   8e-22
KLLA0C17248g complement(1509885..1510439) similar to sp|P52491 S...    86   2e-21
YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853) Rub...    83   3e-20
CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces c...    82   6e-20
YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070) Smt3p-...    79   4e-19
ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH] (634059..6...    79   7e-19
Sklu_1826.3 YGR133W, Contig c1826 3548-4033                            76   6e-18
KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces c...    76   4e-17
Kwal_55.21246                                                          74   6e-17
Scas_712.59                                                            73   1e-16
YDR054C (CDC34) [905] chr4 complement(561436..562323) Ubiquitin-...    74   2e-16
KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces...    74   2e-16
Kwal_27.10444                                                          73   5e-16
CAGL0E04598g complement(444288..445175) highly similar to sp|P14...    73   5e-16
Scas_635.18                                                            72   9e-16
AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH] (317749..3...    72   1e-15
Scas_718.34                                                            71   2e-15
Sklu_2136.5 YDR054C, Contig c2136 7737-8555                            71   2e-15
AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH] complement(...    70   3e-15
YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugatin...    70   4e-15
Kwal_27.10837                                                          69   8e-15
Scas_599.16                                                            68   2e-14
CAGL0I10450g complement(1024541..1025029) similar to sp|P29340 S...    66   4e-14
AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH] complement(...    65   5e-14
Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement         67   7e-14
CAGL0I05478g complement(518933..519673) highly similar to sp|P33...    66   2e-13
YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugatin...    64   2e-13
Scas_609.7                                                             62   5e-12
KLLA0E03916g complement(365119..365595) similar to sp|P29340 Sac...    59   1e-11
Scas_551.9                                                             50   3e-08
Kwal_27.11182                                                          47   2e-07
YGL087C (MMS2) [1895] chr7 complement(346407..346809,346895..346...    44   7e-06
CAGL0H03157g join(complement(297881..297891),complement(297272.....    43   1e-05
KLLA0E19217g join(complement(1703226..1703236), highly similar t...    42   2e-05
Scas_720.10*                                                           41   4e-05
AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH] complement(...    41   8e-05
Kwal_23.4090                                                           30   0.74 
Scas_719.33                                                            28   2.5  
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    27   6.6  
KLLA0B02717g 240125..246268 highly similar to sp|P07149 Saccharo...    27   6.7  
AFL181C [3014] [Homologous to ScYMR202W (ERG2) - SH] (99899..100...    27   7.0  
Sklu_2323.1 YPL207W, Contig c2323 491-2812 reverse complement          27   7.5  
CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces c...    27   7.7  
YKL182W (FAS1) [3090] chr11 (100676..106831) Fatty-acyl-CoA synt...    27   7.7  
KLLA0E22220g complement(1974635..1975786) similar to sp|P32628 S...    27   9.2  

>KLLA0C17622g join(1555873..1555902,1556004..1556453) highly similar
           to sp|P52490 Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 159

 Score =  322 bits (826), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 157/157 (100%), Positives = 157/157 (100%)

Query: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD
Sbjct: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120

Query: 121 LANDVAEEWIKHEDTAIAKAKEWTKLYAKPTQDEEPA 157
           LANDVAEEWIKHEDTAIAKAKEWTKLYAKPTQDEEPA
Sbjct: 121 LANDVAEEWIKHEDTAIAKAKEWTKLYAKPTQDEEPA 157

>YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599)
           Ubiquitin-conjugating (E2) enzyme involved in
           Rad6-dependent post-replicative repair pathway, required
           for non-proteolytic multi-ubiquitination of Pol30p
           (PCNA) [462 bp, 153 aa]
          Length = 153

 Score =  281 bits (719), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 133/149 (89%), Positives = 145/149 (97%)

Query: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           MA+LPKRIIKETE+LVSDPVPGITAEPH+DNLRYFQVTIEGP+QSPYE+G+F+LEL+LPD
Sbjct: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLS+QALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120

Query: 121 LANDVAEEWIKHEDTAIAKAKEWTKLYAK 149
           LANDVAE+WIK+E  A AKA+EWTKLYAK
Sbjct: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAK 149

>Scas_636.15*
          Length = 153

 Score =  276 bits (707), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           MA+LPKRIIKETERL+SDPVPGITAEPHEDNLRYF VT+EGP  SPYENG+FQLEL+LPD
Sbjct: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLSVQALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120

Query: 121 LANDVAEEWIKHEDTAIAKAKEWTKLYAKPTQD 153
           LANDVAEEWI++E  A A A+EWT+ YAK  ++
Sbjct: 121 LANDVAEEWIQNEAGAKATAREWTQKYAKKVEN 153

>Kwal_56.23482
          Length = 149

 Score =  273 bits (698), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 130/139 (93%), Positives = 137/139 (98%)

Query: 10  KETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKV 69
           +ETERLVSDPVPGITAEPHE+NLRYFQVTIEGPQQSPYENGVF+LELFLPDDYPMEAPKV
Sbjct: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69

Query: 70  RFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEW 129
           RFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLSVQALLASPNPNDPLANDVAE+W
Sbjct: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129

Query: 130 IKHEDTAIAKAKEWTKLYA 148
           IK+ED AIAKA+EWT+LYA
Sbjct: 130 IKNEDGAIAKAREWTQLYA 148

>Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement
          Length = 163

 Score =  272 bits (696), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 128/144 (88%), Positives = 140/144 (97%)

Query: 9   IKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPK 68
           ++ETERLVSDPVPGI+AEPH+DNLRYFQVTIEGPQQSPYENGVF+LELFLP+DYPMEAPK
Sbjct: 19  LQETERLVSDPVPGISAEPHDDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPK 78

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEE 128
           VRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLS+QALLASPNPNDPLANDVAE+
Sbjct: 79  VRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPNDPLANDVAED 138

Query: 129 WIKHEDTAIAKAKEWTKLYAKPTQ 152
           WIK+E+ AIA AKEWT+ YAK +Q
Sbjct: 139 WIKNEEGAIATAKEWTEKYAKKSQ 162

>CAGL0G08063g 761662..762111 highly similar to sp|P52490
           Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 149

 Score =  271 bits (693), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 137/149 (91%)

Query: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           MA+LPKRIIKETERLVSDPVPGITAEPHEDNLRYF VTIEGP QSPYE G+F+LEL+LP+
Sbjct: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLS+QALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120

Query: 121 LANDVAEEWIKHEDTAIAKAKEWTKLYAK 149
           LANDVAE+WIK E  A   AKEWT  YAK
Sbjct: 121 LANDVAEDWIKDEAKAKQTAKEWTAQYAK 149

>AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH]
           (977487..977921,977971..978000) [465 bp, 154 aa]
          Length = 154

 Score =  260 bits (664), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%)

Query: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           M  LPKRIIKETERLVSDPVPGI+AEPHEDNLRYF V+IEGPQQSPYE+GVF+LELFLPD
Sbjct: 1   MVPLPKRIIKETERLVSDPVPGISAEPHEDNLRYFDVSIEGPQQSPYEHGVFRLELFLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120
           +YPME PKVRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLS+QALLA+PNPNDP
Sbjct: 61  EYPMEPPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLATPNPNDP 120

Query: 121 LANDVAEEWIKHEDTAIAKAKEWTKLYAKPT 151
           LANDVA++WI  E  A AKA+EWT LYAKP 
Sbjct: 121 LANDVAKDWIADEAAATAKAREWTALYAKPA 151

>YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..569766)
           Ubiquitin-conjugating enzyme that with Ubc4p is
           responsible for most of ubiquitin-dependent protein
           degradation of short-lived and abnormal proteins [447
           bp, 148 aa]
          Length = 148

 Score =  145 bits (367), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 91/143 (63%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++Q +I GP  SPY  GVF L +  P DYP +
Sbjct: 5   KRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFK 64

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PKV F TKIYHPNI+  G ICLD+LK+ WSPAL +  VLLS+ +LL   NP+DPL  ++
Sbjct: 65  PPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 124

Query: 126 AEEWIKHEDTAIAKAKEWTKLYA 148
           A+ +   +    A AKEWTK YA
Sbjct: 125 AQIYKTDKAKYEATAKEWTKKYA 147

>AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C
           (UBC5) - SH] (960420..960863) [444 bp, 147 aa]
          Length = 147

 Score =  142 bits (359), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 89/143 (62%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++Q +I GP  SPY  GVF L +  P DYP +
Sbjct: 4   KRITKELNDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 63

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK+ WSPAL I  VLLS+ +LL   NP+DPL  ++
Sbjct: 64  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEI 123

Query: 126 AEEWIKHEDTAIAKAKEWTKLYA 148
           A  +        A AKEWTK YA
Sbjct: 124 AHIYKTDRAKYEATAKEWTKKYA 146

>KLLA0E12595g join(1117022..1117068,1117342..1117741) highly similar
           to sp|P15731 Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 148

 Score =  141 bits (355), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 93/148 (62%), Gaps = 1/148 (0%)

Query: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           M++L KRI KE   L  DP    +A P  D++ ++Q +I GP  SPY  GVF L +  P 
Sbjct: 1   MSSL-KRITKELNDLGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYP + PK+ F TKIYHPNI+  G ICLD+LK+ WSPAL I  VLLS+ +LL   NP+DP
Sbjct: 60  DYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDP 119

Query: 121 LANDVAEEWIKHEDTAIAKAKEWTKLYA 148
           L  ++A  +        A A+EWTK YA
Sbjct: 120 LVPEIAHLYKTDRAKYEATAREWTKKYA 147

>YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..407126)
           Ubiquitin-conjugating (E2) enzyme, together with Ubc5p
           is responsible for the majority of ubiquitin-dependent
           protein degradation of short-lived and abnormal proteins
           [447 bp, 148 aa]
          Length = 148

 Score =  140 bits (354), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 89/143 (62%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++Q +I GP  SPY  GVF L +  P DYP +
Sbjct: 5   KRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFK 64

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK+ WSPAL +  VLLS+ +LL   NP+DPL  ++
Sbjct: 65  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 124

Query: 126 AEEWIKHEDTAIAKAKEWTKLYA 148
           A  +        A A+EWTK YA
Sbjct: 125 AHIYKTDRPKYEATAREWTKKYA 147

>CAGL0E04752g complement(455965..456408) highly similar to sp|P15731
           Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 147

 Score =  140 bits (354), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 89/143 (62%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++Q +I GP  SPY  GVF L +  P DYP +
Sbjct: 4   KRIAKELSDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 63

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK+ WSPAL +  VLLS+ +LL   NP+DPL  ++
Sbjct: 64  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 123

Query: 126 AEEWIKHEDTAIAKAKEWTKLYA 148
           A  +        A A+EWTK YA
Sbjct: 124 AHIYKTDRAKYEATAREWTKKYA 146

>Scas_635.14*
          Length = 148

 Score =  140 bits (353), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 89/143 (62%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KRI KE   +  DP    +A P  D+L ++Q +I GP  SPY  GVF L +  P DYP +
Sbjct: 5   KRITKELSDMGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 64

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK+ WSPAL +  VLLS+ +LL   NP+DPL  ++
Sbjct: 65  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 124

Query: 126 AEEWIKHEDTAIAKAKEWTKLYA 148
           A  +        A A+EWTK YA
Sbjct: 125 AHIYKTDRPKYEATAREWTKKYA 147

>Kwal_27.12401
          Length = 236

 Score =  135 bits (339), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 83/131 (63%)

Query: 18  DPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYH 77
           DP    +A P  D+L ++Q +I GP  SPY  GVF L +  P DYP + PK+ F TKIYH
Sbjct: 105 DPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYH 164

Query: 78  PNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKHEDTAI 137
           PNI+  G ICLD+LK+ WSPAL I  VLLS+ +LL   NP+DPL  ++A  +        
Sbjct: 165 PNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYE 224

Query: 138 AKAKEWTKLYA 148
           A AKEWTK YA
Sbjct: 225 ATAKEWTKKYA 235

>YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugating
           enzyme (E2) that plays a role early in spore
           germination, in degradation of mis-folded proteins in
           the ER, and degradation of Gal2p at the plasma membrane
           [648 bp, 215 aa]
          Length = 215

 Score =  130 bits (328), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 98/150 (65%), Gaps = 2/150 (1%)

Query: 6   KRIIKETERLVSDPVPGITAE-PHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KRI+KE + +  DP   IT E   E ++ + + T  GP  +PYE G F +++ +P +YP 
Sbjct: 5   KRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPF 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
           + PK++F TK+YHPNI  + G ICLD+LKN WSP + +++ L+S+QALL SP PNDP   
Sbjct: 65  KPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDA 124

Query: 124 DVAEEWIKHEDTAIAKAKEWTKLYAKPTQD 153
           +VA+ +++  ++    A  WT+LYA  T +
Sbjct: 125 EVAQHYLRDRESFNKTAALWTRLYASETSN 154

>Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement
          Length = 215

 Score =  127 bits (318), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 94/145 (64%), Gaps = 2/145 (1%)

Query: 6   KRIIKETERLVSDPVPGITAE-PHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KRIIKE +    DP   IT     E ++ + + +  GP  +PYE G F +++ +P +YP 
Sbjct: 5   KRIIKEIQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPLEYPF 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
           + PK++F TK+YHPNI  + G ICLD+LKN WSP + +++ L+S+QALL SP PNDP   
Sbjct: 65  KPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDA 124

Query: 124 DVAEEWIKHEDTAIAKAKEWTKLYA 148
           +VA+ +I+ + +    A  WTKLYA
Sbjct: 125 EVAQHFIRDKSSFDKTAALWTKLYA 149

>Scas_682.10
          Length = 214

 Score =  127 bits (318), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 96/147 (65%), Gaps = 2/147 (1%)

Query: 6   KRIIKETERLVSDPVPGITAE-PHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KRI+KE + +  DP   I  E  +E ++ + + +  GP  +PYE G F +++ +P +YP 
Sbjct: 5   KRIMKELQAVKDDPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPMEYPF 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
           + P ++F TK+YHPNI  + G ICLD+LKN WSP + +++ L+S+QALL SP PNDP   
Sbjct: 65  KPPMMKFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDA 124

Query: 124 DVAEEWIKHEDTAIAKAKEWTKLYAKP 150
           +VA+ ++K  ++    A  WTKLYA P
Sbjct: 125 EVAQHYLKDRESFNKTAALWTKLYASP 151

>CAGL0E00671g complement(61460..62101) highly similar to sp|P21734
           Saccharomyces cerevisiae YDR177w E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 213

 Score =  125 bits (314), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 95/145 (65%), Gaps = 2/145 (1%)

Query: 6   KRIIKETERLVSDPVPGITAE-PHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KRI+KE + +  DP   I+ E   E ++ + + +  GP  +PYE G F +++ +P +YP 
Sbjct: 5   KRIMKELQAVKDDPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPMEYPF 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
           + PK++F +K+YHPNI  + G ICLD+LKN WSP + +++ L+S+QALL SP PNDP   
Sbjct: 65  KPPKMKFDSKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDA 124

Query: 124 DVAEEWIKHEDTAIAKAKEWTKLYA 148
           +VA+ +++   +    A  WTKLYA
Sbjct: 125 EVAQHYLRDRQSFDKTAALWTKLYA 149

>ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH]
           (1000736..1001371) [636 bp, 211 aa]
          Length = 211

 Score =  124 bits (311), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 97/154 (62%), Gaps = 4/154 (2%)

Query: 6   KRIIKETERLVSDPVPGIT-AEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KR++KE + +  DP   I+ A   E ++ + + T  GP  +PY  G F +++ +P +YP 
Sbjct: 5   KRLMKEIQSVKDDPDANISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLEYPF 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
           + PK++F TK+YHPNI  + G ICLD+LKN+WSP L ++T L+S+QALL SP PNDP   
Sbjct: 65  KPPKMQFDTKVYHPNISSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDPQDA 124

Query: 124 DVAEEWIKHEDTAIAKAKEWTKLYA--KPTQDEE 155
           +VA+ ++    +    A  WTK YA  +   DEE
Sbjct: 125 EVAKHYLSDRASFDRTAALWTKTYASGQTGNDEE 158

>Kwal_23.6485
          Length = 215

 Score =  122 bits (306), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 96/145 (66%), Gaps = 2/145 (1%)

Query: 6   KRIIKETERLVSDPVPGITAE-PHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KR++KE + +  DP   +  +  +E+++   + +  GP  +PYENG + +++ +P +YP 
Sbjct: 5   KRVMKELQAIKDDPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPMEYPF 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
           + PK++F TK+YHPN+  + G ICLD+LKN WSP + +++ L+S+QALL SP PNDP   
Sbjct: 65  KPPKMKFQTKVYHPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDA 124

Query: 124 DVAEEWIKHEDTAIAKAKEWTKLYA 148
           +VA+ +I+ + +    A  WTK YA
Sbjct: 125 EVAQHYIRDKASFDKTAAFWTKTYA 149

>CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomyces
           cerevisiae YGL058w RAD6 E2 ubiquitin-conjugating, start
           by similarity
          Length = 167

 Score =  116 bits (291), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 85/137 (62%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           +R++++ +R+  D  PG++A P  DN+  +   I GP  +PYE+G F+L L   +DYP +
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+N W+P   + ++L S+Q+L   PNP  P   + 
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEA 126

Query: 126 AEEWIKHEDTAIAKAKE 142
           A  +  H+   I + KE
Sbjct: 127 ATLFKDHKSQYIKRVKE 143

>Scas_563.8
          Length = 171

 Score =  115 bits (288), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 87/141 (61%)

Query: 2   AALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDD 61
            A  +R++++ +R+  D  PG++A P  DN+  +   I GP ++PYE+G F+L L   ++
Sbjct: 3   TAARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEE 62

Query: 62  YPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPL 121
           YP + P V+FL++++HPN+   G ICLD+L+N W+P   + ++L S+Q+L   PNP  P 
Sbjct: 63  YPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPA 122

Query: 122 ANDVAEEWIKHEDTAIAKAKE 142
             + A  +  H+   I + KE
Sbjct: 123 NVEAATLFKDHKSQYIKRVKE 143

>KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces
           cerevisiae YDR177w UBC1 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 228

 Score =  117 bits (292), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 93/145 (64%), Gaps = 2/145 (1%)

Query: 6   KRIIKETERLVSDPVPGITAE-PHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KRI+KE + +  DP   I  +  +E ++ + + +  GP  +PYE G F +++ +P +YP 
Sbjct: 5   KRILKEIQAVKEDPEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPY 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
           + P+++F TK+YHPN+  + G ICLD+LKN W+P + +++ L+S+QALL SP PNDP   
Sbjct: 65  KPPQMKFDTKVYHPNVSSVTGAICLDILKNAWTPVITLKSALISLQALLQSPEPNDPQDA 124

Query: 124 DVAEEWIKHEDTAIAKAKEWTKLYA 148
            VA+ ++  + +    A  WT+ YA
Sbjct: 125 QVAKHYLTDKKSFDETAALWTRTYA 149

>KLLA0C05632g complement(503484..503978) highly similar to sp|P06104
           Saccharomyces cerevisiae YGL058w RAD6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 164

 Score =  114 bits (284), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 85/137 (62%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           +R++++ +R+  D  PG++A P  DN+  +   I GP  +PYE+G F+L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+N W+P   + ++L S+Q+L   PNP  P   + 
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEA 126

Query: 126 AEEWIKHEDTAIAKAKE 142
           A  +  H+   + + KE
Sbjct: 127 ATLFQDHKSQYVKRVKE 143

>YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugating
           (E2) enzyme involved in error-prone and error-free
           DNA-damage recovery pathways, in the N-end rule protein
           degradation pathway, mediates methylation of histone H3
           lysines 4 and 79 by ubiquitination of histone H2B [519
           bp, 172 aa]
          Length = 172

 Score =  114 bits (285), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 85/137 (62%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           +R++++ +R+  D  PG++A P  DN+  +   I GP  +PYE+G F+L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+N W+P   + ++L S+Q+L   PNP  P   + 
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEA 126

Query: 126 AEEWIKHEDTAIAKAKE 142
           A  +  H+   + + KE
Sbjct: 127 ATLFKDHKSQYVKRVKE 143

>AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH]
           (626372..626884) [513 bp, 170 aa]
          Length = 170

 Score =  114 bits (285), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 85/137 (62%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           +R++++ +R+  D  PG++A P  DN+  +   I GP  +PYE+G F+L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+N W+P   + ++L S+Q+L   PNP  P   + 
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEA 126

Query: 126 AEEWIKHEDTAIAKAKE 142
           A  +  H+   + + KE
Sbjct: 127 ATLFKDHKSQYVKRVKE 143

>Kwal_14.1828
          Length = 152

 Score =  108 bits (271), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 77/125 (61%)

Query: 18  DPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYH 77
           D  PG++A P  DN+  +   I GP ++PYE+G F+L L   ++YP + P V+FL++I+H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIFH 63

Query: 78  PNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKHEDTAI 137
           PN+   G ICLD+L+N W+P   + ++L S+Q+L   PNP  P   + A  +  H+   I
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYI 123

Query: 138 AKAKE 142
            + KE
Sbjct: 124 KRVKE 128

>YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein
           with similarity to ubiquitin-conjugating enzymes [471
           bp, 156 aa]
          Length = 156

 Score =  108 bits (269), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 76/129 (58%), Gaps = 1/129 (0%)

Query: 2   AALPKRIIKETERLVSDPVPGITAEPHEDN-LRYFQVTIEGPQQSPYENGVFQLELFLPD 60
             + KR+  E  +L+S     I+A P +DN L Y+   I GP+ +PY    F++ L  P 
Sbjct: 7   GCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQ 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120
           +YP   P ++FL+ ++HPN+D+ G ICLD+LK  WS    + T+LLS+Q+LL  PN   P
Sbjct: 67  NYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSP 126

Query: 121 LANDVAEEW 129
           L    AE W
Sbjct: 127 LNAVAAELW 135

>Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement
          Length = 154

 Score =  106 bits (265), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 76/125 (60%)

Query: 18  DPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYH 77
           D  PG++A P  DN+  +   I GP  +PYE+G F+L L   ++YP + P V+FL++++H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFH 63

Query: 78  PNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKHEDTAI 137
           PN+   G ICLD+L+N W+P   + ++L S+Q+L   PNP  P   + A  +  H+   +
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYV 123

Query: 138 AKAKE 142
            + KE
Sbjct: 124 KRVKE 128

>Kwal_26.7009
          Length = 161

 Score =  101 bits (251), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 91/148 (61%), Gaps = 7/148 (4%)

Query: 3   ALPKRIIKETERLVSDPVPGITAEPH-EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDD 61
           ++ KR+  E  +L+  P PG++A P  ED+L  +   I GP  +PYE   F++ L     
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQT 73

Query: 62  YPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPL 121
           YP  APKVRF++ ++HPN+D  G ICLD+LK+ WS    ++T+LLS+Q+LL  PN + PL
Sbjct: 74  YPYTAPKVRFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPL 133

Query: 122 ANDVAEEWIKHEDTAIAKAKEWTKLYAK 149
               AE W    DT + + K+  KLYA+
Sbjct: 134 NAVAAELW----DTDMQEYKK--KLYAR 155

>Sklu_2410.4 YOR339C, Contig c2410 15549-16034
          Length = 161

 Score =  100 bits (248), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 83/131 (63%), Gaps = 1/131 (0%)

Query: 3   ALPKRIIKETERLVSDPVPGITAEP-HEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDD 61
           ++ KR+  E  +L+  P PG++A P +ED+L  +   I GP  +PYE   F++ L  P  
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQS 73

Query: 62  YPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPL 121
           YP  AP+V F++ ++HPN+D  G ICLD+LK+ WS    ++T+LLS+Q+LL  PN + PL
Sbjct: 74  YPYTAPRVTFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPL 133

Query: 122 ANDVAEEWIKH 132
               AE W K+
Sbjct: 134 NAVAAELWDKN 144

>KLLA0A11198g
           join(complement(974525..974529),
           complement(973755..974358)) similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 202

 Score =  100 bits (250), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 74/122 (60%), Gaps = 2/122 (1%)

Query: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRL-GRIC 87
           ED ++ F +   GP+ +PYE GV++L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSIC 86

Query: 88  LDVLKNNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEEWIKHEDTAIAKAKEWTKL 146
           LDV+ + WSP   +  ++   +  LL  PN +DPL N+ A   +K +D    K  E+   
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIHEYINK 146

Query: 147 YA 148
           YA
Sbjct: 147 YA 148

>AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH]
           complement(549376..549380,549444..550074) [636 bp, 211
           aa]
          Length = 211

 Score =  100 bits (248), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 87/150 (58%), Gaps = 5/150 (3%)

Query: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           M++  +RI  +  +L+   +     E  +DN++ F V   GP+ +PYE GV++L + LPD
Sbjct: 1   MSSSKRRIETDVMKLL---MSDHDVELVDDNMQEFHVKFHGPKGTPYERGVWRLHVELPD 57

Query: 61  DYPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKNNWSPALQIRTVL-LSVQALLASPNPN 118
           +YP ++P + F+ KI+HPNID   G ICLDV+ + WSP   +  ++   +  LL  PN +
Sbjct: 58  NYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGS 117

Query: 119 DPLANDVAEEWIKHEDTAIAKAKEWTKLYA 148
           DPL N+ A   +K+      K +E+   YA
Sbjct: 118 DPLNNEAATLQLKNPQMYEEKIQEYIDKYA 147

>Kwal_34.16174
          Length = 213

 Score = 99.8 bits (247), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 76/121 (62%), Gaps = 2/121 (1%)

Query: 30  DNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRL-GRICL 88
           DN++ F V   GP+++PYE GV++L + LPD+YP ++P + F+ KI+HPNID   G ICL
Sbjct: 15  DNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICL 74

Query: 89  DVLKNNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEEWIKHEDTAIAKAKEWTKLY 147
           DV+ + WSP   +  +L   +  LL  PN +DPL N+ A   +K ++    K +E+   +
Sbjct: 75  DVINSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKELYERKIREFIDQF 134

Query: 148 A 148
           A
Sbjct: 135 A 135

>CAGL0M03399g complement(389650..390294) highly similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, hypothetical start
          Length = 214

 Score = 99.8 bits (247), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 75/122 (61%), Gaps = 2/122 (1%)

Query: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRIC 87
           ED+++ F V   GP+ +PYE GV++L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSIC 86

Query: 88  LDVLKNNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEEWIKHEDTAIAKAKEWTKL 146
           LDV+ + WSP   +  ++   +  LL  PN +DPL N+ A   +K +     K +E+   
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDK 146

Query: 147 YA 148
           YA
Sbjct: 147 YA 148

>YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551)
           Ubiquitin-conjugating enzyme involved in the catabolite
           degradation of fructose-1,6-bisphosphate [657 bp, 218
           aa]
          Length = 218

 Score = 99.0 bits (245), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 74/121 (61%), Gaps = 2/121 (1%)

Query: 30  DNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRICL 88
           D+++ F V   GP+ +PYENGV++L + LPD+YP ++P + F+ KI+HPNID   G ICL
Sbjct: 27  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICL 86

Query: 89  DVLKNNWSPALQ-IRTVLLSVQALLASPNPNDPLANDVAEEWIKHEDTAIAKAKEWTKLY 147
           DV+ + WSP    I  V   +  LL  PN +DPL N+ A   ++ +     K KE+   Y
Sbjct: 87  DVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKY 146

Query: 148 A 148
           A
Sbjct: 147 A 147

>ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH]
           complement(503223..503720) [498 bp, 165 aa]
          Length = 165

 Score = 94.0 bits (232), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 67/125 (53%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KR++KE ++L+ D   GI A P  EDNL  +   IEGP  SPYE GVF   L  P DYP+
Sbjct: 7   KRLMKELQQLLRDSPDGIVAGPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVL-------------KNNWSPALQIRTVLLSVQAL 111
             PK+ F   I HPN+   G +C+ +L                WSP   +  +LLSV ++
Sbjct: 67  SPPKLTFTPSILHPNVYPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>CAGL0M07568g complement(758110..758607) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 93.2 bits (230), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KR+ KE ++L+ D  PGI A P  +DNL  +   I+GP  +PY  GVF  +L  P DYP+
Sbjct: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKN-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugating
           enzyme, associates with Ubc6p on the cytoplasmic side of
           endoplasmic reticulum [498 bp, 165 aa]
          Length = 165

 Score = 92.4 bits (228), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 70/125 (56%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KR++KE ++L+ D  PGI A P  E+N+  +   I+GP  +PY +GVF  +L  P DYP+
Sbjct: 7   KRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKN-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>Scas_694.33
          Length = 231

 Score = 93.6 bits (231), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 77/128 (60%), Gaps = 2/128 (1%)

Query: 30  DNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRICL 88
           ++++ F +   GP+ +PYE GV++L + LPD+YP ++P + F+ KI+HPNID   G ICL
Sbjct: 50  NSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICL 109

Query: 89  DVLKNNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEEWIKHEDTAIAKAKEWTKLY 147
           DV+ + WSP   +  ++   +  LL  PN +DPL N+ A   ++ +     K +E+   Y
Sbjct: 110 DVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELRDKKLYEEKIREYIDKY 169

Query: 148 AKPTQDEE 155
           A   + E+
Sbjct: 170 ATEEKYEQ 177

>Kwal_26.8224
          Length = 165

 Score = 90.9 bits (224), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 66/125 (52%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KR+ KE ++L+ D   GI A P  EDNL  +   I GP  SPY+ GVF   L  P DYP+
Sbjct: 7   KRLFKELQQLLKDSPEGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKN-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 67  SPPKLLFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>Scas_621.4
          Length = 193

 Score = 91.3 bits (225), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 38  TIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSP 97
            I  P +  Y+NG F+  L   D+YPME PKV    +IYHPNID  G++CL++L+ +WSP
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNRIYHPNIDVQGKVCLNILREDWSP 132

Query: 98  ALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKHEDTAIAK 139
           AL ++++++ +  L   PN  DPL  D A  + K +  A AK
Sbjct: 133 ALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFSK-DSNAFAK 173

>Scas_709.49
          Length = 165

 Score = 89.4 bits (220), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 68/125 (54%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           +R++KE ++L  D  PGI A P +E+NL  +   ++GP  + YE G+F   L  P DYP+
Sbjct: 7   RRLLKELQQLTKDSPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKN-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   I  +LLSV ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH]
           (741224..741659,741718..741755) [474 bp, 157 aa]
          Length = 157

 Score = 88.2 bits (217), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 82/151 (54%), Gaps = 7/151 (4%)

Query: 6   KRIIKETERLVSDPVPGITAEP--HED---NLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           +R+ +E ++   D   G  A+P   ED   NL+ ++  I G + + +++GV+ + +  PD
Sbjct: 7   QRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYPITIEYPD 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--NNWSPALQIRTVLLSVQALLASPNPN 118
           DYP + P+V+F    YHPNI   G +CL +L    +W PA+ ++ +LL VQ LL SPNPN
Sbjct: 67  DYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPN 126

Query: 119 DPLANDVAEEWIKHEDTAIAKAKEWTKLYAK 149
            P        + K+      K  E  + YAK
Sbjct: 127 SPAQEPAWRAYAKNLQEYEKKVLEQARRYAK 157

>CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomyces
           cerevisiae YDL064w UBC9 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 157

 Score = 88.2 bits (217), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 84/151 (55%), Gaps = 11/151 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHED-----NLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           +R+ +E ++   D   G  A+P +      NL+ ++  I G + + +++GVF + +  PD
Sbjct: 7   QRLQEERKKWRKDHPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPITVEYPD 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--NNWSPALQIRTVLLSVQALLASPNPN 118
           +YP + PKV+F    YHPNI   G +CL +L    +W PA+ ++ ++L VQ LL SPNPN
Sbjct: 67  EYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPN 126

Query: 119 DPLANDVAEEWIK----HEDTAIAKAKEWTK 145
            P        + K    +E   + +AK++TK
Sbjct: 127 SPAQEPAWRAFSKNKAEYEKKVLIQAKQYTK 157

>Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement
          Length = 233

 Score = 89.7 bits (221), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 68/138 (49%), Gaps = 14/138 (10%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KR++KE ++L  D   GI A P  EDNL  +   I GP  SPYE GVF   L  P DYP+
Sbjct: 75  KRLLKELQQLARDSPEGIVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPL 134

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKN-------------NWSPALQIRTVLLSVQAL 111
             P++ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 135 SPPRLTFTPSILHPNIYPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSM 194

Query: 112 LASPNPNDPLANDVAEEW 129
           L+ PN       D    W
Sbjct: 195 LSEPNVESGANIDACILW 212

>Kwal_23.4227
          Length = 122

 Score = 86.3 bits (212), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 6/121 (4%)

Query: 31  NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDV 90
           NL+ ++  I G + + ++ GVF + +  PDDYP + PKV+F    YHPNI   G +CL +
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFYHPNIYPSGTVCLSI 61

Query: 91  LK--NNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIK----HEDTAIAKAKEWT 144
           L    +W PA+ ++ + L VQ LL SPNPN P        + K    +E   I +AK++T
Sbjct: 62  LNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFSKNVKEYERKVIEQAKKYT 121

Query: 145 K 145
           K
Sbjct: 122 K 122

>KLLA0E07711g complement(693694..694191) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w QRI8 E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 87.4 bits (215), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEPHED-NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           KR++KE E+L  D   GI A P +D NL  +   I GP  S YE GVF   L  P DYP+
Sbjct: 7   KRLLKELEKLTKDSPEGILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKN-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 67  NPPKLTFQPSILHPNIYPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLSVMSI 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>KLLA0E04983g 443446..443919 highly similar to sp|P50623
           Saccharomyces cerevisiae YDL064w UBC9 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 157

 Score = 85.9 bits (211), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 71/122 (58%), Gaps = 7/122 (5%)

Query: 6   KRIIKETERLVSDPVPGITAEPHED-----NLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           +R+ +E ++   D   G  A+P +      NL+ ++  I G   + ++NG++ L +  PD
Sbjct: 7   QRLQEERKKWRKDHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPD 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--NNWSPALQIRTVLLSVQALLASPNPN 118
           DYP + PKV+F    YHPN+   G ICL +L    +W PA+ ++ +LL VQ LL SPNPN
Sbjct: 67  DYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPN 126

Query: 119 DP 120
            P
Sbjct: 127 SP 128

>KLLA0C17248g complement(1509885..1510439) similar to sp|P52491
           Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 184

 Score = 85.9 bits (211), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%)

Query: 42  PQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQI 101
           P    Y  G +   +F+ D YPME P V+ + +IYHPNID  G +CL++L+ +W+PAL I
Sbjct: 67  PDIGYYAGGTYYFNVFIKDTYPMEPPVVKCMHRIYHPNIDIDGNVCLNLLREDWTPALDI 126

Query: 102 RTVLLSVQALLASPNPNDPLANDVAEEWIK 131
           +++++ +  L   PN  DPL  D A+  I+
Sbjct: 127 QSIIIGILFLFHEPNGRDPLNKDAAKTLIE 156

>YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853)
           Rub1p-conjugating enzyme, with similarity to ubiquitin-
           and ubiquitin-like protein-conjugating enzymes [567 bp,
           188 aa]
          Length = 188

 Score = 82.8 bits (203), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 56/96 (58%)

Query: 38  TIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSP 97
            I  P +  Y  G     L   + YP+E PKV  L KI+HPNID  G +CL++L+ +WSP
Sbjct: 66  VIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSP 125

Query: 98  ALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKHE 133
           AL +++++  +  L   PNPNDPL  D A+   + E
Sbjct: 126 ALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGE 161

>CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces
           cerevisiae YLR306w UBC12 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 187

 Score = 81.6 bits (200), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 55/86 (63%)

Query: 42  PQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQI 101
           P +  Y+ G F+      + YP++ PKV    KI+HPNID  G+ICL++L+ +WSPAL +
Sbjct: 71  PDEGFYKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPHGKICLNILREDWSPALDL 130

Query: 102 RTVLLSVQALLASPNPNDPLANDVAE 127
           + ++L + +L   PN NDPL  + AE
Sbjct: 131 QCIVLGLLSLFQEPNGNDPLNKEAAE 156

>YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070)
           Smt3p-conjugating enzyme required for G2/M transition,
           conjugates Smt3p to Pol30p (PCNA) in S phase, which may
           be antagonistic to non-proteolytic ubiquitination of
           Pol30p in the Rad6-dependent DNA repair pathway [474 bp,
           157 aa]
          Length = 157

 Score = 79.0 bits (193), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 70/122 (57%), Gaps = 7/122 (5%)

Query: 6   KRIIKETERLVSDPVPGITAEPHED-----NLRYFQVTIEGPQQSPYENGVFQLELFLPD 60
           +R+ +E ++   D   G  A+P +      +L+ ++  I G + + +  GV+ + +  P+
Sbjct: 7   QRLQEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPN 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--NNWSPALQIRTVLLSVQALLASPNPN 118
           +YP + PKV+F    YHPN+   G ICL +L    +W PA+ ++ ++L VQ LL SPNPN
Sbjct: 67  EYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPN 126

Query: 119 DP 120
            P
Sbjct: 127 SP 128

>ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH]
           (634059..634610,634663..634713) [603 bp, 200 aa]
          Length = 200

 Score = 79.3 bits (194), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 61/102 (59%), Gaps = 3/102 (2%)

Query: 30  DNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLD 89
           +N  Y +++   P++  Y  G F+  +   D YP+E P V+ L  IYHPNID  G ICL+
Sbjct: 74  ENKVYLRIS---PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLNTIYHPNIDYSGNICLN 130

Query: 90  VLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIK 131
           VL+ +WSP + ++TV+L +  L   PN +DPL    A+  ++
Sbjct: 131 VLREDWSPVMDLQTVVLGLLFLFLEPNGSDPLNRQAADTMLR 172

>Sklu_1826.3 YGR133W, Contig c1826 3548-4033
          Length = 161

 Score = 75.9 bits (185), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (59%), Gaps = 6/102 (5%)

Query: 31  NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFL----TKIYHPNID-RLGR 85
           N+ ++   I GP ++PY + VF L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95

Query: 86  ICLDVL-KNNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126
           ICLD+L + +WSP   +  V+ ++  LL  P P  PL  D+A
Sbjct: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137

>KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 292

 Score = 76.3 bits (186), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 58/111 (52%), Gaps = 12/111 (10%)

Query: 43  QQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNN-------- 94
           ++S Y  G F+ ++  PDD+P   P  RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 50  EESIYHGGYFKAQMKFPDDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHQSGNPTSDEP 109

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKHEDTAIAKAK 141
               WSP   + +VL+S+ +LL  PN + P   D A ++ K+ D    K K
Sbjct: 110 DEETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYKKNPDQYKQKVK 160

>Kwal_55.21246
          Length = 160

 Score = 73.6 bits (179), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 63/101 (62%), Gaps = 3/101 (2%)

Query: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86
           +DNL  ++  I GP  +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92

Query: 87  CLDVL-KNNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126
           C+++L + +WSPA  +  ++ ++  LLA+P P+ PL  D+A
Sbjct: 93  CINLLERAHWSPAWDLLHLVHAIWLLLANPEPDSPLDVDLA 133

>Scas_712.59
          Length = 171

 Score = 72.8 bits (177), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 31  NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88
           +L ++Q  I+GPQ +PY N  FQL++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103

Query: 89  DVL-KNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
           D+L K +W+PA  + T + ++  LL  P P+ PL  D+A 
Sbjct: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIAN 143

>YDR054C (CDC34) [905] chr4 complement(561436..562323)
           Ubiquitin-conjugating enzyme (E2); component of the SCF
           (Skp1p-Cdc53p-F-box) complexes which act with various
           F-box proteins to direct target proteins into the
           ubiquitin-dependent degradation pathway [888 bp, 295 aa]
          Length = 295

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (53%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNN-------- 94
           + S Y  G F+ ++  P+D+P   P+ RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKH 132
               WSP   + +VL+S+ +LL  PN N P   D A ++ K+
Sbjct: 111 DAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 251

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 59/114 (51%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KR+ KE + +V++P P I A PHEDN+  +   I GP  +PYENG +   L  P DYP  
Sbjct: 8   KRLTKEYKNIVNNPPPFIIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTFPSDYPFN 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKNNWSPALQIRTVLLSVQALLAS 114
            P +R +T    PN       R+CL   D     W+PA  + T+L  + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMTG 117

>Kwal_27.10444
          Length = 278

 Score = 73.2 bits (178), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 55/104 (52%), Gaps = 12/104 (11%)

Query: 43  QQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNN-------- 94
           + S Y  G F+ ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHTSGDPTSEEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKHED 134
               WSP   + +VL+S+ +LL  PN + P   D A ++ K+ D
Sbjct: 111 DSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNAD 154

>CAGL0E04598g complement(444288..445175) highly similar to sp|P14682
           Saccharomyces cerevisiae YDR054c CDC34 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 295

 Score = 73.2 bits (178), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (53%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNN-------- 94
           + S Y  G F+ ++  PDD+P   P+ RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKH 132
               WSP   + +VL+S+ +LL  PN + P   D A ++ K+
Sbjct: 111 DAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKN 152

>Scas_635.18
          Length = 273

 Score = 72.4 bits (176), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNN-------- 94
           + S Y  G F+ ++  P+D+P   P+ RF   IYHPN+ R GR+C+ +L           
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQGGDPMTDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKH 132
               WSP   + +VL+S+ +LL  PN + P   D A ++ K+
Sbjct: 111 DAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH]
           (317749..318561) [813 bp, 270 aa]
          Length = 270

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNN-------- 94
           + S Y  G F+ ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPSFRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKH 132
               WSP   + +VL+S+ +LL  PN + P   D A ++ K+
Sbjct: 111 DSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Scas_718.34
          Length = 258

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (53%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNN-------- 94
           + S Y  G FQ ++  P D+P   P+ +F+  IYHPN+ R G++C+ +L  +        
Sbjct: 58  KDSIYHGGYFQSQMKFPKDFPFSPPQFKFIPPIYHPNVYRDGKLCISILHQSGDAMTSEP 117

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKH 132
               WSP   + +VL+S+ +LL  PN + P   D A E+ K+
Sbjct: 118 DNETWSPVQSVESVLISIVSLLEDPNVSSPANVDAAVEYRKN 159

>Sklu_2136.5 YDR054C, Contig c2136 7737-8555
          Length = 272

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 43  QQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNN-------- 94
           + S Y  G F+ ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L  +        
Sbjct: 51  EDSIYHGGYFKAQMKFPEDFPFSPPNFRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEP 110

Query: 95  ----WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKH 132
               WSP   + +VL+S+ +LL  PN + P   D A ++ K+
Sbjct: 111 DSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH]
           complement(1419828..1420556) [729 bp, 242 aa]
          Length = 242

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KR+ KE + +  +P P I A P EDN+  +   I GP ++PYE+G +   L  P+DYP  
Sbjct: 8   KRLSKEYKMMTENPPPYIVAAPKEDNILVWHYVITGPPETPYEDGQYHGTLVFPNDYPFN 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKNNWSPALQIRTVLLSVQALLAS 114
            P +R LT    PN       R+CL   D   + W+P+  + T+L  + + + +
Sbjct: 68  PPAIRMLT----PNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMTT 117

>YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugating
           enzyme, anchored in the ER membrane with the
           catalytically active domain in cytoplasm [753 bp, 250
           aa]
          Length = 250

 Score = 70.5 bits (171), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KR+ KE + +V +P P I A P+EDN+  +   I GP  +PY+ G +   L  P DYP +
Sbjct: 8   KRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYK 67

Query: 66  APKVRFLT--KIYHPNIDRLGRICL---DVLKNNWSPALQIRTVLLSVQALLAS 114
            P +R +T    + PN     R+CL   D   + W+P   + T+L  + + + S
Sbjct: 68  PPAIRMITPNGRFKPNT----RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTS 117

>Kwal_27.10837
          Length = 246

 Score = 69.3 bits (168), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 5/112 (4%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KR+ KE + +V +P P I A+P+EDN+  +   I GP  +PY  G +   L  P DYP +
Sbjct: 8   KRLSKEYKSMVENPPPFIIAQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFK 67

Query: 66  APKVRFLTKIYHPNIDRLGRICL---DVLKNNWSPALQIRTVLLSVQALLAS 114
            P +R +T       D   R+CL   D   + W+P+  + T+L  + + + S
Sbjct: 68  PPAIRMVTPSGRFKED--TRLCLSMSDYHPDTWNPSWSVSTILTGLLSFMTS 117

>Scas_599.16
          Length = 224

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (53%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KR+ KE + +V +P+P I A P+EDN+  +   I GP  +PY++G +   L  P DYP +
Sbjct: 110 KRLTKEYKLMVENPLPYILARPNEDNILEWHYIITGPPDTPYKDGQYHGTLTFPSDYPYK 169

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKNNWSPALQIRTVLLSVQALLAS 114
            P +R +T    PN       R+CL   D   + W+P   + T+L  + +L+  
Sbjct: 170 PPAIRMIT----PNGRFKDNTRLCLSMSDYHPDLWNPGWSVNTILNGLLSLMTG 219

>CAGL0I10450g complement(1024541..1025029) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w ubiquitin-conjugating
           enzyme - peroxin, hypothetical start
          Length = 162

 Score = 65.9 bits (159), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIY-------HPNID 81
            D  R+F V I+GP ++PY    F+L + +P  YPM  P ++F++          H N+D
Sbjct: 32  SDLSRWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90

Query: 82  -RLGRICLDVLK-NNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126
            R G ICLD+LK   WSP   I  V+ ++  LL  P P+ PL  D+A
Sbjct: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA 137

>AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH]
           complement(1006421..1006888) [468 bp, 155 aa]
          Length = 155

 Score = 65.5 bits (158), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (55%), Gaps = 3/99 (3%)

Query: 31  NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88
           +L  ++   +GP+ +PY    F L + +P+ YP E PK  F    I HPNI    G +CL
Sbjct: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92

Query: 89  DVLKNN-WSPALQIRTVLLSVQALLASPNPNDPLANDVA 126
           D+LK+  WSP   +  V+ ++  LLA P  + PL  D++
Sbjct: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131

>Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement
          Length = 251

 Score = 67.0 bits (162), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KR+ KE + ++ +P   I A+P+EDN+  +   I GP  +PY +G +   L  P DYP +
Sbjct: 8   KRLTKEYKAIIENPPQFINAQPNEDNILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKNNWSPALQIRTVLLSVQALLAS 114
            P +R +T    PN       R+C+   D   + W+PA  + T+L+ + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCMTMSDYHPDTWNPAWSVATILMGLLSFMTG 117

>CAGL0I05478g complement(518933..519673) highly similar to sp|P33296
           Saccharomyces cerevisiae YER100w UBC6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 246

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KR+ KE + +V +P P I A P+E+N+  +   I GP  +PY+ G +   L  P DYP +
Sbjct: 8   KRLTKEYKMMVENPPPFIIARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKNNWSPALQIRTVLLSVQALLAS 114
            P +R +T    PN       R+CL   D   + W+P   + T+L  + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMTG 117

>YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugating
           enzyme and peroxisomal biogenesis protein (peroxin) [552
           bp, 183 aa]
          Length = 183

 Score = 64.3 bits (155), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 6   KRIIKETERL---------VSDPVPGITAEPH---EDNLRYFQVTIEGPQQSPYENGVFQ 53
            RI+KE + +         +++P  GI    +   E +L  ++  I GP  +PYEN  F+
Sbjct: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79

Query: 54  LELFLPDDYPMEAPKVRFL-TKIYHPNIDR-LGRICLDVLK-NNWSPALQIRTVLLSVQA 110
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + +V  
Sbjct: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139

Query: 111 LLASPNPNDPLANDVA 126
           LL  P  + PL  D+ 
Sbjct: 140 LLREPVCDSPLDVDIG 155

>Scas_609.7
          Length = 240

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPME 65
           KR+ KE + ++ +P P I A P+E+N+  +   I GP  +PY  G +   L  P DYP +
Sbjct: 8   KRLSKEYKLIIENPTPYILARPNENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKNNWSPALQIRTVLLSVQALLAS 114
            P +R +T    PN       R+CL   D   + W+P   + T+L  + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCLSMSDYHPDLWNPGWSVATILNGLLSFMTG 117

>KLLA0E03916g complement(365119..365595) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w PAS2 E2
           ubiquitin-conjugating enzyme - peroxin, start by
           similarity
          Length = 158

 Score = 59.3 bits (142), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 61/105 (58%), Gaps = 8/105 (7%)

Query: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82
           +D+L  +    +GP +SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88

Query: 83  LGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
            G ICLD+LK+ W+P   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133

>Scas_551.9
          Length = 153

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 47/89 (52%), Gaps = 5/89 (5%)

Query: 10  KETERLVSDPVPGITAEP--HED---NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPM 64
           K  ++   D   G  A+P  H D   NL+ ++  I G + + +  GV+ + +  P++YP 
Sbjct: 65  KNRKKWRKDHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPS 124

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKN 93
           + PKV+     YHPN+   G ICL +L N
Sbjct: 125 KPPKVKLPANFYHPNVYPSGTICLSILWN 153

>Kwal_27.11182
          Length = 101

 Score = 47.0 bits (110), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 3/87 (3%)

Query: 32  LRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDV 90
           + Y+  TI GP  S +EN ++ + L   + YP E PK++F++KI  P +++  G +  D 
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPCVNQTTGEVKRDQ 60

Query: 91  LKN--NWSPALQIRTVLLSVQALLASP 115
                +W  +  + T+LL ++  +A P
Sbjct: 61  FSTLRDWKRSYNMETLLLDLRKEMALP 87

>YGL087C (MMS2) [1895] chr7
           complement(346407..346809,346895..346905)
           Ubiquitin-conjugating enzyme variant (UEV) protein
           required for resistance to DNA damaging agents and
           non-proteolytic multi-ubiquitination of Pol30p (PCNA)
           [414 bp, 137 aa]
          Length = 137

 Score = 43.5 bits (101), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 38  TIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLDVLK-NNW 95
           TI GP  S +EN ++ L +    +YP   PKV F++KI  P ++   G +  D     +W
Sbjct: 44  TILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRDW 103

Query: 96  SPALQIRTVLLSVQALLASP 115
             A  + T+LL ++  +A+P
Sbjct: 104 KRAYTMETLLLDLRKEMATP 123

>CAGL0H03157g
           join(complement(297881..297891),
           complement(297272..297680)) highly similar to sp|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 63/125 (50%), Gaps = 11/125 (8%)

Query: 1   MAALPK--RIIKETER----LVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQL 54
           M+ +P+  R+++E E+    L  +      A+  +  +  +  TI GP  S +EN ++ +
Sbjct: 1   MSKVPRSFRLLEELEKGEKGLGPESCSYGLADADDITMTRWNGTILGPPHSNHENRIYSV 60

Query: 55  ELFLPDDYPMEAPKVRFLTKIYHPNIDR----LGRICLDVLKNNWSPALQIRTVLLSVQA 110
            +     YP E P + F++KI  P +D+    + +   + LK +W     + T+LL ++ 
Sbjct: 61  SIECGPKYPDEPPTITFISKINLPCVDQSTGEVNKEKFNTLK-DWKRLYNMETILLDLRK 119

Query: 111 LLASP 115
            +ASP
Sbjct: 120 EMASP 124

>KLLA0E19217g join(complement(1703226..1703236), highly similar to
           sp|P53152 Saccharomyces cerevisiae YGL087c MMS2 part of
           the error-free postreplication repair pathway singleton,
           start by similarity
          Length = 139

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 38  TIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDVLKN--N 94
           TI GP  S +EN ++ + +     YP E PKV+F++KI  P ++   G +  +       
Sbjct: 44  TILGPPHSNHENRIYSVLIECGPSYPDEPPKVKFVSKINLPCVNSTTGEVVKEKFHTLKE 103

Query: 95  WSPALQIRTVLLSVQALLASPN 116
           W  +  + TVLL ++  +A+P+
Sbjct: 104 WKRSYTMETVLLELRKEMATPS 125

>Scas_720.10*
          Length = 134

 Score = 41.2 bits (95), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 38  TIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRI---CLDVLKN 93
           TI GP  S +EN ++ + +     YP   P ++F++KI  P +D + G +       L+ 
Sbjct: 40  TILGPPHSNHENRIYSVAIHCGPHYPDAPPTIKFVSKINLPCVDEKTGEVKQASFHTLR- 98

Query: 94  NWSPALQIRTVLLSVQALLASP 115
           +W  +  + T+LL ++  +ASP
Sbjct: 99  DWKRSYTMETLLLDLRKEMASP 120

>AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH]
           complement(314210..314220,314273..314678) [417 bp, 138
           aa]
          Length = 138

 Score = 40.8 bits (94), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 31  NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLD 89
           ++ ++  TI GP  S +EN ++ + +    +YP   PKVRF+++I  P +D   G +  +
Sbjct: 37  SMTHWNGTILGPPHSSHENRIYSVVIECGAEYPDRPPKVRFISRINLPCVDPSTGEVRPE 96

Query: 90  VLK--NNWSPALQIRTVLLSVQALLAS 114
                 +W  +  + T+L  ++  +AS
Sbjct: 97  AFHALRDWKRSSNMETLLQDLRKEMAS 123

>Kwal_23.4090
          Length = 2050

 Score = 30.4 bits (67), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 4    LPKRIIKE---TERLVSDPVPGITAEPHEDNLRYFQ 36
            L K IIKE    +RL+   +P +TA+P E    YFQ
Sbjct: 1992 LKKNIIKENVKADRLIGKYIPNLTAKPFEITKEYFQ 2027

>Scas_719.33
          Length = 2045

 Score = 28.5 bits (62), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 4    LPKRIIKE---TERLVSDPVPGITAEPHEDNLRYFQ 36
            L K IIKE    +RLV   +P +TA+P      YFQ
Sbjct: 1987 LKKNIIKENVKVDRLVGKYIPNLTAKPFAVTKEYFQ 2022

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 27.3 bits (59), Expect = 6.6,   Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 72  LTKIYHPNIDRLGRICLDVLKN 93
           L K+ HPNI R+ + C+D L N
Sbjct: 193 LEKLNHPNIIRIHQSCVDALGN 214

>KLLA0B02717g 240125..246268 highly similar to sp|P07149 Saccharomyces
            cerevisiae YKL182w FAS1 fatty-acyl-CoA synthase, beta
            chain singleton, start by similarity
          Length = 2047

 Score = 27.3 bits (59), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 4    LPKRIIKE---TERLVSDPVPGITAEPHEDNLRYFQ 36
            L K + KE    +RL+   +P +TA+P E    YFQ
Sbjct: 1989 LMKNVTKENVKADRLIGKYIPNLTAKPFEITKEYFQ 2024

>AFL181C [3014] [Homologous to ScYMR202W (ERG2) - SH]
           (99899..100567) [669 bp, 222 aa]
          Length = 222

 Score = 26.9 bits (58), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVL-KNNWSPALQIRTVLLSVQALLASPNPND 119
            Y M A    +L + Y  +   L RIC  V+ K+N   A+  R +L  V+  LA+    +
Sbjct: 14  GYVMNAALYSWLPRNYMFDPHTLNRICNTVIAKHNARGAVAPRALLQDVRDALAAHYGEE 73

Query: 120 PLANDVAEEWI 130
            +   V +EW+
Sbjct: 74  YINRYVEDEWV 84

>Sklu_2323.1 YPL207W, Contig c2323 491-2812 reverse complement
          Length = 773

 Score = 27.3 bits (59), Expect = 7.5,   Method: Composition-based stats.
 Identities = 10/18 (55%), Positives = 13/18 (72%)

Query: 139 KAKEWTKLYAKPTQDEEP 156
           K +EW +L AK  QD+EP
Sbjct: 318 KVEEWAELLAKTLQDDEP 335

>CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein,
           start by similarity
          Length = 422

 Score = 26.9 bits (58), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 7   RIIKETERLVSDP---VPGITAEPHEDN-LRYFQVTIEGPQQSP---YENGVFQLELFLP 59
            II++TE  V+ P   V G+      DN +R        P  +P   + + + QL   + 
Sbjct: 58  HIIRDTEETVAFPTETVYGLGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIY 117

Query: 60  DDYPMEAPKVRFLTKIYHPNIDRL 83
           +DY  +   +R + KIYHP I++L
Sbjct: 118 NDYE-DGDILRNIPKIYHPLIEKL 140

>YKL182W (FAS1) [3090] chr11 (100676..106831) Fatty-acyl-CoA synthase,
            beta chain, contains acetyl transferase, enoyl reductase,
            enoyl dehydratase, and malonyl/palmitoyl transferase
            activities in a single polypeptide [6156 bp, 2051 aa]
          Length = 2051

 Score = 27.3 bits (59), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 4    LPKRIIKE---TERLVSDPVPGITAEPHEDNLRYFQ 36
            L K IIKE     RL    +P +TA+P +    YFQ
Sbjct: 1992 LKKNIIKENVKVARLAGKYIPNLTAKPFQVTKEYFQ 2027

>KLLA0E22220g complement(1974635..1975786) similar to sp|P32628
           Saccharomyces cerevisiae YEL037c RAD23 nucleotide
           excision repair protein (ubiquitin-like protein)
           singleton, start by similarity
          Length = 383

 Score = 26.9 bits (58), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 113 ASPNPNDPLANDVAEEWIKHEDTAIAKAK 141
           A  N N  +A DV  ++ +HED   A+A+
Sbjct: 197 AGANANSEVATDVPSQFTEHEDNLFAQAE 225

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,687,015
Number of extensions: 236496
Number of successful extensions: 673
Number of sequences better than 10.0: 100
Number of HSP's gapped: 617
Number of HSP's successfully gapped: 100
Length of query: 157
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 64
Effective length of database: 13,376,635
Effective search space: 856104640
Effective search space used: 856104640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)