Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17578g1525150176320.0
AGR123C1422150546560.0
Kwal_56.234421435151046450.0
Scas_576.61457151145760.0
YER164W (CHD1)1468151644940.0
CAGL0L11770g1476141944830.0
Scas_665.17106057511961e-142
YOR304W (ISW2)112057511681e-138
CAGL0I09614g103954111591e-137
Kwal_34.15925102554511551e-137
KLLA0F24838g106254411511e-136
AFR537W102554011361e-134
CAGL0C01683g111559711141e-130
AFL040W108658911051e-129
KLLA0F04521g134457110981e-126
Scas_652.17102559110771e-126
KLLA0F06710g109660210811e-126
YBR245C (ISW1)112952310801e-125
AER375C128850910861e-125
Scas_662.7134250910851e-124
Scas_597.8106559810661e-124
Kwal_23.4777130156210781e-124
Kwal_14.1600110252110591e-123
YIL126W (STH1)135951810621e-121
CAGL0G08756g135452910431e-119
Kwal_26.9164145453110471e-118
Scas_594.7170351810391e-116
AFR562C144451310201e-115
KLLA0B08327g153456310231e-115
YOR290C (SNF2)170351510231e-114
CAGL0M04807g173050910201e-114
CAGL0J02662g8445618534e-97
KLLA0E04048g8265578288e-94
Kwal_47.180778095978205e-93
Scas_520.58635518175e-92
ADL098C8046038055e-91
KLLA0F07513g10485496992e-75
YJR035W (RAD26)10855646851e-73
ACR286C10195396822e-73
CAGL0I01694g10715546717e-72
YAL019W (FUN30)11315746657e-71
CAGL0H05533g19045646728e-71
KLLA0E23804g18735296711e-70
Sklu_2125.310525256573e-70
AEL065C10255606554e-70
YPL082C (MOT1)18675336655e-70
AEL256C18665526647e-70
Scas_549.410795246549e-70
KLLA0E22726g10335496511e-69
Scas_664.918595336541e-68
CAGL0H06193g11265396372e-67
CAGL0M01188g14503405832e-60
Scas_646.3*14563245752e-59
Kwal_34.160827264795573e-59
Kwal_55.2014314943235716e-59
KLLA0F21758g15723235717e-59
KLLA0A03069g8954795617e-59
ADR309W14863235691e-58
YDR334W15143245681e-58
Scas_668.188755445553e-58
Scas_669.2013973295474e-56
CAGL0E05038g14843515458e-56
KLLA0E08965g14893305441e-55
AEL297W8954815296e-55
AGR379W14143295351e-54
Kwal_14.15378424805232e-54
YGL163C (RAD54)8984865233e-54
YGL150C (INO80)14893275296e-54
Kwal_27.1138813343445261e-53
CAGL0I04224g9424885192e-53
YFR038W8532835101e-52
KLLA0F11814g9314844995e-51
CAGL0M01958g9204964923e-50
AGL212W9034844906e-50
YBR073W (RDH54)9244904881e-49
Scas_718.409264964763e-48
Kwal_27.105139004874692e-47
Kwal_26.712310813274338e-43
Scas_548.410543203981e-38
Sklu_1582.22831623662e-38
ADL345C7462162485e-21
CAGL0K07766g8302602461e-20
KLLA0C05368g16051442443e-20
Scas_591.107722362253e-18
YBR114W (RAD16)7902132227e-18
Kwal_14.186813573782211e-17
KLLA0B09240g8002092172e-17
CAGL0G09493g14083462193e-17
Kwal_23.36607681312163e-17
AAR147W15801332112e-16
Scas_721.10011371362093e-16
YLR032W (RAD5)11691382066e-16
CAGL0A03432g11511382067e-16
Kwal_47.177719721382004e-15
Scas_674.12d13231281986e-15
AFR220W10851291961e-14
KLLA0F17479g11141341932e-14
Sklu_2412.711273341871e-13
YOR191W (RIS1)16191341862e-13
YLR247C15561301531e-09
CAGL0B05049g14701311503e-09
Scas_573.915021231404e-08
KLLA0F12166g15281281395e-08
AAL030C15391551361e-07
Kwal_14.128715181171298e-07
Sklu_2234.210061591163e-05
Sklu_2432.914751021073e-04
CAGL0L03047g715111870.054
AFR082C71083800.43
KLLA0F10505g812124790.54
Kwal_56.24760433159780.68
Scas_711.345275761.1
ADL273C623131761.1
Kwal_47.1667121366722.3
YDR110W (FOB1)56697714.5
Scas_587.791049714.9
Scas_554.128960696.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17578g
         (1501 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...  2944   0.0  
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...  1798   0.0  
Kwal_56.23442                                                        1793   0.0  
Scas_576.6                                                           1767   0.0  
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...  1735   0.0  
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...  1731   0.0  
Scas_665.17                                                           465   e-142
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   454   e-138
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   451   e-137
Kwal_34.15925                                                         449   e-137
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   447   e-136
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   442   e-134
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   433   e-130
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   430   e-129
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   427   e-126
Scas_652.17                                                           419   e-126
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   421   e-126
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   420   e-125
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   422   e-125
Scas_662.7                                                            422   e-124
Scas_597.8                                                            415   e-124
Kwal_23.4777                                                          419   e-124
Kwal_14.1600                                                          412   e-123
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   413   e-121
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   406   e-119
Kwal_26.9164                                                          407   e-118
Scas_594.7                                                            404   e-116
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   397   e-115
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   398   e-115
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   398   e-114
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   397   e-114
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   333   4e-97
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   323   8e-94
Kwal_47.18077                                                         320   5e-93
Scas_520.5                                                            319   5e-92
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   314   5e-91
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   273   2e-75
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   268   1e-73
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   267   2e-73
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   263   7e-72
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   260   7e-71
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   263   8e-71
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   263   1e-70
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           257   3e-70
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   256   4e-70
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   260   5e-70
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   260   7e-70
Scas_549.4                                                            256   9e-70
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   255   1e-69
Scas_664.9                                                            256   1e-68
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   249   2e-67
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   229   2e-60
Scas_646.3*                                                           226   2e-59
Kwal_34.16082                                                         219   3e-59
Kwal_55.20143                                                         224   6e-59
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   224   7e-59
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...   220   7e-59
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   223   1e-58
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   223   1e-58
Scas_668.18                                                           218   3e-58
Scas_669.20                                                           215   4e-56
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   214   8e-56
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   214   1e-55
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...   208   6e-55
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   210   1e-54
Kwal_14.1537                                                          206   2e-54
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...   206   3e-54
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   208   6e-54
Kwal_27.11388                                                         207   1e-53
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...   204   2e-53
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   201   1e-52
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   196   5e-51
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   194   3e-50
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   193   6e-50
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   192   1e-49
Scas_718.40                                                           187   3e-48
Kwal_27.10513                                                         185   2e-47
Kwal_26.7123                                                          171   8e-43
Scas_548.4                                                            157   1e-38
Sklu_1582.2 , Contig c1582 197-1048                                   145   2e-38
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...   100   5e-21
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    99   1e-20
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    99   3e-20
Scas_591.10                                                            91   3e-18
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    90   7e-18
Kwal_14.1868                                                           90   1e-17
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    88   2e-17
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    89   3e-17
Kwal_23.3660                                                           88   3e-17
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    86   2e-16
Scas_721.100                                                           85   3e-16
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    84   6e-16
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    84   7e-16
Kwal_47.17771                                                          82   4e-15
Scas_674.12d                                                           81   6e-15
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    80   1e-14
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    79   2e-14
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          77   1e-13
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    76   2e-13
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    64   1e-09
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    62   3e-09
Scas_573.9                                                             59   4e-08
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    58   5e-08
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    57   1e-07
Kwal_14.1287                                                           54   8e-07
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         49   3e-05
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              46   3e-04
CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces c...    38   0.054
AFR082C [3274] [Homologous to ScYKR024C (DBP7) - SH] (576175..57...    35   0.43 
KLLA0F10505g complement(966736..969174) some similarities with s...    35   0.54 
Kwal_56.24760                                                          35   0.68 
Scas_711.3                                                             34   1.1  
ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C (...    34   1.1  
Kwal_47.16671                                                          32   2.3  
YDR110W (FOB1) [959] chr4 (676096..677796) Protein required for ...    32   4.5  
Scas_587.7                                                             32   4.9  
Scas_554.1                                                             31   6.7  

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
            cerevisiae YER164w CHD1 transcriptional regulator, start
            by similarity
          Length = 1525

 Score = 2944 bits (7632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1433/1501 (95%), Positives = 1433/1501 (95%)

Query: 1    MVQDLPDEVLANPELYGLRRSHRAAITHNTYAGLDSDSDEEVIRPRRGKQKRKAVKQEHN 60
            MVQDLPDEVLANPELYGLRRSHRAAITHNTYAGLDSDSDEEVIRPRRGKQKRKAVKQEHN
Sbjct: 1    MVQDLPDEVLANPELYGLRRSHRAAITHNTYAGLDSDSDEEVIRPRRGKQKRKAVKQEHN 60

Query: 61   YDXXXXXXXXIDDFSDTDDFGSKRKPTRAPSAKRGRKRVSAGNSKSKRQAKRVEESDEEN 120
            YD        IDDFSDTDDFGSKRKPTRAPSAKRGRKRVSAGNSKSKRQAKRVEESDEEN
Sbjct: 61   YDEEEEEEEEIDDFSDTDDFGSKRKPTRAPSAKRGRKRVSAGNSKSKRQAKRVEESDEEN 120

Query: 121  VVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDGYSASPSPQ 180
            VVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDGYSASPSPQ
Sbjct: 121  VVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDGYSASPSPQ 180

Query: 181  QETHSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSWESYEDL 240
            QETHSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSWESYEDL
Sbjct: 181  QETHSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSWESYEDL 240

Query: 241  KENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFKVPERII 300
            KENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFKVPERII
Sbjct: 241  KENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFKVPERII 300

Query: 301  DSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTNSKIMPQ 360
            DSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTNSKIMPQ
Sbjct: 301  DSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTNSKIMPQ 360

Query: 361  NSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKT 420
            NSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKT
Sbjct: 361  NSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKT 420

Query: 421  VQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQD 480
            VQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQD
Sbjct: 421  VQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQD 480

Query: 481  YEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYES 540
            YEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYES
Sbjct: 481  YEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYES 540

Query: 541  LNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYIRDLHK 600
            LNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYIRDLHK
Sbjct: 541  LNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYIRDLHK 600

Query: 601  RLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVSL 660
            RLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVSL
Sbjct: 601  RLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVSL 660

Query: 661  LNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXX 720
            LNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSG             
Sbjct: 661  LNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGKMVLLDKLLTRLK 720

Query: 721  XDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFL 780
             DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFL
Sbjct: 721  KDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFL 780

Query: 781  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEE 840
            LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEE
Sbjct: 781  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEE 840

Query: 841  VLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKL 900
            VLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKL
Sbjct: 841  VLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKL 900

Query: 901  EDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPXXXXXXXXX 960
            EDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIP         
Sbjct: 901  EDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPEDELKKLKD 960

Query: 961  XXQRRIDEEYVREQLDIMNRKTAAIDKIKRSVNGETFGSDSEDEGNSKSRKRSKANNLDA 1020
              QRRIDEEYVREQLDIMNRKTAAIDKIKRSVNGETFGSDSEDEGNSKSRKRSKANNLDA
Sbjct: 961  EEQRRIDEEYVREQLDIMNRKTAAIDKIKRSVNGETFGSDSEDEGNSKSRKRSKANNLDA 1020

Query: 1021 FGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETLMRDEEA 1080
            FGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETLMRDEEA
Sbjct: 1021 FGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETLMRDEEA 1080

Query: 1081 KRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFEFHDTKAL 1140
            KRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFEFHDTKAL
Sbjct: 1081 KRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFEFHDTKAL 1140

Query: 1141 NADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDEKLLIGIY 1200
            NADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDEKLLIGIY
Sbjct: 1141 NADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDEKLLIGIY 1200

Query: 1201 KYGYGAWMQIRDDPFLGLTEKLFLNNEVTQKXXXXXXXXXXXXXXXXXXXXXXXXXXDAV 1260
            KYGYGAWMQIRDDPFLGLTEKLFLNNEVTQK                          DAV
Sbjct: 1201 KYGYGAWMQIRDDPFLGLTEKLFLNNEVTQKAATPAAPSLTPSAPGASVAGSSTPGADAV 1260

Query: 1261 KTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEAKGPQTDPSHP 1320
            KTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEAKGPQTDPSHP
Sbjct: 1261 KTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEAKGPQTDPSHP 1320

Query: 1321 AXXXXXXXXXPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLTGKDSTPDNSSE 1380
            A         PQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLTGKDSTPDNSSE
Sbjct: 1321 AGSSSTGTTTPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLTGKDSTPDNSSE 1380

Query: 1381 TKRGKAHHHQQPSSRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKEYDSMDEEECKKTM 1440
            TKRGKAHHHQQPSSRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKEYDSMDEEECKKTM
Sbjct: 1381 TKRGKAHHHQQPSSRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKEYDSMDEEECKKTM 1440

Query: 1441 TNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKTSPEKYKRHLWSFT 1500
            TNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKTSPEKYKRHLWSFT
Sbjct: 1441 TNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKTSPEKYKRHLWSFT 1500

Query: 1501 A 1501
            A
Sbjct: 1501 A 1501

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..985231)
            [4269 bp, 1422 aa]
          Length = 1422

 Score = 1798 bits (4656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 945/1505 (62%), Positives = 1144/1505 (76%), Gaps = 114/1505 (7%)

Query: 1    MVQDLPDEVLANPELYGLRRSHRAAITHNTYAGLDSDSDEE--VIRPRRGKQKRKAVKQE 58
            M +DLPDEVLANPELYGLRRSHR  +  +T A     +D+E  V+   RG++++KA+   
Sbjct: 1    MAKDLPDEVLANPELYGLRRSHRTPVGGSTQATYYESNDDEDSVVVSGRGRKRKKAI--- 57

Query: 59   HNYDXXXXXXXXIDDFSDTDDFGSKRKPTRAPSAKRGRKRVSAGNSKSKRQAKRVEESDE 118
             + D         ++ ++ D  G + +   AP                +R+  R E S E
Sbjct: 58   -DIDSYSEEEPADNESTNEDISGDEDEDFGAPVR-------------RRRKKGRRELSAE 103

Query: 119  ENVVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDGYSASPS 178
            ++++LPTRFSSRNN K +NY  N D +D+DL+ES+EE+ EG   D  + +     + + +
Sbjct: 104  DDIMLPTRFSSRNN-KAVNY--NIDYSDDDLLESAEEEYEGDEGDEGEEE-----AYAQT 155

Query: 179  PQ-QETHSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSWESY 237
            PQ  + H ID VV HRL EG      T+   WDV   +  +EFLIKW ++SH+HN+WE+ 
Sbjct: 156  PQIPDEHGIDFVVTHRLHEG-----HTEPVEWDVPECKECYEFLIKWNNESHIHNTWETA 210

Query: 238  EDLKENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFKVPE 297
            E L     +G+K+++NY KQ+I+LD E+R D YTTREDIEVMDLEHERR DEFEEFK  E
Sbjct: 211  ESL--GNVRGVKKVDNYIKQYILLDHELRTDKYTTREDIEVMDLEHERRCDEFEEFKKVE 268

Query: 298  RIIDSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTNSKI 357
            RIIDS+R   +DGS  SQL+YLVKW+RLNYDE TWE AS IVKMAPE+VK FQ+R++SKI
Sbjct: 269  RIIDSDRVTLDDGS--SQLQYLVKWKRLNYDEATWENASVIVKMAPEEVKRFQSRSSSKI 326

Query: 358  MPQNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGL 417
            +PQ+SSNY  +QRP FEKL  QPSFIKGGELRDFQLTGINWMAFLWSK+DNGILADEMGL
Sbjct: 327  LPQHSSNY-GSQRPGFEKLSVQPSFIKGGELRDFQLTGINWMAFLWSKSDNGILADEMGL 385

Query: 418  GKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDL 477
            GKTVQTVSFISWLI+ARRQNGPHLVVVPLSTMPAWQETF+KWAP LNCVYYMGNQ SRD+
Sbjct: 386  GKTVQTVSFISWLIFARRQNGPHLVVVPLSTMPAWQETFEKWAPELNCVYYMGNQKSRDV 445

Query: 478  IQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSL 537
            I++YEFYTNP  KGKK++KFNVLLTTYEYILKDR  LG+IKWQFLAVDEAHRLKNAESSL
Sbjct: 446  IREYEFYTNPHTKGKKNIKFNVLLTTYEYILKDRLELGAIKWQFLAVDEAHRLKNAESSL 505

Query: 538  YESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYIRD 597
            YESL+SFKVANR+LITGTPLQNNIKELAALVNFLMPG+FTIDQEIDFENQDE+QE YIRD
Sbjct: 506  YESLSSFKVANRMLITGTPLQNNIKELAALVNFLMPGKFTIDQEIDFENQDEKQENYIRD 565

Query: 598  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGH 657
            LHKRLQP+ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNY+ALT+G KG H
Sbjct: 566  LHKRLQPYILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYNALTAGTKGTH 625

Query: 658  VSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXX 717
             SLLN+MNELKKASNHPYLF NAE RVL+KFGDG++SRENILRGLIMSSG          
Sbjct: 626  FSLLNIMNELKKASNHPYLFGNAENRVLAKFGDGNRSRENILRGLIMSSGKMVLLDKLLT 685

Query: 718  XXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDF 777
                DGHRVLIFSQMVR+LDILGDYLSIKGINFQRLDGTVPS+QRRISIDHFNA DSNDF
Sbjct: 686  RLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDF 745

Query: 778  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 837
            VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV
Sbjct: 746  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 805

Query: 838  EEEVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQ 897
            EEEVLERARKKMILEYAIISLGVTDGNK +S  K EPSAGELSEILKFGAGNMFK +DNQ
Sbjct: 806  EEEVLERARKKMILEYAIISLGVTDGNKYTSKSKAEPSAGELSEILKFGAGNMFKAHDNQ 865

Query: 898  QKLEDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPXXXXXX 957
            +KLEDLNLD+VLNHAEDH+TTP+LGES+LGGEEFL+QFEVTDYKADV+WDDIIP      
Sbjct: 866  KKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVEWDDIIPEDELRK 925

Query: 958  XXXXXQRRIDEEYVREQLDIMNRKTAAIDKIKRSVNGETFGSDSEDEGNSKSRKRSKANN 1017
                 Q+R DEEYV+EQL +MNR+  A++KIK SVNG+   S S+ E +S+S+KR+K+NN
Sbjct: 926  LKDEEQKRKDEEYVQEQLQMMNRRNVALNKIKNSVNGDGAQSLSDKE-DSRSKKRAKSNN 984

Query: 1018 LDAFGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETLMRD 1077
            L++ GEREIRALYK IL++GD+  +  +LIADG+LPVKS+++Y ELY E+++ A   + D
Sbjct: 985  LNSIGEREIRALYKAILKYGDLTERLGDLIADGTLPVKSLEKYGELYDELMSIARKQIND 1044

Query: 1078 EEAKRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFEFHDT 1137
            EE+KR+E  S+LE+D  EY+ K+K+ EIKP+D+A K+ PI  L+AKRREKRA+LFEF++ 
Sbjct: 1045 EESKRNEAISRLERDVEEYKTKVKSGEIKPDDNA-KDLPIARLAAKRREKRAVLFEFYEI 1103

Query: 1138 KALNADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDEKLLI 1197
            K LNA+T+VNR D+L+FL NF++ NY  DP++F+F+N+ PKP++ WNC W +EDDEKLL+
Sbjct: 1104 KGLNAETIVNRTDDLRFLHNFLKNNYPSDPMKFRFLNRLPKPITNWNCTWTQEDDEKLLV 1163

Query: 1198 GIYKYGYGAWMQIRDDPFLGLTEKLFLNNEVTQKXXXXXXXXXXXXXXXXXXXXXXXXXX 1257
            G+ KYGYG+W Q+RDDPFLGL++K+FLN   TQ                           
Sbjct: 1164 GVDKYGYGSWSQVRDDPFLGLSDKIFLNEPGTQ-------------------------TN 1198

Query: 1258 DAVKTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEAKGPQTDP 1317
            D+   +       T +  A+         KK PG+VHLGRRVDYL TVLR+EAKG  +  
Sbjct: 1199 DSAAADADAADKKTRLANAA---------KKVPGSVHLGRRVDYLLTVLREEAKGTDSAA 1249

Query: 1318 SHPAXXXXXXXXXPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLTGKDSTPDN 1377
            +             Q      K++  ++G+S        + TP           D+ P++
Sbjct: 1250 AP------------QAALAAKKRARKSSGSSK-------SATP-----------DARPED 1279

Query: 1378 SSETKRGKA-HHHQQPSSRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKEYDSMDEEEC 1436
            S   KR +A     +PSS S  P +     +R GK    +PKA +   ++EY+SMDE+EC
Sbjct: 1280 SPSIKRTRALPAASRPSSGSPGPQL-----KRNGKK-QASPKAPM---EREYESMDEDEC 1330

Query: 1437 KKTMTNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKTSPEKYKRHL 1496
            ++TM +VR+SLKRL+ GG GL+R +WA +LK+EL  VG+YIE HK DS+     ++KRHL
Sbjct: 1331 RRTMHSVRASLKRLKRGGAGLDRNEWAAILKRELLAVGNYIERHKGDSADRDRAQFKRHL 1390

Query: 1497 WSFTA 1501
            WS++A
Sbjct: 1391 WSYSA 1395

>Kwal_56.23442
          Length = 1435

 Score = 1793 bits (4645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1510 (61%), Positives = 1119/1510 (74%), Gaps = 112/1510 (7%)

Query: 2    VQDLPDEVLANPELYGLRRSHRAAITHNT-YAGLDSDSDEEVIRPRRGKQKRKAVKQEHN 60
             +D+  ++L NPELYGLRRS RAA +  T Y   D + +++V+  RRG   RKA KQ+  
Sbjct: 3    TKDVAMDMLDNPELYGLRRSGRAAASVQTRYFSDDDEDEDQVVTSRRG---RKA-KQDDG 58

Query: 61   YDXXXXXXXXIDDFSDTDDFGSKRKPTRAPSAKRGRKRVSAGNSKSK----RQAKRVEES 116
            +          D+ SD  D           S       V  G SK +       K  + +
Sbjct: 59   FSSDRLSEE--DEVSDESD-----------SMADDDSEVVHGRSKPRPKKKVATKTKKRT 105

Query: 117  DEENVVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDGYSAS 176
              E + LPTRFSSRNN + +NY  N D +DEDL+ES  EQ         D D+++ Y  +
Sbjct: 106  PSEEIELPTRFSSRNN-RSVNY--NVDYSDEDLLESETEQ--------ADADMEE-YDYT 153

Query: 177  PSPQ-QETHSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSWE 235
            P+P  Q+   ID+V+ HRLK   + S        DV + + N+EFLIKW D+SHLHNSWE
Sbjct: 154  PTPSSQDGQGIDLVITHRLKPDTEESKDIP----DVATCKTNYEFLIKWVDESHLHNSWE 209

Query: 236  SYEDLKENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFKV 295
            +Y D+ +   +G+K+I+NY KQFIILD+++R+DPYTT EDIEVMDLE ERR+DEFEE+K+
Sbjct: 210  TYADIGQ--VRGIKKIDNYIKQFIILDKQIRSDPYTTAEDIEVMDLEKERRLDEFEEYKI 267

Query: 296  PERIIDSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTNS 355
            PERIIDS+R   EDGS  SQL+Y VKWRRLNYDE TWE A  IVK+APEQVK FQNR NS
Sbjct: 268  PERIIDSDRVTLEDGS--SQLQYQVKWRRLNYDEATWESAGTIVKLAPEQVKHFQNRINS 325

Query: 356  KIMPQNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEM 415
            KI+PQ SS+Y  ++RP+FEKL  QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEM
Sbjct: 326  KILPQYSSHY-GSERPRFEKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEM 384

Query: 416  GLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASR 475
            GLGKTVQTV+FISWLIYARRQNGPHLVVVPLSTMPAWQETF+KWAP LNC+Y++GNQ SR
Sbjct: 385  GLGKTVQTVAFISWLIYARRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSR 444

Query: 476  DLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAES 535
            D I++ EF+TNPQAK KKH KFNVLLTTYEYILKDR+ LG+IKWQFLAVDEAHRLKNAES
Sbjct: 445  DAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAES 504

Query: 536  SLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYI 595
            SLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQD +QE YI
Sbjct: 505  SLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDAEQETYI 564

Query: 596  RDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG 655
            RDLH RLQPFILRRLKKDVEKSLPSKTERILRVELSDVQT+YYKNILTKNYSAL++G KG
Sbjct: 565  RDLHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKG 624

Query: 656  GHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXX 715
             H SLLN+MNELKKASNHPYLFD AE+RVL+KFGDG  SRENILRGLIMSSG        
Sbjct: 625  AHFSLLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQL 684

Query: 716  XXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSN 775
                  DGHRVLIFSQMVR+LDILGDYL+IKGI +QRLDGTVPSAQRRISIDHFNA DSN
Sbjct: 685  LTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSN 744

Query: 776  DFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKD 835
            DFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKD
Sbjct: 745  DFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKD 804

Query: 836  TVEEEVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPND 895
            TVEEEVLERARKKMILEYAIISLGVTDG+ I+ +KK++PSAGELSEILKFGAGNMFK  D
Sbjct: 805  TVEEEVLERARKKMILEYAIISLGVTDGSNITQSKKSDPSAGELSEILKFGAGNMFKATD 864

Query: 896  NQQKLEDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPXXXX 955
            NQ+KLEDLNLD+VLNHAEDH+TTP+LGES+LGGEEFLRQFEVTDYKADV+WDDIIP    
Sbjct: 865  NQRKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLRQFEVTDYKADVEWDDIIPEEEL 924

Query: 956  XXXXXXXQRRIDEEYVREQLDIMNRKTAAIDKIKRSVNGETF--GSDSEDEGNSKSRKRS 1013
                   Q+R+DEEYV+EQL +MNR+  A+++IK SVNG     G D+EDE N+ S+++S
Sbjct: 925  KKLKDEEQKRMDEEYVQEQLQLMNRRNNALNRIKASVNGSGINNGDDNEDE-NTGSKRKS 983

Query: 1014 KANNLDAFGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAET 1073
            + +NLD+FGERE+RA+YKCILR+G++++KFEELIADGSLPVK+ID Y  +YHEMI EA++
Sbjct: 984  RMSNLDSFGEREVRAIYKCILRYGNLDDKFEELIADGSLPVKTIDGYSGIYHEMIAEAKS 1043

Query: 1074 LMRDEEAKRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFE 1133
             ++ EE KR   F+ LEK A  YR+K+K    +  D+  K  PI  L+AK++EK+A+LFE
Sbjct: 1044 CIKIEEEKRSAAFASLEKSAQAYREKLK-AHGQQLDEKDKSNPIAKLAAKKKEKKAVLFE 1102

Query: 1134 FHDTKALNADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDE 1193
            F+D K+LNA+T++ R D + FL+ F+ +NY DDPL+FKFVNK PKPV+ WNC W KEDDE
Sbjct: 1103 FYDVKSLNAETILTRPDEMGFLTTFLRKNYPDDPLKFKFVNKIPKPVTNWNCSWSKEDDE 1162

Query: 1194 KLLIGIYKYGYGAWMQIRDDPFLGLTEKLFLNNEVTQKXXXXXXXXXXXXXXXXXXXXXX 1253
            KLL+G+ KYGYGAW QIRDDPFLGL++K+FLN   T                        
Sbjct: 1163 KLLVGVNKYGYGAWAQIRDDPFLGLSDKIFLNEPQTNNGKAD------------------ 1204

Query: 1254 XXXXDAVKTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEAKGP 1313
                            N       ++N+     KK PG+VHLGRR DYLF VL+DE K P
Sbjct: 1205 ----------------NISAADQKTKNSGAGGSKKVPGSVHLGRRTDYLFAVLKDEIK-P 1247

Query: 1314 QTDPSHPAXXXXXXXXXPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLTGKDS 1373
             T     +            +K++ +K+ T+                          + +
Sbjct: 1248 HTSSGTNSGNSSPLPGASTGSKKRVRKAPTS--------------------------RSA 1281

Query: 1374 TPD-NSSETKRGKAHHHQQPS-SRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKEYDSM 1431
            TPD  + E + G A   ++    RS  P + +  ++ K      AP+ +   PDKEYDSM
Sbjct: 1282 TPDAKADEIRSGPAKRVKKMGMGRSSPPPLVATARKAKSVKGGTAPRGN-SAPDKEYDSM 1340

Query: 1432 DEEECKKTMTNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKTSPEK 1491
            +EEECK  M  +++SLKRL  GG GL+RK+WA +LK+EL+ VGD+IE+ K  S K  PEK
Sbjct: 1341 EEEECKAAMQPMKNSLKRLSRGGKGLDRKEWATILKEELRTVGDHIETKKVSSKKYPPEK 1400

Query: 1492 YKRHLWSFTA 1501
            +++HLW+F++
Sbjct: 1401 FRKHLWAFSS 1410

>Scas_576.6
          Length = 1457

 Score = 1767 bits (4576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 937/1511 (62%), Positives = 1110/1511 (73%), Gaps = 95/1511 (6%)

Query: 2    VQDLPDEVLANPELYGLRRSHRAAITHNTYAGLDSDSDEEVIRPRRGKQKRKA---VKQE 58
            V+DLP+E+L NPELYGLRRSHRA  THN +   + D D      RRG++K      V  +
Sbjct: 4    VKDLPNEILQNPELYGLRRSHRAP-THNYFEDEEDDEDAVKTSSRRGRKKSNVDPDVNLD 62

Query: 59   HNYDXXXXXXXXIDDFSDTDDFGSKRKPTRAPSAKRGRKRVSAGNSKSKRQAKRVEESDE 118
             + D         D+  D DD+GSK K     +    RK+     S+SK+     +E DE
Sbjct: 63   DDEDEEDLSELDDDEDDDDDDYGSKGKKKHTRTI---RKQKPKRTSRSKKGTDDDDEEDE 119

Query: 119  ENVVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDG-----Y 173
              V  P RFS RNN K +NY  N D +D+DL+ S E+ D   + + E+ D +D      Y
Sbjct: 120  FGV--PVRFSERNN-KTVNY--NVDYSDDDLLVSEEDYDMNSDDEDEENDEEDTGNRLEY 174

Query: 174  SASPSPQQETHSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNS 233
            SA+P   ++ HSID+V+ H+LK+GVD S     +  ++   + N +FLIKW DQSHLHN+
Sbjct: 175  SATPQ-LEDVHSIDMVITHKLKDGVDES--VWKKVMNLQECKDNIQFLIKWTDQSHLHNT 231

Query: 234  WESYEDLKENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEF 293
            WE+YE L +   KGLKR++NY KQFII DQ+VR DPY T ED+EVMD+E ERR+DEF+EF
Sbjct: 232  WETYESLGQ--IKGLKRLDNYCKQFIIQDQQVRLDPYITPEDLEVMDMEQERRLDEFQEF 289

Query: 294  KVPERIIDSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRT 353
             +PERI+DS+R   +DG+  S+L+YLVKW+RLNYDE TWE A++IVK APEQVK FQNR 
Sbjct: 290  TIPERIVDSQRVTLDDGT--SELQYLVKWKRLNYDEATWEAAADIVKDAPEQVKHFQNRI 347

Query: 354  NSKIMPQNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILAD 413
            NSKI+PQNS+NY  + RPKFEKL  QPS++K GELRDFQLTGINWMAFLWSKNDNGILAD
Sbjct: 348  NSKILPQNSTNYNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILAD 407

Query: 414  EMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQA 473
            EMGLGKTVQTV+FISWLIYARRQNGPH+VVVPLSTMPAWQETFDKWAP LN + YMGNQ 
Sbjct: 408  EMGLGKTVQTVAFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQR 467

Query: 474  SRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNA 533
            SRD I+++EFYTNP AKGKK++KFNVLLTTYEYILKDRS LGSIKWQFLAVDEAHRLKNA
Sbjct: 468  SRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNA 527

Query: 534  ESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEE 593
            ESSLYESLNSFKV NRLLITGTPLQNNIKELAAL+NFLMPGRFTIDQEIDFENQDE+QEE
Sbjct: 528  ESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQEIDFENQDEEQEE 587

Query: 594  YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI 653
            YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALT+G 
Sbjct: 588  YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGS 647

Query: 654  KGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXX 713
            KGGH SLLN+M+ELKKASNHPYLFDNAEERVL KFGDG  SREN+LRGLIMSSG      
Sbjct: 648  KGGHFSLLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSRENVLRGLIMSSGKMVLLD 707

Query: 714  XXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAED 773
                    DGHRVLIFSQMVR+LDILGDYLSIKGI FQRLDGTVPSAQRRISIDHFNA D
Sbjct: 708  QLLNKLKKDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPD 767

Query: 774  SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 833
            S D VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYR VS
Sbjct: 768  STDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 827

Query: 834  KDTVEEEVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKP 893
            KDTVEEEVLERARKKMILEYAIISLGVTDG+K   TKKNEP+ GELSEILKFGAGNMF  
Sbjct: 828  KDTVEEEVLERARKKMILEYAIISLGVTDGSKY--TKKNEPNPGELSEILKFGAGNMFAA 885

Query: 894  NDNQQKLEDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPXX 953
             DNQ+KLEDLNLD+VLNHAEDH+TTP+LGES+LGGEEFL+QFEVTDYKADVDWDDIIP  
Sbjct: 886  KDNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADVDWDDIIPEE 945

Query: 954  XXXXXXXXXQRRIDEEYVREQLDIMNRKTAAIDKIKRSVNGETFGSDSEDEGNSKSRKRS 1013
                     Q+R D+EY++EQLD+MNR+  A+ KIK SVNG+    DS+DE +S++ KR 
Sbjct: 946  ELKKLKDEEQKRKDDEYIKEQLDMMNRRDNALKKIKHSVNGDGTTVDSDDESSSRTSKRR 1005

Query: 1014 KANNLDAFGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAET 1073
              N+L + GE EIRA+YK +L++GD+ N FEELI+DG+LPVKSID+Y+E+Y EM+  A  
Sbjct: 1006 ARNDLTSIGESEIRAIYKAVLKYGDLTNLFEELISDGNLPVKSIDKYQEVYAEMMEVARE 1065

Query: 1074 LMRDEEAKRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFE 1133
             +  EEAKR EI  KLEK A EYR K+K+ EIKP DD  K+ P   L+ KR+EK+AILF 
Sbjct: 1066 NLHSEEAKRKEIMEKLEKKAHEYRLKLKSGEIKP-DDQPKDNPNAELAMKRKEKKAILFT 1124

Query: 1134 FHDTKALNADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDE 1193
            F+D K+LNA++ + R + L FL  ++  ++KDDPL+F   N++PK V  W+  W KEDDE
Sbjct: 1125 FYDVKSLNAESFIGRAEALDFLRKYIHEHFKDDPLKFHIANRSPKAVQNWSSNWNKEDDE 1184

Query: 1194 KLLIGIYKYGYGAWMQIRDDPFLGLTEKLFLNNEVTQKXXXXXXXXXXXXXXXXXXXXXX 1253
            KLL+G++KYGYG+W QIRDDPFLGLT K+FLN+  +                        
Sbjct: 1185 KLLVGVFKYGYGSWTQIRDDPFLGLTNKIFLNDSSSDP---------------------- 1222

Query: 1254 XXXXDAVKTETPDTTANTPI---VTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRDEA 1310
                  +K ET   T NT     VT SS        KK PGA+HLGRRVDYL +V+RDE+
Sbjct: 1223 -----VMKKETATNTTNTKKGKGVTGSS--------KKVPGAIHLGRRVDYLISVMRDES 1269

Query: 1311 KGPQTDPSHPAXXXXXXXXXPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDGNSVNLTG 1370
                                 Q+N   P  +AT             +  P+  +SVN T 
Sbjct: 1270 ---------------------QEN--TPSATATPTSGLKRKRQTKLSKPPTAKSSVNSTP 1306

Query: 1371 KDSTPDNSSETKRGKAHHHQQPSSRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKEYDS 1430
                   + +T + K     +  S S TPV       +K     + P     + +KEY+S
Sbjct: 1307 SSKRTKLTPKTLK-KVTKASKSVSNSPTPV------NKKRTTSNMTPPGSENVIEKEYES 1359

Query: 1431 MDEEECKKTMTNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSSKTSPE 1490
            MDE+EC+  M  VR SLK+LR+G  GL+RK++A++LK EL  +GD+IES K  S KT P 
Sbjct: 1360 MDEDECRHAMAPVRLSLKKLRNGNKGLDRKEFAHMLKSELTNIGDHIESQKGTSKKTDPV 1419

Query: 1491 KYKRHLWSFTA 1501
             +K+HLWS+++
Sbjct: 1420 NFKKHLWSYSS 1430

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
            ATP-dependent nucleosome remodeling activity, member of
            the Chromodomain-Helicase-DNA-binding (CHD) family [4407
            bp, 1468 aa]
          Length = 1468

 Score = 1735 bits (4494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 903/1516 (59%), Positives = 1086/1516 (71%), Gaps = 91/1516 (6%)

Query: 2    VQDLPDEVLANPELYGLRRSHRAAITHNTYAGLDSDSDEEVIRPRRGKQKRKAVKQEHNY 61
             +D+  EVL NPELYGLRRSHRAA     Y   DSD +++    ++ ++KR    ++   
Sbjct: 3    AKDISTEVLQNPELYGLRRSHRAAAHQQNYFN-DSDDEDDEDNIKQSRRKRMTTIEDDED 61

Query: 62   DXXXXXXXXIDDFSDTDDFGSKRKPTRAPSAKRGRKRVSAGNSKSKRQAKRVEESDEENV 121
            +             + ++   +         K+ R +  +      +   + +   +  V
Sbjct: 62   EFEDEEGEEDSGEDEDEEDFEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQSTV 121

Query: 122  VLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQDGYSASPSPQQ 181
             +PTRFS+R N K +NY +       D  +    + E      E +  ++ + AS +PQ 
Sbjct: 122  KIPTRFSNRQN-KTVNYNI-------DYSDDDLLESEDDYGSEEALSEENVHEASANPQP 173

Query: 182  ET-HSIDIVVDHRLKEGVDNSGSTKNRRWDVDSIRANFEFLIKWADQSHLHNSWESYEDL 240
            E  H IDIV++HRLK  ++     +    D+++ + N+EFLIKW D+SHLHN+WE+YE +
Sbjct: 174  EDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESI 233

Query: 241  KENGTKGLKRIENYYKQFIILDQEVRADPYTTREDIEVMDLEHERRIDEFEEFKVPERII 300
             +   +GLKR++NY KQFII DQ+VR DPY T EDIE+MD+E ERR+DEFEEF VPERII
Sbjct: 234  GQ--VRGLKRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERII 291

Query: 301  DSERFENEDGSGSSQLKYLVKWRRLNYDECTWEVASEIVKMAPEQVKEFQNRTNSKIMPQ 360
            DS+R   EDG+  SQL+YLVKWRRLNYDE TWE A++IVK+APEQVK FQNR NSKI+PQ
Sbjct: 292  DSQRASLEDGT--SQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQ 349

Query: 361  NSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKT 420
             SSNY  +QRP+FEKL  QP FIKGGELRDFQLTGINWMAFLWSK DNGILADEMGLGKT
Sbjct: 350  YSSNY-TSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKT 408

Query: 421  VQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQD 480
            VQTV+FISWLI+ARRQNGPH++VVPLSTMPAW +TF+KWAP LNC+ YMGNQ SRD I++
Sbjct: 409  VQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIRE 468

Query: 481  YEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYES 540
            YEFYTNP+AKGKK +KFNVLLTTYEYILKDR+ LGSIKWQF+AVDEAHRLKNAESSLYES
Sbjct: 469  YEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYES 528

Query: 541  LNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQEEYIRDLHK 600
            LNSFKVANR+LITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDE+QEEYI DLH+
Sbjct: 529  LNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHR 588

Query: 601  RLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVSL 660
            R+QPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALT+G KGGH SL
Sbjct: 589  RIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSL 648

Query: 661  LNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXX 720
            LN+MNELKKASNHPYLFDNAEERVL KFGDG  +REN+LRGLIMSSG             
Sbjct: 649  LNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLK 708

Query: 721  XDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFL 780
             DGHRVLIFSQMVR+LDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFN+ DSNDFVFL
Sbjct: 709  KDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFL 768

Query: 781  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEE 840
            LSTRAGGLGINLMTADTV+IFDSDWNPQADLQAMARAHRIGQKNHVMVYR VSKDTVEEE
Sbjct: 769  LSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEE 828

Query: 841  VLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKL 900
            VLERARKKMILEYAIISLGVTDGNK   TKKNEP+AGELS ILKFGAGNMF   DNQ+KL
Sbjct: 829  VLERARKKMILEYAIISLGVTDGNKY--TKKNEPNAGELSAILKFGAGNMFTATDNQKKL 886

Query: 901  EDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWDDIIPXXXXXXXXX 960
            EDLNLD+VLNHAEDH+TTP+LGES+LGGEEFL+QFEVTDYKAD+DWDDIIP         
Sbjct: 887  EDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQD 946

Query: 961  XXQRRIDEEYVREQLDIMNRKTAAIDKIKRSVNGE---TFGSDSEDEGNSKSRKRSKANN 1017
              Q+R DEEYV+EQL++MNR+  A+ KIK SVNG+         +D  +  SR+R++AN+
Sbjct: 947  EEQKRKDEEYVKEQLEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARAND 1006

Query: 1018 LDAFGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETLMRD 1077
            +D+ GE E+RALYK IL+FG+++   +ELIADG+LPVKS ++Y E Y EM+  A+  + +
Sbjct: 1007 MDSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHE 1066

Query: 1078 EEAKRHEIFSKLEKDAAEYRQKIKNLEIKPEDDAGKETPITLLSAKRREKRAILFEFHDT 1137
            EE  R EI  KLEK A  YR K+K+ EIK E+   K+ P+T LS K+REK+A+LF F   
Sbjct: 1067 EEKNRKEILEKLEKHATAYRAKLKSGEIKAENQP-KDNPLTRLSLKKREKKAVLFNFKGV 1125

Query: 1138 KALNADTLVNRRDNLKFLSNFVERNYKDDPLQFKFVNKNPKPVSAWNCVWGKEDDEKLLI 1197
            K+LNA++L++R ++LK+L N +  NYKDDPL+F   N  PKPV  W+  W KE+DEKLLI
Sbjct: 1126 KSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLI 1185

Query: 1198 GIYKYGYGAWMQIRDDPFLGLTEKLFLN---NEVTQKXXXXXXXXXXXXXXXXXXXXXXX 1254
            G++KYGYG+W QIRDDPFLG+T+K+FLN   N V +K                       
Sbjct: 1186 GVFKYGYGSWTQIRDDPFLGITDKIFLNEVHNPVAKKSASSSDT---------------- 1229

Query: 1255 XXXDAVKTETPDTTANTPIVTASSENTNKKTVKKAPGAVHLGRRVDYLFTVLRD--EAKG 1312
                     TP  +     +T SS        KK PGA+HLGRRVDYL + LR     K 
Sbjct: 1230 ---------TPTPSKKGKGITGSS--------KKVPGAIHLGRRVDYLLSFLRGGLNTKS 1272

Query: 1313 PQTDPSH---PAXXXXXXXXXPQQNKRKPKKSATTAGNSNGNENAHTAGTPSDG----NS 1365
            P  D      P          P  + +      T++  +NG  +      P       N+
Sbjct: 1273 PSADIGSKKLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMKALPKGPAALINN 1332

Query: 1366 VNLTGKDSTPDNSSETKRGKAHHHQQPSSRSGTPVVGSKKQQRKGKDIPLAPKADIRLPD 1425
              L+    TP   S+  R         + +S  P  GS  +                   
Sbjct: 1333 TRLSPNSPTPPLKSKVSRDNG------TRQSSNPSSGSAHE------------------- 1367

Query: 1426 KEYDSMDEEECKKTMTNVRSSLKRLRSGGDGLERKQWANLLKKELKRVGDYIESHKKDSS 1485
            KEYDSMDEE+C+ TM+ +R+SLKRLR GG  L+RK+WA +LK EL  +G++IES K  S 
Sbjct: 1368 KEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSR 1427

Query: 1486 KTSPEKYKRHLWSFTA 1501
            K SPEKY++HLWS++A
Sbjct: 1428 KASPEKYRKHLWSYSA 1443

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
            Saccharomyces cerevisiae YER164w CHD1 transcriptional
            regulator, start by similarity
          Length = 1476

 Score = 1731 bits (4483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 884/1419 (62%), Positives = 1061/1419 (74%), Gaps = 74/1419 (5%)

Query: 89   APSAKRGRKRVSAGNSKSKRQAKRVEESDEENVVLPTRFSSRNNNKVINYTLNDDSNDED 148
            +P  KR  +    GNS  K+ A       E+ V +PTRFSSR N K +NY + D S+D+ 
Sbjct: 102  SPQKKRSSRGSGRGNSYKKKTAATRNVKREKQVAIPTRFSSRAN-KQVNYNI-DYSDDDL 159

Query: 149  LMESSEEQDEGHNLDSEDMDLQDGYSASPSPQQETHSIDIVVDHRLKEGVDNSGSTKNRR 208
            L    E   +   L  ED + +   S +P PQ++ H ID+V+ HR+KEG D     K   
Sbjct: 160  LESEEEFDSDEDELLDEDQESR-ARSNTP-PQEDVHGIDMVITHRIKEGSDKEHLAKIVP 217

Query: 209  WDVDSIRANFEFLIKWADQSHLHNSWESYEDLKENGTKGLKRIENYYKQFIILDQEVRAD 268
             +++  + N+EF IKW DQSHLHN+WE+YE L   G KG+KR++NY KQ+II +Q+VR D
Sbjct: 218  -ELNVCKENYEFQIKWTDQSHLHNTWETYESLA--GVKGIKRLDNYCKQYIIQEQQVRLD 274

Query: 269  PYTTREDIEVMDLEHERRIDEFEEFKVPERIIDSERFENEDGSGSSQLKYLVKWRRLNYD 328
            PY T EDIE+MD+EHERR+DE +EF  PERIIDS+R E EDG+  SQL+YLVKWR LNYD
Sbjct: 275  PYITPEDIEIMDMEHERRLDELQEFTNPERIIDSQRVELEDGT--SQLQYLVKWRHLNYD 332

Query: 329  ECTWEVASEIVKMAPEQVKEFQNRTNSKIMPQNSSNYPANQRPKFEKLDAQPSFIKGGEL 388
            E TWE A+EIVK+APE VK FQ+R NSKI+PQ SSNY  ++RP+FEKL  QP FIKGGEL
Sbjct: 333  EATWEDAAEIVKIAPEPVKHFQSRQNSKILPQYSSNY-TSERPRFEKLSVQPPFIKGGEL 391

Query: 389  RDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLST 448
            RDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV+FISWLI+ARRQNGPHLVVVPLST
Sbjct: 392  RDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLVVVPLST 451

Query: 449  MPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYIL 508
            MPAW ETF+KWAP ++ + YMGNQ SRD+ ++YEFY+NP+ KGKK +KFNVL+TTYEYIL
Sbjct: 452  MPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTYEYIL 511

Query: 509  KDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALV 568
            KDR+ LGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALV
Sbjct: 512  KDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALV 571

Query: 569  NFLMPGRFTIDQEIDFENQDEQQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRV 628
            NFLMPGRFTIDQEIDFENQDE+QE+YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRV
Sbjct: 572  NFLMPGRFTIDQEIDFENQDEEQEQYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRV 631

Query: 629  ELSDVQTEYYKNILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKF 688
            ELSDVQTEYYKNILTKNYSALT+G KGG  S+LN+MN L KASNHPYLFD+AEE+VL KF
Sbjct: 632  ELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKVLEKF 691

Query: 689  GDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGI 748
            G G+ SRENILRGLIMSSG              DGHRVLIFSQMVRILDILGDYLSIKGI
Sbjct: 692  GAGNMSRENILRGLIMSSGKMVLLDKLLTRLKKDGHRVLIFSQMVRILDILGDYLSIKGI 751

Query: 749  NFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQ 808
            NFQRLDGTVPS QRRI+IDHFNA  S+DFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQ
Sbjct: 752  NFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQ 811

Query: 809  ADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKISS 868
            ADLQAMARAHRIGQKNHVMVYR VSKDTVEEEVLERARKKMILEYAIISLGVTDGNK   
Sbjct: 812  ADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKY-- 869

Query: 869  TKKNEPSAGELSEILKFGAGNMFKPNDNQQKLEDLNLDEVLNHAEDHITTPELGESNLGG 928
            TKK EPSAGELSEILKFGAGNMF   DNQ+KLEDLNLD+VL+HAEDH+TTP+LGES+LGG
Sbjct: 870  TKKTEPSAGELSEILKFGAGNMFAAKDNQKKLEDLNLDDVLSHAEDHVTTPDLGESHLGG 929

Query: 929  EEFLRQFEVTDYKADVDWDDIIPXXXXXXXXXXXQRRIDEEYVREQLDIMNRKTAAIDKI 988
            EEFL+QFEVTDYKADVDWDDIIP           QR  DEEYV+EQL++MNR+  A+ KI
Sbjct: 930  EEFLKQFEVTDYKADVDWDDIIPEEELKKLQDEEQRHKDEEYVKEQLEMMNRRNNALKKI 989

Query: 989  KRSVNGETFGSDSEDEGNSKSRKRSKANNLDAFGEREIRALYKCILRFGDIENKFEELIA 1048
            K SVNGE     S+DE    SR+R+K N+L++ G+ E+RALY+ +LRFGD+ +K +ELIA
Sbjct: 990  KDSVNGEGSTVTSDDEDGRSSRRRAKTNDLNSIGDSEVRALYRAVLRFGDVTDKLDELIA 1049

Query: 1049 DGSLPVKSIDRYKELYHEMITEAETLMRDEEAKRHEIFSKLEKDAAEYRQKIKNLEIKPE 1108
            DG+LPVKSI++YKE+  E++ EA+++  +E+ KR +   + E  A EY+ K+K  EIK E
Sbjct: 1050 DGTLPVKSIEKYKEILEELLDEAKSIYEEEDTKRTQTLREFEAAAHEYKMKLKTGEIKAE 1109

Query: 1109 DDAGKETPITLLSAKRREKRAILFEFHDTKALNADTLVNRRDNLKFLSNFVERNYKDDPL 1168
            +   K+ PIT L+ KRREK+AILF FH  K+LNA+++VNR  +L+F++N+ + ++K+DPL
Sbjct: 1110 EQE-KDNPITRLTMKRREKKAILFTFHKVKSLNAESIVNRCRDLEFVNNYFKTHFKNDPL 1168

Query: 1169 QFKFVNKNPKPVSAWNCVWGKEDDEKLLIGIYKYGYGAWMQIRDDPFLGLTEKLFLNNEV 1228
            +FKF   +PKPV+ WNC W + DDEKL++GI+KYGYGAW QIRDDPFLGLT K+FL++  
Sbjct: 1169 EFKFDKAHPKPVTNWNCDWNQMDDEKLMVGIHKYGYGAWAQIRDDPFLGLTNKIFLSD-- 1226

Query: 1229 TQKXXXXXXXXXXXXXXXXXXXXXXXXXXDAVKTETPDTTANTPIVTASSENTNKKTVKK 1288
                                         + VK ETPD T          + +  +  KK
Sbjct: 1227 -------------------VSSAATDKVKEEVKQETPDATG--------GKRSKGRESKK 1259

Query: 1289 APGAVHLGRRVDYLFTVLRDEAKGPQTDPSHPAXXXXXXXXXPQQNKRKPKKSATTAGNS 1348
             PGA+HLGRRVDYL   L+++ K     P+  A          ++    P+K      N+
Sbjct: 1260 VPGALHLGRRVDYLIDFLQNDGK-----PTTGASGSSSISESSRKTAANPRKRNRKPNNT 1314

Query: 1349 NGNENAHTAGTPSDGNSVNLTGKDSTPDNSSETKRGKAHHHQQPSS------RSGTPVVG 1402
            +       +GTP         GK  +P     TKR KA   + P+S      ++ +P   
Sbjct: 1315 SSFSETSASGTPE-------LGKLDSP--GQPTKRIKA-LPKGPASLVSRNKKTNSPQRD 1364

Query: 1403 SKKQQRKGKDIPLAPKADIRLPDKEYDSMDEEECKKTMTNVRSSLKRLRSGGDGLERKQW 1462
              K+   G     A         KEYDSMDEEEC+ TMT++RSSLKRLR GG GL+R++W
Sbjct: 1365 GNKENENGTSGAHA---------KEYDSMDEEECRHTMTSMRSSLKRLRRGGKGLDRREW 1415

Query: 1463 ANLLKKELKRVGDYIESHKKDSSKTSPEKYKRHLWSFTA 1501
            A +LK EL  +GDYIE+  K +   +P+++++HLWS+++
Sbjct: 1416 AKILKSELTAIGDYIEAQAKKNK--NPDRHRKHLWSYSS 1452

>Scas_665.17
          Length = 1060

 Score =  465 bits (1196), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 248/575 (43%), Positives = 366/575 (63%), Gaps = 34/575 (5%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           P+FIKGG+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT+SF+ +L Y ++ +GP
Sbjct: 129 PAFIKGGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKKIDGP 188

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
            L+VVP ST+  W+  F+KW P +N +   G++  R  I  Y+             KF+V
Sbjct: 189 FLIVVPKSTLDNWRREFNKWTPEVNAIVLHGDKEERHKIL-YDIVLEA--------KFDV 239

Query: 500 LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 559
           L+T+YE ++K+++ L    WQ++ +DEAHR+KN +S L + +  F   NRLLITGTPLQN
Sbjct: 240 LITSYEMVIKEKNVLKKFAWQYIVIDEAHRIKNEQSQLSQIIRLFYSKNRLLITGTPLQN 299

Query: 560 NIKELAALVNFLMPGRF----TIDQEIDFENQDEQQEEYIRDLHKRLQPFILRRLKKDVE 615
           N+ EL AL+NFL+P  F      D+  +  N ++ QE  ++ LH  L PF+LRR+K DVE
Sbjct: 300 NLHELWALLNFLLPDVFGDSGIFDEWFEQNNSEQDQEIVVQQLHTVLNPFLLRRIKADVE 359

Query: 616 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI--KGGHVSLLNVMNELKKASNH 673
           KSL  K E  + V ++++Q ++YK++L K+  A+   +  + G   LLN++ +L+K  NH
Sbjct: 360 KSLLPKIETNVYVGMTEMQVKWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNH 419

Query: 674 PYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 733
           PYLF+ AE       G  + + E+    L+ ++G               G RVLIFSQM 
Sbjct: 420 PYLFEGAEP------GPPYTTDEH----LVFNAGKMIVLDKLLKRLKEKGSRVLIFSQMS 469

Query: 734 RILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLM 793
           R+LDIL DY   +G  + R+DG+     R  +ID +N  +S+ FVFLL+TRAGGLGINL+
Sbjct: 470 RLLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLGINLV 529

Query: 794 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEY 853
           TADTVI++DSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+V+ERA +K+ L+ 
Sbjct: 530 TADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKLRLDQ 589

Query: 854 AIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKLEDLNLDEVLNHAE 913
            +I  G   G K +S   N+    +L E++++GA NMF+ N  QQ  +D ++DE+L   +
Sbjct: 590 LVIQQGT--GKKTASLGSNK---DDLLEMIQYGAKNMFE-NKEQQITKDADIDEILKKGQ 643

Query: 914 DHITTPEL-GESNLGGEEFLRQFEVTDYKADVDWD 947
             + T EL  +    G + L++F   D ++  +W+
Sbjct: 644 --LKTKELNAKYQALGLDDLQKFNDVDNQSAYEWN 676

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  454 bits (1168), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 241/575 (41%), Positives = 363/575 (63%), Gaps = 34/575 (5%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           PSF+K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT+SF+ +L Y ++  GP
Sbjct: 176 PSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGP 235

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASR-DLIQDYEFYTNPQAKGKKHLKFN 498
            L++VP ST+  W+  F KW P +N +   G++ +R D++++               +F+
Sbjct: 236 FLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIIL----------EARFD 285

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           VL+T+YE ++++++ L  + WQ++ +DEAHR+KN +S+L + +  F   NRLLITGTPLQ
Sbjct: 286 VLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQ 345

Query: 559 NNIKELAALVNFLMPGRF----TIDQEIDFENQDEQQEEYIRDLHKRLQPFILRRLKKDV 614
           NN+ EL AL+NFL+P  F      D+  +  N ++ QE  I+ LH  L PF+LRR+K DV
Sbjct: 346 NNLHELWALLNFLLPDIFGDSELFDEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRVKADV 405

Query: 615 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI--KGGHVSLLNVMNELKKASN 672
           EKSL  K E  + V ++D+Q ++YK++L K+  A+   +  + G   LLN++ +L+K  N
Sbjct: 406 EKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCN 465

Query: 673 HPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 732
           HPYLF+ AE       G  + + E+    LI +SG               G RVLIFSQM
Sbjct: 466 HPYLFEGAEP------GPPYTTDEH----LIFNSGKMIILDKLLKRLKEKGSRVLIFSQM 515

Query: 733 VRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINL 792
            R+LDIL DY   +   + R+DG+    +R  +ID +N  +S  FVFLL+TRAGGLGINL
Sbjct: 516 SRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINL 575

Query: 793 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 852
           +TADTVI+FDSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+V+ERA +K+ L+
Sbjct: 576 VTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLD 635

Query: 853 YAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKLEDLNLDEVLNHA 912
             +I  G   G K +S      S  +L ++++FGA NMF+   ++  + D ++D++L   
Sbjct: 636 QLVIQQGT--GKKTASLGN---SKDDLLDMIQFGAKNMFEKKASKVTV-DADIDDILKKG 689

Query: 913 EDHITTPELGESNLGGEEFLRQFEVTDYKADVDWD 947
           E           +LG ++ L++F   + ++  +W+
Sbjct: 690 EQKTQELNAKYQSLGLDD-LQKFNGIENQSAYEWN 723

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  451 bits (1159), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/541 (43%), Positives = 342/541 (63%), Gaps = 33/541 (6%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           PS+I+ G+LRD+Q+ G+NWM  L     +GILADEMGLGKT+QT+SF+ +L Y ++  GP
Sbjct: 125 PSYIQSGKLRDYQIQGLNWMISLHENKISGILADEMGLGKTLQTISFLGYLRYVKKIEGP 184

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASR-DLIQDYEFYTNPQAKGKKHLKFN 498
            LV+VP ST+  W+  F KW P ++     G +  R D++Q+               +F+
Sbjct: 185 FLVIVPKSTLDNWRREFFKWTPNVSTTVLQGTKEQRQDILQNIVL----------EARFD 234

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           VL+T+YE +++++  L  + W+++ +DEAHR+KN +S+L + +  F   NRLLITGTPLQ
Sbjct: 235 VLITSYEMVIREKGYLKRLAWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQ 294

Query: 559 NNIKELAALVNFLMPGRF----TIDQEIDFENQDEQQEEYIRDLHKRLQPFILRRLKKDV 614
           NN+ EL AL+NFL+P  F      D      N D+ QE  ++ LH  L PF+LRR+K DV
Sbjct: 295 NNLHELWALLNFLLPDVFGDSEVFDDWFQQNNSDQDQEVVVQQLHAVLNPFLLRRIKADV 354

Query: 615 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI--KGGHVSLLNVMNELKKASN 672
           EKSL  K E  + V ++D+Q ++YK++L K+  A+   +  + G   LLN++ +L+K  N
Sbjct: 355 EKSLLPKIETNVYVGMTDMQVQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCN 414

Query: 673 HPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 732
           HPYLF+ AE       G  + + E+    LI ++G               G RVLIFSQM
Sbjct: 415 HPYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKRLKEKGSRVLIFSQM 464

Query: 733 VRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINL 792
            R+LDIL DY   +  N+ R+DG+    +R  +ID +N  +S  FVFLL+TRAGGLGINL
Sbjct: 465 SRLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGLGINL 524

Query: 793 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 852
           +TADTV++FDSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+VLERA +K+ L+
Sbjct: 525 VTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQKLRLD 584

Query: 853 YAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKLEDLNLDEVLNHA 912
             +I  G   G K ++      S  +L E++++GA N+F+ N     + D ++DE+L   
Sbjct: 585 QLVIQQG--SGKKTANLGN---SKDDLIEMIQYGAKNVFEKNGTTISV-DADIDEILKKG 638

Query: 913 E 913
           E
Sbjct: 639 E 639

>Kwal_34.15925
          Length = 1025

 Score =  449 bits (1155), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 242/545 (44%), Positives = 345/545 (63%), Gaps = 33/545 (6%)

Query: 376 LDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARR 435
           L   PS+IK G LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT++F+ +L Y + 
Sbjct: 117 LTESPSYIKSGVLRDYQVQGLNWLLSLHDNRLSGILADEMGLGKTLQTIAFLGYLRYLKD 176

Query: 436 QNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRD-LIQDYEFYTNPQAKGKKH 494
            +GPH+V+VP ST+  W+  F KW P +  V   G++  R  L++D              
Sbjct: 177 IDGPHIVIVPKSTLNNWKREFSKWTPEVEAVVLSGDKEERQHLLKDIVL----------E 226

Query: 495 LKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITG 554
            KF+VL+T+YE ++K++STL    WQ++ VDEAHR+KN +S+L + +  F   +RLLITG
Sbjct: 227 CKFDVLITSYEMVIKEKSTLKRFMWQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRLLITG 286

Query: 555 TPLQNNIKELAALVNFLMPGRFTIDQEID--FENQDEQ--QEEYIRDLHKRLQPFILRRL 610
           TPLQNN+ EL AL+NFL+P  F      D  FE  D +  Q+  ++ LH  L PF+LRRL
Sbjct: 287 TPLQNNLHELWALLNFLLPDVFGDSDAFDRWFEQSDTEKDQDVVVQQLHTVLSPFLLRRL 346

Query: 611 KKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI--KGGHVSLLNVMNELK 668
           K +VE SL  K E  L V ++D+Q ++YK++L K+  A+   I  + G+  LLN++ +L+
Sbjct: 347 KSEVETSLLPKIETNLYVGMTDMQVQWYKSLLEKDLDAVNGAIGKREGNTRLLNIVMQLR 406

Query: 669 KASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLI 728
           K  NHPYLF+ AE       G  + + E+    LI ++G               G RVLI
Sbjct: 407 KCCNHPYLFEGAEP------GPPYTTDEH----LIFNAGKMIVLDKLLKKKKEAGSRVLI 456

Query: 729 FSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGL 788
           FSQM R+LDIL DY   +  ++ R+DG+    +R  +ID FN   S  F+FLL+TRAGGL
Sbjct: 457 FSQMSRLLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTRAGGL 516

Query: 789 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKK 848
           GINL+TADTV+I+DSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+V+ERA +K
Sbjct: 517 GINLVTADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQK 576

Query: 849 MILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKLEDLNLDEV 908
           + L+  +I  GV  G K S+      S GEL  ++++GA ++F     +  ++D ++DE+
Sbjct: 577 LRLDQLVIQQGV--GKKTSAIGN---SKGELLGMIQYGAKDVFGDGARKITVDD-DIDEI 630

Query: 909 LNHAE 913
           L   E
Sbjct: 631 LKKGE 635

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  447 bits (1151), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 237/544 (43%), Positives = 343/544 (63%), Gaps = 31/544 (5%)

Query: 376 LDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARR 435
           L   PSFIK G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+Q++SF+ +L Y + 
Sbjct: 124 LTQSPSFIKEGKLRDYQVYGLNWLISLHESKLSGILADEMGLGKTLQSISFLGYLRYIKG 183

Query: 436 QNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHL 495
             GP++V+VP ST+  WQ  F KW P +  V   G++  R  + + +  T          
Sbjct: 184 IEGPYIVIVPKSTLDNWQREFAKWTPEVKTVILQGDKDFRKELIETKILT---------C 234

Query: 496 KFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 555
            F+VL+T+YE +LK++ TL    W+++ +DEAHR+KN +S+L + +  F   NRLLITGT
Sbjct: 235 NFDVLITSYEMVLKEKLTLKRFAWEYILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGT 294

Query: 556 PLQNNIKELAALVNFLMPGRF----TIDQEIDFENQDEQQEEYIRDLHKRLQPFILRRLK 611
           PLQNN+ EL AL+NFL+P  F      D+      ++E QE  ++ LH  LQPF+LRR+K
Sbjct: 295 PLQNNLHELWALLNFLLPDVFGDSEVFDEWFQQNGKEEDQEVVVQQLHSVLQPFLLRRVK 354

Query: 612 KDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI--KGGHVSLLNVMNELKK 669
            +VEKSL  K E  L V ++D+Q E+YK++L K+  A+   +  + G   LLN++ +L+K
Sbjct: 355 SEVEKSLLPKKEINLYVGMTDMQIEWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRK 414

Query: 670 ASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIF 729
             NHPYLF+ AE       G  + + E+    L+ +SG               G RVLIF
Sbjct: 415 CCNHPYLFEGAEP------GPPYTTDEH----LVFNSGKMIVLDKLLKKKKEQGSRVLIF 464

Query: 730 SQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLG 789
           SQM R+LDIL DY   +G  + R+DG+    +R  +ID +N  +S  F+FLL+TRAGGLG
Sbjct: 465 SQMSRLLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLG 524

Query: 790 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKM 849
           INL+TADTV+++DSDWNPQADLQAM RAHRIGQK  V VYRFV+++ +EE+V+ERA +K+
Sbjct: 525 INLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKL 584

Query: 850 ILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKLEDLNLDEVL 909
            L+  +I  G   G K S+   N+    +L ++++FGA +M +       + D ++DE+L
Sbjct: 585 RLDQLVIQQGT--GKKTSALTNNK---DDLIDMIQFGARDMLQHGSGNITV-DEDIDEIL 638

Query: 910 NHAE 913
              E
Sbjct: 639 KKGE 642

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  442 bits (1136), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/540 (42%), Positives = 341/540 (63%), Gaps = 31/540 (5%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           PSF+K G+LRD+Q+ G+NW+  L     +GILADEMGLGKT+QT+SF+ +L + +  +GP
Sbjct: 120 PSFVKAGKLRDYQIYGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRFIKDIDGP 179

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
            +VVVP ST+  W+  F KW P +N +   G++ +R  + +    T           F+V
Sbjct: 180 FIVVVPKSTLDNWKREFAKWTPEVNTIVLHGDRETRTQLIEERILT---------CDFDV 230

Query: 500 LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 559
           L+T+YE ++K+++ L    WQ++ +DEAHR+KN +S+L + +  F   +RLLITGTPLQN
Sbjct: 231 LITSYEMVIKEKAILKKFAWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGTPLQN 290

Query: 560 NIKELAALVNFLMPGRF----TIDQEIDFENQDEQQEEYIRDLHKRLQPFILRRLKKDVE 615
           N+ EL AL+NFL+P  F      D+      + + QE  ++ LH  LQPF+LRR+K DVE
Sbjct: 291 NLHELWALLNFLLPDVFGESEVFDEWFQQNEKAQDQEIVVQQLHAVLQPFLLRRVKADVE 350

Query: 616 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI--KGGHVSLLNVMNELKKASNH 673
           KSL  K E  + V ++ +Q ++Y+++L K+  A+   +  + G   LLN++ +L+K  NH
Sbjct: 351 KSLLPKIETNVYVGMTAMQLQWYRSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNH 410

Query: 674 PYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 733
           PYLF+ AE       G  + + E+    LI +SG              +G RVLIFSQM 
Sbjct: 411 PYLFEGAEP------GPPYTTDEH----LIYNSGKMIVLDKLLKRKKKEGSRVLIFSQMS 460

Query: 734 RILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLM 793
           R+LDIL DY   +   + R+DG     +R  +ID FNA DS  F+FLL+TRAGGLGINL+
Sbjct: 461 RLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLGINLV 520

Query: 794 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEY 853
           TADTV+++DSDWNPQADLQAM RAHRIGQK  V VYR V+++ +EE+V+ERA +K+ L+ 
Sbjct: 521 TADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKLRLDQ 580

Query: 854 AIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKLEDLNLDEVLNHAE 913
            +I  G   G K S+   N  + GEL ++++FGA ++F     +  + D ++D +L   E
Sbjct: 581 LVIQQGA--GRK-SANLGN--TKGELIDMIQFGARDVFDKKLTEATVAD-DIDAILMKGE 634

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  433 bits (1114), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 247/597 (41%), Positives = 353/597 (59%), Gaps = 51/597 (8%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           P++I  G+LRD+Q+ G+NW+  L      GILADEMGLGKT+QT+SF+ +L Y ++  GP
Sbjct: 168 PAYI-NGQLRDYQVQGLNWLVSLDKNRIAGILADEMGLGKTLQTISFLGYLRYIKKIPGP 226

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRD-LIQDYEFYTNPQAKGKKHLKFN 498
            LV+ P ST+  W    +KW P +N     G++  R  LIQD     +          F+
Sbjct: 227 FLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERARLIQDKFMACD----------FD 276

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           V++ +YE I+++++    + W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQ
Sbjct: 277 VVIASYEIIIREKAAFRKMNWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPLQ 336

Query: 559 NNIKELAALVNFLMPGRFTIDQEID----FENQDEQQEEYIRDLHKRLQPFILRRLKKDV 614
           NN+ EL AL+NFL+P  F+  Q+ D     E  +E QE+ ++ LH  LQPF+LRR+K DV
Sbjct: 337 NNLHELWALLNFLLPDIFSDSQDFDEWFSKETDEEDQEKIVKQLHTVLQPFLLRRIKSDV 396

Query: 615 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALT--SGIKGGHVSLLNVMNELKKASN 672
           E SL  K E  + V +S +Q ++Y+ IL K+  A+   SG K     LLN++ +L+K  N
Sbjct: 397 ETSLLPKKELNVYVGMSPMQKKWYRQILEKDIDAVNADSGSKESKTRLLNIVMQLRKCCN 456

Query: 673 HPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 732
           HPYLFD AE       G  + + E+    L+ +S                G RVLIFSQM
Sbjct: 457 HPYLFDGAEP------GPPYTTDEH----LVYNSEKLKVLDKLLRKLKEAGSRVLIFSQM 506

Query: 733 VRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINL 792
            R+LDIL DY   +   + R+DG+     R  +ID +NA DS  F+FLL+TRAGGLGINL
Sbjct: 507 SRVLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGLGINL 566

Query: 793 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 852
            TAD V++FDSDWNPQADLQAM RAHRIGQK  V V+RFV+ ++VEE++LERA +K+ L+
Sbjct: 567 TTADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLRLD 626

Query: 853 YAIISLGVTDGNKISSTKKNEP--SAGELSEILKFGAGNMFK---------PNDNQQKLE 901
             +I       N+ ++ KK     S   L  +++ GA ++FK         P  +  K E
Sbjct: 627 QLVIQ-----QNRPTNKKKENKNDSKDALLSMIQHGAADVFKSNTTSERGTPQPDDDKGE 681

Query: 902 DLNLDEVLNHAEDHITTPELGESNLGGEEFLR-------QFEVTDYKADVDWDDIIP 951
           D++LDE+L  +E    +      +LG ++  +       ++  TD+K  V  D I P
Sbjct: 682 DVDLDELLAQSESKTQSLNAKYESLGLDDLQKFNQDSAYEWNGTDFKKKVQKDIISP 738

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  430 bits (1105), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 238/589 (40%), Positives = 347/589 (58%), Gaps = 49/589 (8%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           P F+  G LR +Q+ G+NW+  L   N  GILADEMGLGKT+QT++F+ +L Y  ++ GP
Sbjct: 137 PGFV-DGRLRPYQVQGVNWLVSLHKNNLAGILADEMGLGKTLQTITFLGYLRYIEKKRGP 195

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRD-LIQDYEFYTNPQAKGKKHLKFN 498
            LV+ P ST+  WQ   ++W P ++     G++  R  L Q+     N          F+
Sbjct: 196 FLVIAPKSTLNNWQREINRWTPDVDAFILQGDKEERARLCQERLLACN----------FD 245

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           V + +YE I++++++   I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQ
Sbjct: 246 VAIASYEIIIREKASFKKIDWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQ 305

Query: 559 NNIKELAALVNFLMPGRFT----IDQEIDFENQDEQQEEYIRDLHKRLQPFILRRLKKDV 614
           NN+ EL AL+NFL+P  F+     D+    E  D+ +++ ++ LH  LQPF+LRR+K DV
Sbjct: 306 NNLHELWALLNFLLPDIFSDSAAFDEWFSSEASDDDKDKIVKQLHTILQPFLLRRIKSDV 365

Query: 615 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TSGIKGGHVSLLNVMNELKKASN 672
           E SL  K E  L V +S +Q ++YK IL K+  A+  ++G K     LLN+M +L+K  N
Sbjct: 366 ETSLLPKKELNLYVGMSSMQRKWYKQILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCN 425

Query: 673 HPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 732
           HPYLFD AE       G  + + E+    L+ +S               DG RVLIFSQM
Sbjct: 426 HPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKLKEDGSRVLIFSQM 475

Query: 733 VRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINL 792
            R+LDIL DY   +G  + R+DG+     R  +ID +NA DS  F+FLL+TRAGGLGINL
Sbjct: 476 SRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTRAGGLGINL 535

Query: 793 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 852
            TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+
Sbjct: 536 TTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLD 595

Query: 853 YAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQ-------------- 898
             +I  G T    IS  +  + +   L  +++ GA +MF+  D                 
Sbjct: 596 QLVIQQGRTS---ISKKENAKDAKDALLSMIQHGAVDMFRSTDTSNASSAKGTPQPETGD 652

Query: 899 KLEDLNLDEVLNHAEDHITTPELGESNLGGEEFLRQFEVTDYKADVDWD 947
           K ++++L+ +LN +E+   +     + LG    L Q +  +  +  +WD
Sbjct: 653 KDDEVDLESLLNKSENKTKSLNEKYAALG----LDQLQKFNQDSAYEWD 697

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, start by similarity
          Length = 1344

 Score =  427 bits (1098), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 239/571 (41%), Positives = 335/571 (58%), Gaps = 49/571 (8%)

Query: 365  YPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 424
            Y  + R K E +D QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+Q++
Sbjct: 491  YEVSHRIK-ETVDKQPSILVGGTLKEYQLKGLEWMVSLYNNHLNGILADEMGLGKTIQSI 549

Query: 425  SFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFY 484
            S IS+L   + +  P LV+VPLST+  W   F+KWAP L  + Y GN   R  +Q     
Sbjct: 550  SLISYLYEIKNERQPFLVIVPLSTITNWTIEFEKWAPSLRTIVYKGNPNQRKALQHTIKM 609

Query: 485  TNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSL-YESLNS 543
             N          F+V+LTTYEYI+KDR  L    W  + +DE HR+KNA+S L Y   + 
Sbjct: 610  GN----------FDVVLTTYEYIIKDRPLLAKHDWAHMIIDEGHRMKNAQSKLSYTLTHY 659

Query: 544  FKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQD 588
            +K  NRL++TGTPLQNN+ EL AL+NF++P  F   +  D                E  +
Sbjct: 660  YKTKNRLILTGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFANTGTQEKLEMTE 719

Query: 589  EQQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSA 648
            E+    IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   
Sbjct: 720  EETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSSLQQQLYEQMLKHNAFF 779

Query: 649  LTSGIKG----GHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIM 704
            + +G +G    G   L N + +L+K  NHP++FD  E  +       + +REN    L  
Sbjct: 780  IGAGTEGATKAGIKGLNNKVMQLRKICNHPFVFDEVENVI-------NPTRENS-SILYR 831

Query: 705  SSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRI 764
             SG               GHRVL+F QM +++DI+ D+L ++ + + RLDG   +  R  
Sbjct: 832  VSGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTG 891

Query: 765  SIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKN 824
             +  FNA DS  F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN
Sbjct: 892  MLKLFNAPDSEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKN 951

Query: 825  HVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEIL- 883
             V + R ++ D+VEE +LERA +K+ ++  +I  G  D         N+ +A E  E L 
Sbjct: 952  EVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFD---------NKSTAEEQEEFLR 1002

Query: 884  KFGAGNMFKPNDNQQKLEDLNLDEVLNHAED 914
            +   G+  K ++   +L+D  L+E+L   ED
Sbjct: 1003 RLLEGDTNKDDEYSGELDDEELNEILARTED 1033

>Scas_652.17
          Length = 1025

 Score =  419 bits (1077), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/591 (39%), Positives = 346/591 (58%), Gaps = 47/591 (7%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           P +I G  LR +Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L Y    NGP
Sbjct: 106 PKYIHGT-LRPYQIQGLNWLVSLHKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGINGP 164

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
            LV+ P ST+  W    +KW P +      G++  R  +   +  T           F++
Sbjct: 165 FLVIAPKSTLNNWLREINKWTPDVKAFVLQGDKQERASLIKEKLMT---------CDFDI 215

Query: 500 LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 559
           ++ +YE I+++++      W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQN
Sbjct: 216 VVASYEIIIREKAAFKKFNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPLQN 275

Query: 560 NIKELAALVNFLMPGRFTIDQEID----FENQDEQQEEYIRDLHKRLQPFILRRLKKDVE 615
           N+ EL AL+NFL+P  F+  Q+ D     E  +E Q++ ++ LH  LQPF+LRR+K DVE
Sbjct: 276 NLHELWALLNFLLPDIFSSSQDFDDWFSSETTEEDQDKVVKQLHTVLQPFLLRRIKNDVE 335

Query: 616 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALT--SGIKGGHVSLLNVMNELKKASNH 673
            SL  K E  L V +S++Q ++YK IL K+  A+   +  K     LLN++ +L+K  NH
Sbjct: 336 TSLLPKKELNLYVGMSNMQKKWYKKILEKDLDAVNGENSSKESKTRLLNIVMQLRKCCNH 395

Query: 674 PYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 733
           PYLFD AE       G  + + E+    L+ +S               DG RVLIFSQM 
Sbjct: 396 PYLFDGAEP------GPPYTTDEH----LVYNSKKLQVLDKLLKKMKEDGSRVLIFSQMS 445

Query: 734 RILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLM 793
           R+LDIL DY   +G  + R+DG+     R  SID +NA DS+ F+FLL+TRAGGLGINL 
Sbjct: 446 RVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAGGLGINLT 505

Query: 794 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEY 853
           +AD V+++DSDWNPQADLQAM RAHRIGQK  V V+RFV+ ++VEE++LERA +K+ L+ 
Sbjct: 506 SADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERATQKLRLDQ 565

Query: 854 AIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDN-------------QQKL 900
            +I       NK     K +     LS +++ GA ++F+  ++              +++
Sbjct: 566 LVIQQNKASMNKNKKESKKDAKDALLS-MIQHGAADIFQSGNSTTTESTPQPGEAKSEEV 624

Query: 901 EDLNLDEVLNHAEDHITTPELGESNLGGEEFLR-------QFEVTDYKADV 944
           ED++L+ +L  +E+  ++       LG ++  +       +++  D+K DV
Sbjct: 625 EDVDLESILATSENKTSSLNAKYETLGLDDLQKFNQDSAYEWDGHDFKKDV 675

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  421 bits (1081), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 243/602 (40%), Positives = 357/602 (59%), Gaps = 55/602 (9%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           P+++  G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT++F+ +L Y  ++NGP
Sbjct: 134 PAYV-NGQLRPYQIQGLNWLVALHKNQLAGILADEMGLGKTLQTIAFLGYLRYIEKKNGP 192

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRD-LIQDYEFYTNPQAKGKKHLKFN 498
            LV+ P ST+  W    ++W P ++     G++  R  L  D     +          F+
Sbjct: 193 FLVIAPKSTLNNWLREINRWTPEVSAFILQGDKEERSKLCHDKLLACD----------FD 242

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           + + +YE I++++++   I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQ
Sbjct: 243 ICVASYEIIIREKASFKKIDWEYVVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQ 302

Query: 559 NNIKELAALVNFLMPGRF----TIDQEIDFENQDEQQEEYIRDLHKRLQPFILRRLKKDV 614
           NN+ EL AL+NFL+P  F    T D+    E+ +E +E+ ++ LH  L PF+LRR+K DV
Sbjct: 303 NNLHELWALLNFLLPDIFADSATFDEWFSSESSEEDKEKVVKQLHTVLSPFLLRRIKNDV 362

Query: 615 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TSGIKGGHVSLLNVMNELKKASN 672
           E SL  K E  + V +S +Q ++YK IL K+  A+  ++G K     LLN++ +L+K  N
Sbjct: 363 EGSLLPKKELNVYVGMSSMQKKWYKQILEKDIDAVNGSNGQKESKTRLLNIVMQLRKCCN 422

Query: 673 HPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 732
           HPYLFD AE       G  + + E+    L+ +S                G RVLIFSQM
Sbjct: 423 HPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKFKEQGSRVLIFSQM 472

Query: 733 VRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINL 792
            R+LDIL DY   +   + R+DG+     R  +ID +NA DS  F+FLL+TRAGGLGINL
Sbjct: 473 SRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAGGLGINL 532

Query: 793 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 852
            TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+RFV+ ++VEE++LERA +K+ L+
Sbjct: 533 TTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLKLD 592

Query: 853 YAIISLG-VTDGNKISSTKKNEPSAGELSEILKFGAGNMFK---------------PNDN 896
             +I  G VT+  K     KN+   G LS +++ GA ++FK               P+D 
Sbjct: 593 QLVIQQGRVTNKKK---ENKNDSKEGLLS-MIQHGAVDVFKSNDSSAMTSQTGTPHPDDG 648

Query: 897 QQKLEDLNLDEVLNHAEDHITTPELGESNLGGEEFLR-------QFEVTDYKADVDWDDI 949
           + K ED++LD +L  +ED   +     + LG +E  R       +++  ++K  V+ D I
Sbjct: 649 KDKDEDVDLDALLAQSEDKTRSLNAKYATLGLDELQRFNQDSAYEWDGQNFKKKVEKDII 708

Query: 950 IP 951
            P
Sbjct: 709 NP 710

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  420 bits (1080), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 322/523 (61%), Gaps = 37/523 (7%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           P+++  G+LR +Q+ G+NW+  L      GILADEMGLGKT+QT+SF+ +L Y  +  GP
Sbjct: 189 PAYV-NGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGP 247

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASR-DLIQDYEFYTNPQAKGKKHLKFN 498
            LV+ P ST+  W    ++W P +N     G++  R +LIQ          K      F+
Sbjct: 248 FLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQ----------KKLLGCDFD 297

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           V++ +YE I++++S L  I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQ
Sbjct: 298 VVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQ 357

Query: 559 NNIKELAALVNFLMPGRFTIDQEID----FENQDEQQEEYIRDLHKRLQPFILRRLKKDV 614
           NN+ EL AL+NFL+P  F+  Q+ D     E+ +E Q++ ++ LH  LQPF+LRR+K DV
Sbjct: 358 NNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDV 417

Query: 615 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TSGIKGGHVSLLNVMNELKKASN 672
           E SL  K E  L V +S +Q ++YK IL K+  A+  ++G K     LLN+M +L+K  N
Sbjct: 418 ETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCN 477

Query: 673 HPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 732
           HPYLFD AE       G  + + E+    L+ ++               +G RVLIFSQM
Sbjct: 478 HPYLFDGAEP------GPPYTTDEH----LVYNAAKLQVLDKLLKKLKEEGSRVLIFSQM 527

Query: 733 VRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINL 792
            R+LDIL DY   +   + R+DG+     R  +ID +NA DS  FVFLL+TRAGGLGINL
Sbjct: 528 SRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINL 587

Query: 793 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 852
            +AD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+
Sbjct: 588 TSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLD 647

Query: 853 YAIISLGVTDGNKISSTKKNEPSAGE---LSEILKFGAGNMFK 892
             +I    T      S KK E  A     L  +++ GA ++FK
Sbjct: 648 QLVIQQNRT------SLKKKENKADSKDALLSMIQHGAADVFK 684

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  422 bits (1086), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/509 (44%), Positives = 314/509 (61%), Gaps = 38/509 (7%)

Query: 374 EKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYA 433
           EK++ QPS + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q++S I++L   
Sbjct: 443 EKVEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEV 502

Query: 434 RRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKK 493
           ++ +GP LV+VPLST+  W   F+KWAP L  V Y G    R  +Q      +       
Sbjct: 503 KKDSGPFLVIVPLSTITNWTLEFEKWAPSLTTVIYKGTPNQRRSLQHQVRIGD------- 555

Query: 494 HLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSL-YESLNSFKVANRLLI 552
              F+VLLTTYEYI+KDRS L   +W  + +DE HR+KNA+S L Y   + +K  +RL++
Sbjct: 556 ---FDVLLTTYEYIIKDRSLLAKHEWSHMIIDEGHRMKNAQSKLSYTLTHYYKTRHRLIL 612

Query: 553 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEQQEE---------YIRD 597
           TGTPLQNN+ EL AL+NF++P  F   +  D      F N   Q++           IR 
Sbjct: 613 TGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFSNTGGQEKLELTEEEALLVIRR 672

Query: 598 LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI---- 653
           LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + +G     
Sbjct: 673 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFVGAGTEGAT 732

Query: 654 KGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXX 713
           KGG   L N + +L+K  NHP++FD  E       G  + +R N    L   SG      
Sbjct: 733 KGGIKGLNNKIMQLRKICNHPFVFDEVE-------GVVNPTRTNS-SLLYRVSGKFELLD 784

Query: 714 XXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAED 773
                    GHRVL+F QM +++DI+ D+L +K + + RLDG   + +R   ++ FNA D
Sbjct: 785 RVLPKFKATGHRVLMFFQMTQVMDIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPD 844

Query: 774 SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 833
           S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 845 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 904

Query: 834 KDTVEEEVLERARKKMILEYAIISLGVTD 862
            D+VEE +LERA +K+ ++  +I  G  D
Sbjct: 905 TDSVEEVILERAMQKLDIDGKVIQAGKFD 933

>Scas_662.7
          Length = 1342

 Score =  422 bits (1085), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/509 (43%), Positives = 315/509 (61%), Gaps = 38/509 (7%)

Query: 374 EKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYA 433
           EK+D QPS + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q++S I++L   
Sbjct: 447 EKIDKQPSMLVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLFEE 506

Query: 434 RRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKK 493
           ++  GP+LV+VPLST+  W   F+KWAP LN V Y G    R  +Q      N       
Sbjct: 507 KKDPGPYLVIVPLSTITNWTLEFEKWAPSLNTVIYKGTPNQRRNLQHQVRIGN------- 559

Query: 494 HLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSL-YESLNSFKVANRLLI 552
              F+VLLTTYEYI+KDR+ L   +W  + +DE HR+KNA+S L Y   + +K  +RL++
Sbjct: 560 ---FDVLLTTYEYIIKDRALLAKHEWTHMIIDEGHRMKNAQSKLSYTITHYYKTRHRLIL 616

Query: 553 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEQQEE---------YIRD 597
           TGTPLQNN+ EL AL+NF++P  F   +  +      F N    ++           IR 
Sbjct: 617 TGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTGEKLELTEEETLLVIRR 676

Query: 598 LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG-- 655
           LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   L  G +G  
Sbjct: 677 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYEQMLKHNALFLGEGTEGAT 736

Query: 656 --GHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXX 713
             G   L N + +L+K  NHP++FD  E  +     +  ++  N+L  +   SG      
Sbjct: 737 KSGIKGLNNKIMQLRKICNHPFVFDEVEGVI-----NPTRANSNLLYRV---SGKFELLN 788

Query: 714 XXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAED 773
                    GHRVL+F QM +++DI+ D+L +K + + RLDG+  +  R   ++ FNA D
Sbjct: 789 RVLPKFKAAGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPD 848

Query: 774 SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 833
           S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 849 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 908

Query: 834 KDTVEEEVLERARKKMILEYAIISLGVTD 862
            D+VEE +LERA +K+ ++  +I  G  D
Sbjct: 909 TDSVEEVILERAMQKLDIDGKVIQAGKFD 937

>Scas_597.8
          Length = 1065

 Score =  415 bits (1066), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 241/598 (40%), Positives = 347/598 (58%), Gaps = 49/598 (8%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           P FI  G LR++Q+ G+NW+  L      GILADEMGLGKT+QT+SF+ +L Y  +  GP
Sbjct: 125 PGFI-NGTLRNYQIQGLNWLVSLHKSKLAGILADEMGLGKTLQTISFLGYLRYVEKIPGP 183

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASR-DLIQDYEFYTNPQAKGKKHLKFN 498
            LV+ P ST+  W    +KW P +N     G++  R  L++D     +          F+
Sbjct: 184 FLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERAQLVKDKLLACD----------FD 233

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           +++ +YE I++++S    I WQ++ +DEAHR+KN ES L + L  F  +NRLLITGTPLQ
Sbjct: 234 IVVASYEIIIREKSAFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPLQ 293

Query: 559 NNIKELAALVNFLMPGRFTIDQEID----FENQDEQQEEYIRDLHKRLQPFILRRLKKDV 614
           NN+ EL AL+NFL+P  F+  Q+ D     E  +E QE+ ++ LH  LQPF+LRRLK DV
Sbjct: 294 NNLHELWALLNFLLPDIFSDSQDFDDWFSSETTEEDQEKVVKQLHTVLQPFLLRRLKNDV 353

Query: 615 EKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI--KGGHVSLLNVMNELKKASN 672
           E SL  K E  L V +S++Q ++YK IL K+  A+      K     LLN++ +L+K  N
Sbjct: 354 ETSLLPKQELNLYVGMSNMQKKWYKQILEKDIDAVNGSNVNKESKTRLLNIVMQLRKCCN 413

Query: 673 HPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 732
           HPYLFD AE       G  + + E+    L+ +S               +G RVLIFSQM
Sbjct: 414 HPYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLKKMKEEGSRVLIFSQM 463

Query: 733 VRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINL 792
            R+LDIL DY   +G  + R+DG+     R  +ID +N   S  F+FLL+TRAGGLGINL
Sbjct: 464 SRVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTRAGGLGINL 523

Query: 793 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 852
            +A+ V++FDSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+
Sbjct: 524 TSANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILERATQKLRLD 583

Query: 853 YAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQK------------L 900
             +I    +   K    KK+   A  L  +++ GA ++F+  D+  +             
Sbjct: 584 QLVIQQNRSTLKKKKENKKDNKEA--LLSMIQHGAADVFQSIDSSAENSNRNTPQPGDAT 641

Query: 901 EDLNLDEVLNHAEDHITTPELGESNLGGEEFLR-------QFEVTDYKADVDWDDIIP 951
           +D++LD +L  +ED   +      +LG ++  R       ++   D+K  V  D I P
Sbjct: 642 DDIDLDSILALSEDKTKSLNAKYESLGLDDLQRFNQDSAYEWNGQDFKKKVQKDIISP 699

>Kwal_23.4777
          Length = 1301

 Score =  419 bits (1078), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 238/562 (42%), Positives = 332/562 (59%), Gaps = 48/562 (8%)

Query: 374 EKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYA 433
           EK++ QPS + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+Q++S I++L   
Sbjct: 442 EKIEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLRET 501

Query: 434 RRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKK 493
           + + GP LV+VPLST+  W   F+KWAP L  + Y G    R  +Q      N       
Sbjct: 502 KNEPGPFLVIVPLSTITNWTLEFEKWAPSLATIVYKGTPNQRKSMQHQIRIGN------- 554

Query: 494 HLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSF-KVANRLLI 552
              F VLLTTYEYI+KDRS L    W  + +DE HR+KNA+S L  +L  + +  NRL++
Sbjct: 555 ---FEVLLTTYEYIIKDRSLLAKHDWSHMIIDEGHRMKNAQSKLSFTLTRYYRTRNRLIL 611

Query: 553 TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEQQEE---------YIRD 597
           TGTPLQNN+ EL AL+NF++P  F   +  D      F N   Q++           IR 
Sbjct: 612 TGTPLQNNLPELWALLNFVLPKIFNSAKTFDEWFNTPFANTGGQEKLELTEEETLLVIRR 671

Query: 598 LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN---YSALTSG-I 653
           LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   + A T G  
Sbjct: 672 LHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFFGAGTEGAT 731

Query: 654 KGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXX 713
           KGG   L N + +L+K  NHP++FD  E       G  + SR N    L   +G      
Sbjct: 732 KGGIKGLNNKIMQLRKICNHPFVFDEVE-------GIINPSRANS-PLLYRVAGKFELLD 783

Query: 714 XXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAED 773
                    GHRVL+F QM +++DI+ D+L ++G+ + RLDG   +  R   +  FNA +
Sbjct: 784 RILLKFKVTGHRVLMFFQMTQVMDIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPN 843

Query: 774 SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 833
           S  F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 844 SEYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 903

Query: 834 KDTVEEEVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNM-FK 892
            D+VEE +LERA +K+ ++  +I  G  D         N+ +A E    L+    N   K
Sbjct: 904 TDSVEEVILERALQKLDIDGKVIQAGKFD---------NKSTAEEQEAFLRRLLENENAK 954

Query: 893 PNDNQQKLEDLNLDEVLNHAED 914
             D++ +L D  L+++L   ED
Sbjct: 955 DEDDEAELNDEELNDILARGED 976

>Kwal_14.1600
          Length = 1102

 Score =  412 bits (1059), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 222/521 (42%), Positives = 313/521 (60%), Gaps = 28/521 (5%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           P FI G  LR +Q+ G+NW+  L   N  GILADEMGLGKT+QT+SF+ +L Y  ++ GP
Sbjct: 129 PPFINGC-LRPYQVQGVNWLVSLHRNNLAGILADEMGLGKTLQTISFLGYLRYVEKKPGP 187

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
            +V+ P ST+  W    ++W P +      G++  R  +          A       F++
Sbjct: 188 FVVIAPKSTLNNWLREINRWTPDVRAFILQGDKEERAKLV---------ANKLMACDFDI 238

Query: 500 LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 559
           ++ +YE I+K++++   I W+++ +DEAHR+KN ES L + L  F   NRLLITGTPLQN
Sbjct: 239 VVASYEIIIKEKASFKKIAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQN 298

Query: 560 NIKELAALVNFLMPGRFTIDQEID----FENQDEQQEEYIRDLHKRLQPFILRRLKKDVE 615
           N+ EL AL+NFL+P  F+  Q  D     E+ ++ + + ++ LH  LQPF+LRRLK +VE
Sbjct: 299 NLHELWALLNFLLPDVFSDSQAFDDWFSSESSEDDKGKIVKQLHTVLQPFLLRRLKNEVE 358

Query: 616 KSLPSKTERILRVELSDVQTEYYKNILTKNYSAL--TSGIKGGHVSLLNVMNELKKASNH 673
            SL  K E  L + +S +Q  +YK IL K+  A+   +G K     LLNVM +L+K  NH
Sbjct: 359 TSLLPKKELNLYIGMSSMQKRWYKQILEKDIDAVNGANGNKESKTRLLNVMMQLRKCCNH 418

Query: 674 PYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMV 733
           PYLFD AE       G  + + E+    L+ +S               +G RVLIFSQM 
Sbjct: 419 PYLFDGAEP------GPPYTTDEH----LVYNSAKLKVLDKLLRKFKEEGSRVLIFSQMS 468

Query: 734 RILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLM 793
           R+LDIL DY   +   + R+DG+     R  +ID +NA DS  FVFLL+TRAGGLGINL 
Sbjct: 469 RVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRAGGLGINLT 528

Query: 794 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEY 853
           TAD V+++DSDWNPQADLQAM RAHRIGQK  V V+R V+ ++VEE++LERA +K+ L+ 
Sbjct: 529 TADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERATQKLRLDQ 588

Query: 854 AIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPN 894
            +I       N+    K +   A  L  +++ GA ++F  N
Sbjct: 589 LVIQQSRNGVNQKEVKKGDSKDA--LLSMIQHGAADVFSTN 627

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  413 bits (1062), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 225/518 (43%), Positives = 316/518 (61%), Gaps = 39/518 (7%)

Query: 365 YPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 424
           Y    R K EK+D QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+Q++
Sbjct: 448 YEVAHRIK-EKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSI 506

Query: 425 SFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFY 484
           S I++L   ++  GP LV+VPLST+  W   F+KWAP LN + Y G    R  +Q     
Sbjct: 507 SLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRV 566

Query: 485 TNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSF 544
            N          F+VLLTTYEYI+KD+S L    W  + +DE HR+KNA+S L  +++ +
Sbjct: 567 GN----------FDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHY 616

Query: 545 -KVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEQQEE---- 593
            +  NRL++TGTPLQNN+ EL AL+NF++P  F   +  +      F N   Q++     
Sbjct: 617 YRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTE 676

Query: 594 -----YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSA 648
                 IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   
Sbjct: 677 EETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALF 736

Query: 649 LTSGI----KGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIM 704
           + +G     KGG   L N + +L+K  NHP++FD  E  V    G+           L  
Sbjct: 737 VGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDL--------LFR 788

Query: 705 SSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRI 764
            +G               GHRVL+F QM +++DI+ D+L +K + + RLDG+  + +R  
Sbjct: 789 VAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTE 848

Query: 765 SIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKN 824
            ++ FNA DS+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN
Sbjct: 849 MLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKN 908

Query: 825 HVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTD 862
            V + R ++ D+VEE +LERA +K+ ++  +I  G  D
Sbjct: 909 EVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFD 946

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  406 bits (1043), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 223/529 (42%), Positives = 320/529 (60%), Gaps = 40/529 (7%)

Query: 365 YPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTV 424
           Y    R K EK++ QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+Q++
Sbjct: 431 YEVAHRIK-EKIEKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSI 489

Query: 425 SFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFY 484
           S I++L   +++ GP+LV+VPLST+  W   F+KWAP L  + Y G    R  +Q     
Sbjct: 490 SLITYLYEVKQEPGPYLVIVPLSTITNWTLEFEKWAPSLTTIIYKGTPNQRHALQHKIRS 549

Query: 485 TNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSF 544
            N          F+VLLTTYEYI+KD++ L   +W  + +DE HR+KNA S L  ++  +
Sbjct: 550 GN----------FDVLLTTYEYIIKDKALLSKHEWSHMIIDEGHRMKNANSKLSFTITKY 599

Query: 545 -KVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEQQEE---- 593
            +  NRL++TGTPLQNN+ EL AL+NF++P  F   +  +      F N   Q++     
Sbjct: 600 YRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTE 659

Query: 594 -----YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSA 648
                 IR LHK L+PF+LRRLKK+VEK LP K E++++ +LS +Q + Y+ +L  N   
Sbjct: 660 EETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYQQMLKHNALF 719

Query: 649 LTSGI----KGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIM 704
           + +G     KGG   L N + +L+K  NHP++FD  E  V    G+           L  
Sbjct: 720 VGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEAVVNPSRGNSDL--------LYR 771

Query: 705 SSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRI 764
            +G               GHRVLIF QM +++DI+ D+L ++ + + RLDG+  +  R  
Sbjct: 772 VAGKFELLDRILPKFKATGHRVLIFFQMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRND 831

Query: 765 SIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKN 824
            +  FN E+S  F FLLSTRAGGLG+NL +ADTVIIFD+DWNP  DLQA  RAHRIGQKN
Sbjct: 832 MLKEFNVENSEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKN 891

Query: 825 HVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKISSTKKNE 873
            V + R ++ D+VEE +LERA +K+ ++  +I  G  D NK ++ ++ E
Sbjct: 892 EVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFD-NKSTAEEQEE 939

>Kwal_26.9164
          Length = 1454

 Score =  407 bits (1047), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/531 (42%), Positives = 319/531 (60%), Gaps = 46/531 (8%)

Query: 360  QNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGK 419
            QN   Y    R K E++  QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGK
Sbjct: 575  QNIDYYNVAHRIK-EEIKQQPSILVGGTLKEYQLKGLQWMVSLYNNHLNGILADEMGLGK 633

Query: 420  TVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQ 479
            T+QT+S +++L   +   GP LV+VPLST+  W   FDKWAP +  V Y G+   R    
Sbjct: 634  TIQTISLLTYLYEVKNVRGPSLVIVPLSTLTNWDSEFDKWAPVIRKVAYKGSPNER---- 689

Query: 480  DYEFYTNPQAKGKKHL----KFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAES 535
                      K K+ +    +F+V+LTT+EYI+K+R+ L  IKW  + +DE HR+KNA+S
Sbjct: 690  ----------KSKQGIIRSGQFDVVLTTFEYIIKERALLSKIKWVHMIIDEGHRMKNAQS 739

Query: 536  SLYESLNSFKVAN-RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQD 588
             L  +LN++   + RL++TGTPLQNN+ EL AL+NF++P  F   +  D      F N  
Sbjct: 740  KLSLTLNNYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTG 799

Query: 589  EQ------QEE---YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK 639
             Q      +EE    IR LHK L+PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+
Sbjct: 800  GQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVLKCKMSALQQKLYE 859

Query: 640  NILTKN---YSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRE 696
             +L         L S    G     N + +LKK  NHP++F+  E+++        ++  
Sbjct: 860  QMLKHRRLFIGDLNSNKNVGMRGFNNQIMQLKKICNHPFVFEEVEDQI----NPTRETNA 915

Query: 697  NILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGT 756
            NI R     +G               GHR+LIF QM +I+DI+ D+L +  + + RLDG 
Sbjct: 916  NIWR----VAGKFELLERILPKFKATGHRILIFFQMTQIMDIMEDFLRLSNMKYLRLDGH 971

Query: 757  VPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMAR 816
              S  R + ++ FNA +S  F FLLSTRAGGLG+NL +ADTVIIFD+DWNP  DLQA  R
Sbjct: 972  TKSDDRTLLLNLFNAPNSEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDR 1031

Query: 817  AHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKIS 867
            AHRIGQKN V + R +++++VEE +L+RA KK+ ++  +I  G  D    S
Sbjct: 1032 AHRIGQKNEVRILRLITENSVEEVILDRAHKKLDIDGKVIQAGKFDNKSTS 1082

>Scas_594.7
          Length = 1703

 Score =  404 bits (1039), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 215/518 (41%), Positives = 307/518 (59%), Gaps = 47/518 (9%)

Query: 374  EKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYA 433
            E++  QP+ + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT+S +++L   
Sbjct: 799  EEIRQQPAMLVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYET 858

Query: 434  RRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKK 493
            +  +GP+LV+VPLST+  W   F KWAP + C+ Y G+               P  +  K
Sbjct: 859  KHIHGPYLVIVPLSTLSNWSNEFAKWAPTMRCISYKGS---------------PNERKSK 903

Query: 494  HL-----KFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 548
            H      +F+V+LTT+EYI+K+R+ L  +KW  + +DE HR+KNA+S L  +LN++  ++
Sbjct: 904  HAIIKSGEFDVVLTTFEYIIKERALLSKVKWIHMIIDEGHRMKNAQSKLSLTLNTYYHSD 963

Query: 549  -RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEQQE 592
             RL++TGTPLQNN+ EL AL+NF +P  F   +  D                E  +E+  
Sbjct: 964  YRLILTGTPLQNNLPELWALLNFALPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETL 1023

Query: 593  EYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSG 652
              IR LHK L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L      +   
Sbjct: 1024 LVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQQIMYQQMLKYRRLFIGDH 1083

Query: 653  IKGGHVSLL---NVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXX 709
                 V L    N + +LKK  NHP++F+  E+++        ++  NI R     +G  
Sbjct: 1084 TNKKMVGLRGFNNQLMQLKKICNHPFVFEEVEDQI----NPTRETNANIWR----VAGKF 1135

Query: 710  XXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHF 769
                         GHRVLIF QM +I+DI+ D+L    I + RLDG   S  R   +  F
Sbjct: 1136 ELLEKVLPKLKATGHRVLIFFQMTQIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLF 1195

Query: 770  NAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVY 829
            NA DS    F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + 
Sbjct: 1196 NAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIL 1255

Query: 830  RFVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKIS 867
            R +++ +VEE +LERA KK+ ++  +I  G  D    S
Sbjct: 1256 RLITEHSVEEAILERAHKKLDIDGKVIQAGKFDNKSTS 1293

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  397 bits (1020), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/513 (41%), Positives = 305/513 (59%), Gaps = 46/513 (8%)

Query: 374  EKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYA 433
            E +  QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT+S +++L   
Sbjct: 547  EDVRVQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEF 606

Query: 434  RRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKK 493
            +  +GP LV+VPLST+  W   FDKWAP L  + + G  + R  +              K
Sbjct: 607  KGIHGPFLVIVPLSTLTNWNAEFDKWAPTLRKLAFKGPPSERKALSGI----------IK 656

Query: 494  HLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 552
               F+V+LTT+EYI+K+R  L  +KW  + +DE HR+KNA+S L  +LN +   + RL++
Sbjct: 657  SGNFDVVLTTFEYIIKERPLLSKVKWVHMIIDEGHRMKNAQSKLSLTLNQYYHTDYRLIL 716

Query: 553  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEQQEEYIRD 597
            TGTPLQNN+ EL AL+NF++P  F   +  D                E  +E+    IR 
Sbjct: 717  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRR 776

Query: 598  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKN--------YSAL 649
            LHK L+PF+LRRLKKDVEK LP K E++L+  +S +Q + Y+ +L            S  
Sbjct: 777  LHKVLRPFLLRRLKKDVEKELPDKVEKVLKCRMSALQQKLYEQMLKHRRLFVVDDPSSKK 836

Query: 650  TSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXX 709
              G++G +    N + +LKK  NHP++F+  E+++        ++  NI R     +G  
Sbjct: 837  MVGLRGFN----NQIMQLKKICNHPFVFEEVEDQI----NPNRETNANIWR----VAGKF 884

Query: 710  XXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHF 769
                         GHRVLIF QM +I+DI+ D+L    + + RLDG   S  R   ++ F
Sbjct: 885  ELLEKILPKFKASGHRVLIFFQMTQIMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKF 944

Query: 770  NAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVY 829
            NA  S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + 
Sbjct: 945  NAPGSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIL 1004

Query: 830  RFVSKDTVEEEVLERARKKMILEYAIISLGVTD 862
            R ++ ++VEE +LERA +K+ ++  +I  G  D
Sbjct: 1005 RLITDNSVEEVILERAHRKLDIDGKVIQAGKFD 1037

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  398 bits (1023), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 226/563 (40%), Positives = 333/563 (59%), Gaps = 40/563 (7%)

Query: 374  EKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYA 433
            E++  QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT+S +++L  A
Sbjct: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729

Query: 434  RRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKK 493
            +  +GP LV+VPLST+  W   FDKWAP L  + + G    R           P+    K
Sbjct: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779

Query: 494  HLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 552
            + +F+V+LTT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +LN++  ++ RL++
Sbjct: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839

Query: 553  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FENQDEQ------QEE---YIRD 597
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N   Q      +EE    IR 
Sbjct: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899

Query: 598  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGH 657
            LHK L+PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L      +        
Sbjct: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959

Query: 658  VS----LLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXX 713
             S      N + +L+K  NHP++F+  E+++        ++ + I R    S+G      
Sbjct: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011

Query: 714  XXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAED 773
                     GHRVLIF QM +++DI+ D+L    + + RLDG   S  R   ++ FNA +
Sbjct: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071

Query: 774  SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 833
            S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131

Query: 834  KDTVEEEVLERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKP 893
             ++VEE +L++A  K+ ++  +I  G  D    S+ ++ E     L E  +         
Sbjct: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFDNK--STAEEQEALLRSLLEAEEEEKKRRELG 1189

Query: 894  NDNQQKLEDLNLDEVLNHAEDHI 916
             + +++L+D  L+E+L   E+ I
Sbjct: 1190 IEEEEQLDDNELNEILARNENEI 1212

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  398 bits (1023), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 218/515 (42%), Positives = 309/515 (60%), Gaps = 41/515 (7%)

Query: 374  EKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYA 433
            E +  QPS + GG L+D+Q+ G+ WM  L++ + NGILADEMGLGKT+QT+S +++L   
Sbjct: 753  EDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEM 812

Query: 434  RRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKK 493
            +   GP+LV+VPLST+  W   F KWAP L  + + G+   R            QAK + 
Sbjct: 813  KNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKA---------KQAKIRA 863

Query: 494  HLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 552
              +F+V+LTT+EYI+K+R+ L  +KW  + +DE HR+KNA+S L  +LN+   A+ RL++
Sbjct: 864  G-EFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLIL 922

Query: 553  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEQQEEYIRD 597
            TGTPLQNN+ EL AL+NF++P  F   +  D                E  +E+    IR 
Sbjct: 923  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRR 982

Query: 598  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG-- 655
            LHK L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L   Y  L  G +   
Sbjct: 983  LHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQML--KYRRLFIGDQNNK 1040

Query: 656  ---GHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXX 712
               G     N + +LKK  NHP++F+  E+++        ++ ++I R     +G     
Sbjct: 1041 KMVGLRGFNNQIMQLKKICNHPFVFEEVEDQI----NPTRETNDDIWR----VAGKFELL 1092

Query: 713  XXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAE 772
                      GHRVLIF QM +I+DI+ D+L    I + RLDG   S +R   +  FNA 
Sbjct: 1093 DRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAP 1152

Query: 773  DSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFV 832
            DS    F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R +
Sbjct: 1153 DSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLI 1212

Query: 833  SKDTVEEEVLERARKKMILEYAIISLGVTDGNKIS 867
            + ++VEE +LERA KK+ ++  +I  G  D    S
Sbjct: 1213 TTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTS 1247

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  397 bits (1020), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/509 (41%), Positives = 304/509 (59%), Gaps = 37/509 (7%)

Query: 374  EKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYA 433
            E++  QPS + GG L+++Q+ G+ WM  L++ + NGILADEMGLGKT+QT+S +++L   
Sbjct: 788  EEVRQQPSILVGGTLKEYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEM 847

Query: 434  RRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKK 493
            +   GP L++VPLST+P W   F KWAP L  + Y G+   R + Q        Q K  +
Sbjct: 848  KNIKGPFLIIVPLSTLPNWSSEFAKWAPKLRTISYKGSPNERKMKQ-------AQIKSGE 900

Query: 494  HLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 552
               F+ ++TT+EYI+K+R+ L  +KW  + +DE HR+KNA+S L  +LN+F  ++ RL++
Sbjct: 901  ---FDAVITTFEYIIKERAILSKVKWVHMIIDEGHRMKNAQSKLSLTLNTFYHSDYRLIL 957

Query: 553  TGTPLQNNIKELAALVNFLMPGRFTIDQEID---------------FENQDEQQEEYIRD 597
            TGTPLQNN+ EL AL+NF++P  F   +  D                E  +E+    IR 
Sbjct: 958  TGTPLQNNLPELWALLNFVLPKIFNSAKSFDEWFNTPFANTGGQDKIELSEEETLLIIRR 1017

Query: 598  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGH 657
            LHK L+PF+LRRLKKDVEK LP K E++++ ++S +Q   Y+ +L      +    K   
Sbjct: 1018 LHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQHAMYQQMLKHKQLFIGDQKKNKL 1077

Query: 658  VSLL---NVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXX 714
            V L    N + +LKK  NHP++F+  E+ +         +  NI R     +G       
Sbjct: 1078 VGLRGFNNQLMQLKKICNHPFVFEEVEDHI----NPTRDTNMNIWR----VAGKFELLER 1129

Query: 715  XXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDS 774
                     HRVLIF QM +I+DI+ D+L    I + RLDG   S +R   +  FN  +S
Sbjct: 1130 ILPKLKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPNS 1189

Query: 775  NDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSK 834
              F F+LSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++ 
Sbjct: 1190 EYFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLITT 1249

Query: 835  DTVEEEVLERARKKMILEYAIISLGVTDG 863
            ++VEE +LERA KK+ ++  +I  G  D 
Sbjct: 1250 NSVEEVILERAYKKLDIDGKVIQAGKFDN 1278

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  333 bits (853), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 205/561 (36%), Positives = 292/561 (52%), Gaps = 84/561 (14%)

Query: 379 QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG 438
           QPS++K   L+ +Q+ G+NW+  L+    NGILADEMGLGKT+Q+++ +S+ IY     G
Sbjct: 210 QPSYLKNCVLKPYQMEGLNWLITLYENGLNGILADEMGLGKTIQSIALLSF-IYEMDTKG 268

Query: 439 PHLVVVPLSTMPAWQETFDKWAPGLNCVYYM---GNQASRDLIQDYEFYTNPQAKGKKHL 495
           P L+  PLST+  W   F K+AP +  + Y    G  A + L++  +F+ N   +G    
Sbjct: 269 PFLIAAPLSTVDNWMNEFAKFAPEIPILKYYSQNGQDARQKLLK--KFFKNNNREG---- 322

Query: 496 KFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGT 555
              V++T+YE I++D + +   +W+FL VDE HRLKN    L + L     +NRLL+TGT
Sbjct: 323 ---VIVTSYEMIIRDANIIMGEQWKFLIVDEGHRLKNINCRLIQELKRINTSNRLLLTGT 379

Query: 556 PLQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEQQEEYIR 596
           PLQNN+ EL +L+NF++P  F  D EI     DF++               DE ++  I 
Sbjct: 380 PLQNNLSELWSLLNFILPDIFA-DFEIFNKWFDFKDLDLQSNSAKLNKLINDELEKNLIS 438

Query: 597 DLHKRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYKNILT------------ 643
           +LH  L+PF+LRRLK  V K  LP K E I+   LS +QT++Y+  L+            
Sbjct: 439 NLHTILKPFLLRRLKSVVLKDVLPPKREYIVNCPLSPIQTKFYRMALSGKLKVTVFKELV 498

Query: 644 ---------------------------------KNYSALTSGIKGGHVSLLNVMNELKKA 670
                                               +A+   +   ++  LN   + ++ 
Sbjct: 499 KAFFTLNQEYIGTVSNKSIRDFIDYKLSEEPDEDKVTAVIKQMDDIYMEHLNTFTKNQRL 558

Query: 671 SNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFS 730
            N         +  L  F    +  +  L  L+ SSG               GH++LIFS
Sbjct: 559 QNMMMQLRQVVDSTLLFFFPYMEPEDITLDYLLASSGKLQMLQKLAIPLIKKGHKILIFS 618

Query: 731 QMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGI 790
           Q V +LD+L D+  +   N  R+DG V +  R+  ID FN +  +  +FLLSTRA GLGI
Sbjct: 619 QFVGMLDLLEDWSELNSFNSLRIDGGVDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGI 678

Query: 791 NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMI 850
           NL+ ADTVIIFDSDWNPQ DLQAM R HRIGQ   V+VYRF   +T+E  +L RA  K  
Sbjct: 679 NLVAADTVIIFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRK 738

Query: 851 LEYAIISLGVTDGNKISSTKK 871
           LE  +I +G     K S+ KK
Sbjct: 739 LERMVIQMG-----KFSNLKK 754

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  323 bits (828), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 201/557 (36%), Positives = 291/557 (52%), Gaps = 96/557 (17%)

Query: 379 QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG 438
           QPSF+K  +L+ +Q  G+NW+  L+    NGILADEMGLGKT+Q+++ +++ IY     G
Sbjct: 188 QPSFLKNCQLKPYQKEGLNWLITLYENGLNGILADEMGLGKTIQSIALLAF-IYEMDTKG 246

Query: 439 PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGN--QASRDLIQDYEFYTNPQAKGKKHLK 496
           P L+  PLST+  W   F ++AP +  + Y  +  QA+R  +   +F+ N + +G     
Sbjct: 247 PFLIAAPLSTVENWMNEFARFAPDIPVLKYYNSEGQAARHAMMG-KFFKNNKGEG----- 300

Query: 497 FNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 556
             V++T+YE I++D   + S +W+FL VDE HRLKN    L   L     +NRLL+TGTP
Sbjct: 301 --VIITSYEIIIRDIELILSYQWKFLIVDEGHRLKNINCKLIRELKRINTSNRLLLTGTP 358

Query: 557 LQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEQQEEYIRD 597
           LQNN+ EL +L+NF++P  F+ D EI     DF +               DE ++  I +
Sbjct: 359 LQNNLGELWSLLNFILPNIFS-DFEIFNKWFDFSDLNLESSSEKLTKIINDELEKNLISN 417

Query: 598 LHKRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNIL------------TK 644
           LH  L+PF+LRRLKK+V   SLP K E I+   ++ +Q +YYK  L             K
Sbjct: 418 LHTILKPFLLRRLKKNVLAGSLPPKREYIITCPVTPLQKKYYKQALKGNLKQTIQKQAIK 477

Query: 645 NYSALTSGIKGG-------------------------------------HVSLL-----N 662
           ++  L +   G                                      H  LL     N
Sbjct: 478 DFFTLNAEYIGTVSNKSIRDFIEWKLSADSQDIPNDNIGKMEKLYDMHIHKELLNKRLQN 537

Query: 663 VMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXD 722
           +M +L++  N  YLF          +    +  +  L  L+ +SG               
Sbjct: 538 MMIQLRQIVNSTYLF----------YFPLLEPTDLTLENLLKTSGKLQVLQKLVPELIKK 587

Query: 723 GHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLS 782
            H+VLIFSQ V +LD++ D+  +      R+DG++ +  R+  I+ F+ + S   +FLLS
Sbjct: 588 KHKVLIFSQFVSMLDLIEDWSELNNFISCRIDGSMQNNSRKEQIEEFSKKGSKANLFLLS 647

Query: 783 TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVL 842
           TRA GLGINL  AD+VIIFDSDWNPQ DLQAM RAHRIGQ   V+VYR    +T+E  ++
Sbjct: 648 TRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDRAHRIGQTKPVIVYRLYCDNTIENVIM 707

Query: 843 ERARKKMILEYAIISLG 859
            RA  K  LE  +I +G
Sbjct: 708 TRAVNKRKLEKLVIQMG 724

>Kwal_47.18077
          Length = 809

 Score =  320 bits (820), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 212/597 (35%), Positives = 305/597 (51%), Gaps = 91/597 (15%)

Query: 376 LDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARR 435
           L  QPS +K  +L+ +QL G+NW+  L+    NGILADEMGLGKT+Q+++ +++ I    
Sbjct: 168 LHQQPSLLKNCQLKPYQLEGVNWLITLYENGLNGILADEMGLGKTLQSIALLAF-ITEMD 226

Query: 436 QNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQAS---RDLIQDYEFYTNPQAKGK 492
             GP L+  PLST+  W   F ++AP +  + Y   Q     + L++  +F+ + + +G 
Sbjct: 227 TGGPFLIAAPLSTLDTWVNEFSRFAPDIQVLKYYSTQGQSYRQSLLK--KFFKSTKGQG- 283

Query: 493 KHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLI 552
                 V++T+YE I++D   + S +W+FL VDE HR+KN    L   L      NRLLI
Sbjct: 284 ------VVITSYEIIIRDIELILSYQWKFLIVDEGHRIKNINCKLIRELKRINTLNRLLI 337

Query: 553 TGTPLQNNIKELAALVNFLMPGRFTIDQEI-----DFEN--------------QDEQQEE 593
           TGT LQNN+ EL +L+NF+MP  F  D EI     DF +               DE ++ 
Sbjct: 338 TGTALQNNLSELWSLLNFIMPDIFA-DFEIFHKWFDFSDLELKSSSQGLNRLINDELEKN 396

Query: 594 YIRDLHKRLQPFILRRLKKDV-EKSLPSKTERILRVELSDVQTEYYKNIL---------- 642
            I +LH  L+PF+LRRLKK V   SLP K E I+   L+ VQ + YK+ L          
Sbjct: 397 LISNLHAILKPFLLRRLKKVVLAGSLPPKREYIVNCPLTSVQKKLYKSALNGKLKQAIFK 456

Query: 643 --TKNYSALTSGIKGGHVS----------------------LLNVMNELKKASNHPYLFD 678
              K++  L S  + G VS                      +L  M++L K   H  L +
Sbjct: 457 QAIKDFFVLNSD-QIGQVSNKSIRDFMEWKLNANDEDPDTEILQQMDKLYKQHIHRALLN 515

Query: 679 -----------NAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVL 727
                         +  L  F       +  L  L+ SSG               GH+VL
Sbjct: 516 KRLQNPMVQLRQVVDSTLLFFFPFINPEKLTLDFLLQSSGKLQILQQLVPPLIKKGHKVL 575

Query: 728 IFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGG 787
           IF+Q V +LD++ D+  +  +   R+DG++ +  R+  I+ FN  D +   FL+STRAGG
Sbjct: 576 IFTQFVGMLDLIEDWCELNDVRVCRIDGSMGNETRQEHIERFNDPDDSFDAFLISTRAGG 635

Query: 788 LGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARK 847
           LGINL  AD+VI+FDSDWNPQ DLQA  R HRIGQ   V+VYR    +T+E  +L RA  
Sbjct: 636 LGINLTAADSVILFDSDWNPQVDLQATDRTHRIGQTKPVIVYRLCCDNTIEHVILTRAAS 695

Query: 848 KMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKLEDLN 904
           K  LE  +I LG     K  + ++    AG  S  +  G  N   PN N++ + +L+
Sbjct: 696 KRKLEKMVIQLG-----KFGTLQR---LAGNDSSFISQGHSN---PNSNKELMHELS 741

>Scas_520.5
          Length = 863

 Score =  319 bits (817), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 194/551 (35%), Positives = 286/551 (51%), Gaps = 79/551 (14%)

Query: 379 QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG 438
           QPS +K   L+ +QL G+NW+  L+    NGILAD+MGLGKT+Q+++ +++ IY     G
Sbjct: 262 QPSMLKNCVLKPYQLEGLNWLITLYENGLNGILADDMGLGKTIQSIALLAF-IYEMDTKG 320

Query: 439 PHLVVVPLSTMPAWQETFDKWAPGLNCV--YYMGNQASRDLIQDYEFYTNPQAKGKKHLK 496
           P L+  PLST+  W   F+K+AP L  +  Y+ G +  R+ +    F+      G     
Sbjct: 321 PFLIAAPLSTVDNWMNEFEKFAPDLPVLKYYHPGGKNERNKLMR-NFFKKTNGTG----- 374

Query: 497 FNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 556
             +++T+YE I++D   + S +W+FL VDE HRLKN    L + L     +NRLL+TGTP
Sbjct: 375 --IVVTSYEIIIRDADYIMSKQWKFLIVDEGHRLKNVNCRLIQELKRINTSNRLLLTGTP 432

Query: 557 LQNNIKELAALVNFLMPGRFT----IDQEIDFEN--------------QDEQQEEYIRDL 598
           LQNN+ EL +L+NF+MP  FT     ++  DF++               +E Q+  I +L
Sbjct: 433 LQNNLAELWSLLNFIMPDIFTDFEIFNKWFDFKDLEMESNSSKLNKVINEELQKNLISNL 492

Query: 599 HKRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQT-----------------EYYKN 640
           H  L+PF+LRRLKK V  + LP K E ++   L+ +Q                  EY K 
Sbjct: 493 HTILKPFLLRRLKKTVLANILPPKREYVVNCPLTPIQKKFYKRGLEGKLKKTIFKEYVKA 552

Query: 641 ILTKNYSALTS----GIK--------------GGHVSLLNVMNEL--------------K 668
             T N   + S     I+               G + L + + ++              K
Sbjct: 553 FFTLNSDYIGSVSNKSIREFIDYKLHEGETDSDGQIQLNDTLQKMDTLFMEYIHKEIANK 612

Query: 669 KASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLI 728
           +  N         +  L  +    +  +  L+ L+ SSG               GH++LI
Sbjct: 613 RLQNMMMQLRQIVDSTLIFYFPYLRPEDLTLQELLESSGKLKTLQRLVIPLIAKGHKILI 672

Query: 729 FSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGL 788
           FSQ V +LD+L D+  +  +   R+DGT+ +  R+  +  FN + +   VFLLSTRA GL
Sbjct: 673 FSQFVNMLDLLEDWCDLNSLAAFRIDGTIDNESRKEQLSKFNDKKNKHMVFLLSTRAAGL 732

Query: 789 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKK 848
           G+NL+ ADTV++FDSDWNPQ DLQAM R HRIGQ   V+VYRF   +T+E  +L RA  K
Sbjct: 733 GVNLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTLEHVILTRAANK 792

Query: 849 MILEYAIISLG 859
             LE  +I +G
Sbjct: 793 RKLERLVIQMG 803

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  314 bits (805), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 207/603 (34%), Positives = 305/603 (50%), Gaps = 108/603 (17%)

Query: 343 PEQVKEFQNRTNSKIMPQNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFL 402
           P+ V EF  R+  +         PA+++   E    QP+ ++   L+ +Q+ G+NW+  L
Sbjct: 152 PKTVVEFFKRSKQQ---------PADEKQP-EPSIQQPTLVRNCTLKPYQVEGVNWLITL 201

Query: 403 WSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPG 462
           +    NGILADEMGLGKT+Q+++ +++ IY     GP LV  PLS +  W   F+K+AP 
Sbjct: 202 YENGLNGILADEMGLGKTIQSIALLAF-IYEMDTRGPFLVTAPLSVVDNWITEFEKFAPS 260

Query: 463 LNCV-YYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQF 521
           +  + YY  +   +      EF+     +G       V++T+YE +++D + + S +W+F
Sbjct: 261 IPVLKYYSADGPGKRHAILKEFFRKNSGEG-------VVVTSYEIVMRDMNVILSHQWKF 313

Query: 522 LAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQE 581
           L VDE HRLKN    L   L      NRLL+TGTPLQNN+ EL +L+NF++P  F  D E
Sbjct: 314 LIVDEGHRLKNINCKLIRELKRINTFNRLLLTGTPLQNNLAELWSLLNFILPDVFA-DFE 372

Query: 582 I-----DFENQD--------------EQQEEYIRDLHKRLQPFILRRLKKDV-EKSLPSK 621
           I     DF + D              E ++  + +LH  L+PF+LRRLK+ V   +LP K
Sbjct: 373 IFSKWFDFSDLDLKTSSQRWDKIIGEELEKNLVTNLHTILKPFLLRRLKRVVLADALPPK 432

Query: 622 TERILRVELSDVQTEYYKNILTKNY--SALTSGIKG---------GHVS----------- 659
            E I+   L+ +QT +YK  L      +  T  IK          G VS           
Sbjct: 433 REYIINCPLTPLQTRFYKMALAGKLKRTVFTQAIKEFFTLNREHIGSVSNKTIREFIDYK 492

Query: 660 -------------------------------LLNVMNELKKASNHPYLFDNAEERVLSKF 688
                                          L N+M +L++  +  +LF          +
Sbjct: 493 TSDEEIQASKVITDMEKLYEQHIHKELRNKRLQNLMMQLRQIVDSTFLF----------Y 542

Query: 689 GDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGI 748
               K+ +  L  L+ +SG                H+VLIFSQ V +LD++ D+  +   
Sbjct: 543 FPYLKAEDLQLPVLLQTSGKLQILQQLLPRLLAAKHKVLIFSQFVSMLDLIEDWCELNNY 602

Query: 749 NFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQ 808
           +  R+DG++ +  RR  I+ F+ + S   +FLLSTRAGGLGINL  AD+VI+FD+DWNPQ
Sbjct: 603 SACRIDGSMDNETRREQINSFSEKGSPHSLFLLSTRAGGLGINLTAADSVILFDNDWNPQ 662

Query: 809 ADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKISS 868
            DLQAM R+HRIGQ++ V+VYR     TVE  +L RA  K  LE  +I +G     K S+
Sbjct: 663 VDLQAMDRSHRIGQQHPVIVYRLYCDKTVESVILARATNKRKLEQLVIQMG-----KFST 717

Query: 869 TKK 871
            KK
Sbjct: 718 LKK 720

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  273 bits (699), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 192/549 (34%), Positives = 271/549 (49%), Gaps = 81/549 (14%)

Query: 369  QRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFIS 428
            Q+PK    D         EL+D+Q TGINW+  L+  + + ILADEMGLGKT Q +SF++
Sbjct: 491  QKPKLLSSDV--------ELKDYQQTGINWLHLLYQNDLSCILADEMGLGKTCQVISFLA 542

Query: 429  WLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQ 488
            +L      NGPHLVVVP ST+  W   F+K+ P L    Y G+Q  R  ++D       Q
Sbjct: 543  YL-KQTHHNGPHLVVVPSSTLENWLREFNKFCPHLKVEPYYGSQQERAELRDILEENEGQ 601

Query: 489  AKGKKHLKFNVLLTTYEYILK---DRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 545
                    ++V++TTY        D S L +  +  +  DE H LKN+ S  +  L    
Sbjct: 602  --------YDVIVTTYNLAAGTKYDVSFLRNRNFDVVVYDEGHMLKNSMSERFNKLMKIN 653

Query: 546  VANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEQQ-------------- 591
               RLL+TGTPLQNN+KEL +L+ F+MP  F + ++ D     +Q+              
Sbjct: 654  AHFRLLLTGTPLQNNLKELMSLLEFIMPNLF-VSKKDDLATVFKQKTRTSDADKGYNPLL 712

Query: 592  -EEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNIL---TKNYS 647
             E  I      ++PFILRR K  V K LP K   IL  E++++Q   Y+  +    ++  
Sbjct: 713  AEHAIERAKTMMKPFILRRKKDQVLKHLPRKHNHILHCEMTELQKTLYQQEIKQVMEHRR 772

Query: 648  ALTSGIKGGHVSL---LNVMNELKKASNHPYLFDNA-EERVLSKF-------------GD 690
             +  G+K    S     N++  L+KAS HP LF +   ++++SK              G+
Sbjct: 773  KIKEGVKMEKASRNVSKNLIMALRKASIHPLLFRHIYNDKIISKMSKAIIAEPEYYENGN 832

Query: 691  GHKSRENI-------LRGLI----------------MSSGXXXXXXXXXXXXXXDGH-RV 726
                +E++       L  L                 M+SG                H +V
Sbjct: 833  IEYIKEDMSYMTDFELHKLCCKFPSLYKFKLQSDEWMNSGKVEQLKSVLHKIIDIQHEKV 892

Query: 727  LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAG 786
            L+FS   ++LDIL   LS   I F RLDG      R+  ID F  ED    VFLLST+AG
Sbjct: 893  LVFSLFTQVLDILEFVLSTLNIKFLRLDGQTQVNDRQSLIDRF-YEDDTIPVFLLSTKAG 951

Query: 787  GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERAR 846
            G GINL+ A+ VIIFD  +NP  D QA  RAHR+GQ   V V   +S+DT+EE++L  A+
Sbjct: 952  GFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTKEVQVTTLISRDTIEEKILHLAK 1011

Query: 847  KKMILEYAI 855
             K+ L+  I
Sbjct: 1012 NKLALDTHI 1020

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  268 bits (685), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 183/564 (32%), Positives = 287/564 (50%), Gaps = 88/564 (15%)

Query: 360 QNSSNYPANQRPKFEKLDAQ--PSFIKGGE----LRDFQLTGINWMAFLWSKNDNGILAD 413
           Q SS+ P  +RP     DA+    F   GE    L ++Q T + W+  L+ +N  GI+ D
Sbjct: 263 QRSSDLPEWRRPHPNIPDAKLNSQFKIPGEIYSLLFNYQKTCVQWLYELYQQNCGGIIGD 322

Query: 414 EMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCV--YYMGN 471
           EMGLGKT+Q ++FI+ L ++    GP L+V P + M  W   F  W P L  V  + MG+
Sbjct: 323 EMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPATVMKQWCNEFQHWWPPLRTVILHSMGS 382

Query: 472 QASRD------------LIQD-------YEFYTNPQAKGKKHLKF--------------- 497
             + D            LI +       YE + N   + KK L+                
Sbjct: 383 GMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNS-TRTKKALESSYHLDKLIDKVVTDG 441

Query: 498 NVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPL 557
           ++L+TTY  +      L  +KWQ+  +DE H+++N +S +  +    K  NR++++GTP+
Sbjct: 442 HILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPI 501

Query: 558 QNNIKELAALVNFLMPGR----------FTIDQEID-FENQDEQQEEY-------IRDLH 599
           QNN+ EL +L +F+ PG+          F I   I  + N    Q +        +RDL 
Sbjct: 502 QNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDL- 560

Query: 600 KRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVS 659
             + P++LRR+K DV K LP K E +L  +L+  Q   Y   L   +S+  + I+ G  +
Sbjct: 561 --ISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFL---HSSDLNQIQNGKRN 615

Query: 660 LLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKS-RENILRGLIMSSGXXXXXXXXXXX 718
           +L  ++ L+K  NHP L D   +R    +GD  +S +  +++ L++              
Sbjct: 616 VLFGIDILRKICNHPDLLDRDTKRHNPDYGDPKRSGKMQVVKQLLL-------------L 662

Query: 719 XXXDGHRVLIFSQMVRILDILGDYLSIKG-----INFQRLDGTVPSAQRRISIDHFNAED 773
               G++ L+F+Q  ++LDIL +++S K      +N+ R+DGT     R+  +D FN E 
Sbjct: 663 WHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNIKGRQSLVDRFNNES 722

Query: 774 SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 833
            +  VFLL+TR GGLG+NL  A+ +IIFD DWNP  D+QA  RA RIGQK  V +YR + 
Sbjct: 723 FD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQKREVSIYRLMV 780

Query: 834 KDTVEEEVLERARKKMILEYAIIS 857
             ++EE++  R   K  L   I++
Sbjct: 781 GGSIEEKIYHRQIFKQFLTNRILT 804

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
           (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  267 bits (682), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 186/539 (34%), Positives = 271/539 (50%), Gaps = 84/539 (15%)

Query: 387 ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQN--GPHLVVV 444
           EL+D+Q TG+NW+  L+  N + ILADEMGLGKT Q +SF+++L   + QN  GPHLVVV
Sbjct: 470 ELKDYQQTGLNWINLLYQHNLSCILADEMGLGKTCQVISFLAYL---KEQNHTGPHLVVV 526

Query: 445 PLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTY 504
           P ST+  W   F K+ P L    Y G+Q  R  ++D     + Q        ++ ++TTY
Sbjct: 527 PSSTLENWLREFKKFCPQLKIEPYYGSQQERAELRDILEENDGQ--------YDAIVTTY 578

Query: 505 EYILKDRSTLGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 561
                +++ +  +K   +  +  DE H LKN+ S  +  L       RLL+TGTPLQNN+
Sbjct: 579 NLASGNKADVSFLKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPLQNNL 638

Query: 562 KELAALVNFLMPGRF----------------TIDQEIDFENQDEQQEEYIRDLHKRLQPF 605
           +EL +L+ F+MP  F                T D   D+     Q  E I      ++PF
Sbjct: 639 RELMSLLEFIMPSLFVSKKDELAAVFKQRARTSDSNKDYNPLLAQ--EAIDRAKTIMKPF 696

Query: 606 ILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK---NILTKNYSALTSGI---KGGHVS 659
           ILRR K  V K LP+K   I   +++  Q   Y     ++ ++   +  G+     G  +
Sbjct: 697 ILRRRKDQVLKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDAGERA 756

Query: 660 LL------NVMNELKKASNHPYLFDN---------AEERVLSK-----FGDGHKSRENI- 698
           L+      N++  L+KA+ HP LF +           ER+L++      G+    RE++ 
Sbjct: 757 LVAQSTSKNLIMALRKAAIHPLLFRHHYSDDRIAEMSERILAEPEYADSGNRDYIREDMS 816

Query: 699 ------LRGLI----------------MSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRIL 736
                 L  L                 M+SG                 + L+FS   ++L
Sbjct: 817 YMCDLELHRLCCRFPSLASFQLSEPTWMASGKVHRLQPLLRAAIARREKTLVFSLFTQVL 876

Query: 737 DILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTAD 796
           DIL   LS  GI F RLDG+ P   R+  ID F+  D++  VFLLST+AGG GINL+ A+
Sbjct: 877 DILELVLSSLGIAFLRLDGSTPVNDRQALIDRFHT-DTDVPVFLLSTKAGGFGINLVCAN 935

Query: 797 TVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 855
            VIIFD  +NP  D QA  RAHR+GQ   V V   VS+ TVEE++L+ AR K+ L+ ++
Sbjct: 936 HVIIFDQSFNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQLARHKLALDSSV 994

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  263 bits (671), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 174/554 (31%), Positives = 271/554 (48%), Gaps = 82/554 (14%)

Query: 366 PANQRPKFEKLDAQPS--FIKGGE----LRDFQLTGINWMAFLWSKNDNGILADEMGLGK 419
           P  Q+P  E  DA+ +  F   GE    L ++Q TG+ W+  L+ +   GI+ DEMGLGK
Sbjct: 269 PEWQKPHPEIPDAKLNNEFKIPGEIFSLLFNYQKTGVQWLYELFQQRRGGIIGDEMGLGK 328

Query: 420 TVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQA------ 473
           T+Q  +F++ L ++   +GP L+V P + M  W     +W P    V      A      
Sbjct: 329 TIQVTAFLAALHHSNLLSGPVLIVCPATVMKQWCNEIHQWWPPFRAVILHSIGAGMNDKS 388

Query: 474 --SRDLIQ--------------DYEFYTNPQAKGKKHLKF-----------NVLLTTYEY 506
             + D I+              DYE  +  ++K +  +             ++++TTY  
Sbjct: 389 NLTEDEIENMIIKSELENTDFHDYENASKLKSKVETGMHMQNLISKVVADGHIIITTYVG 448

Query: 507 ILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAA 566
           +      L ++ W +  +DE H+++N +S +  +    K  NR++++GTP+QNN+ EL +
Sbjct: 449 LRIHSDKLLNVNWSYCVLDEGHKIRNPDSEISLTCKKLKCKNRIILSGTPIQNNLVELWS 508

Query: 567 LVNFLMPGRF----TIDQEI-------DFENQDEQQEEY-------IRDLHKRLQPFILR 608
           L +F+ PGR        Q+         + N    Q +        +RDL   + P++LR
Sbjct: 509 LFDFIYPGRLGTLPVFQQQFVQPINMGGYANATNTQVQTGYRCAVALRDL---ISPYLLR 565

Query: 609 RLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVSLLNVMNELK 668
           R+K DV K LP K E +L  +L++ Q   Y   L+   S   S IKGG   +L  ++ L+
Sbjct: 566 RVKADVAKDLPKKKEMVLFCKLTEFQRRKYLEFLS---SDELSQIKGGKRHVLYGIDILR 622

Query: 669 KASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLI 728
           K  NHP L D    +  S +GD  +S            G              +GH+ L+
Sbjct: 623 KICNHPDLLDRDYIKNTSGYGDPKRS------------GKMQVVKQLLKLWKSEGHKTLL 670

Query: 729 FSQMVRILDILGDYLSIK-----GINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLST 783
           F+Q  ++LDIL +++  K      I + R+DGT     R+  +D FN E  +  VFLL+T
Sbjct: 671 FTQSRQMLDILEEFIKFKEPELSDIRYLRMDGTTSIQVRQTLVDRFNNESYD--VFLLTT 728

Query: 784 RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 843
           R GGLG+NL  A+ +II+D DWNP  DLQA  RA RIGQK  V +YR +   T+EE++  
Sbjct: 729 RVGGLGVNLTGANRIIIYDPDWNPSTDLQARERAWRIGQKREVSIYRLMISGTIEEKIYH 788

Query: 844 RARKKMILEYAIIS 857
           R   K  L   ++S
Sbjct: 789 RQIFKQFLMNKVLS 802

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  260 bits (665), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 187/574 (32%), Positives = 278/574 (48%), Gaps = 84/574 (14%)

Query: 352  RTNSKIMPQNSSNYPANQRPKFEKLDAQPSFIKGG-ELRDFQLTGINWMAFLWSKNDNGI 410
            R N+ ++   S N    ++P  +    +P  +     L+D+Q TGINW+  L+    + I
Sbjct: 538  RKNTHVISTTSRN---GRKPIVKFFKGKPRLLSPEISLKDYQQTGINWLNLLYQNKMSCI 594

Query: 411  LADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMG 470
            LAD+MGLGKT Q +SF ++L     + GPHLVVVP ST+  W   F K+AP L    Y G
Sbjct: 595  LADDMGLGKTCQVISFFAYLKQIN-EPGPHLVVVPSSTLENWLREFQKFAPALKIEPYYG 653

Query: 471  NQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIK---WQFLAVDEA 527
            +   R+ ++D           +   K++V++TTY     ++  +  +K   +  +  DE 
Sbjct: 654  SLQEREELRDI--------LERNAGKYDVIVTTYNLAAGNKYDVSFLKNRNFNVVVYDEG 705

Query: 528  HRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQ 587
            H LKN+ S  +  L   +   RLL+TGTPLQNN+KEL +L+ F+MP  F I ++  F+  
Sbjct: 706  HMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKELMSLLEFIMPNLF-ISKKESFDAI 764

Query: 588  DEQQ---------------EEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSD 632
             +Q+               +E I      ++PFILRR K  V K LP K   I   EL+ 
Sbjct: 765  FKQRAKTTDDNKNHNPLLAQEAITRAKTMMKPFILRRRKDQVLKHLPPKHTHIQYCELNA 824

Query: 633  VQTEYYK---NILTKNYSALTSG---------IKGGHVSLLNVMNELKKASNHPYLFDNA 680
            +Q + Y     I+ ++   +  G          K    S  N++  L+KAS HP LF N 
Sbjct: 825  IQKKIYDKEIQIVLEHKRMIKDGELPKDAKEKSKLQSSSSKNLIMALRKASLHPLLFRNI 884

Query: 681  -EERVLSKFGDG----------------------------HKSRENILRGLI-------- 703
              +++++K  D                             HK   N    L         
Sbjct: 885  YNDKIITKMSDAILDEPAYAENGNKEYIKEDMSYMTDFELHKLCCNFPNTLSKYQLHNDE 944

Query: 704  -MSSGXXXXXXXXXXXXXXDGH-RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQ 761
             M SG              D   +VLIFS   ++LDIL   LS     F RLDG+     
Sbjct: 945  WMQSGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDILEMVLSTLDYKFLRLDGSTQVND 1004

Query: 762  RRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIG 821
            R++ ID F  ED +  +F+LST+AGG GINL+ A+ VIIFD  +NP  D QA  RAHR+G
Sbjct: 1005 RQLLIDKF-YEDKDIPIFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVG 1063

Query: 822  QKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 855
            Q   V +   ++KD++EE++ + A+ K+ L+  I
Sbjct: 1064 QTKEVNITTLITKDSIEEKIHQLAKNKLALDSYI 1097

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  263 bits (672), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 184/564 (32%), Positives = 284/564 (50%), Gaps = 76/564 (13%)

Query: 380  PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG- 438
            P  IK   LR +Q  GINW+AFL   + +GIL D+MGLGKT+QT+  I+   Y R++   
Sbjct: 1306 PVAIKA-TLRKYQQDGINWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRQEEYK 1364

Query: 439  ----------PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQ 488
                      P L+V P S    W+  F++++P L  V Y G  + R            Q
Sbjct: 1365 LSGNIECRPLPSLIVCPPSLTGHWENEFEQYSPFLKIVVYAGGPSVR------------Q 1412

Query: 489  AKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 548
               K+    ++++T+Y+    D  T+ S  + +  +DE H +KNA+S L +++   K  +
Sbjct: 1413 PLRKQLSSADIIITSYDVARNDLDTISSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANH 1472

Query: 549  RLLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEQQEE--- 593
            RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   ++QE    
Sbjct: 1473 RLILTGTPIQNNVVELWSLFDFLMPGFLGTEKSFQERFAKPIAASRNSKTSSKEQEAGAL 1532

Query: 594  YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI 653
             +  LHK++ PF+LRRLK+DV   LP K  +    ELSD+Q + Y++   K  + +   I
Sbjct: 1533 ALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDI 1592

Query: 654  KG-----GHVSLLNVMNELKKASNHPYLF---DNAEERVLSKF-----GDGHKSRE---- 696
            +          +   +  ++K  NHP L    D+ + + +  +      D H  R     
Sbjct: 1593 QNTADVDSKQHIFQALQYMRKLCNHPALVLSNDHPQLKQIQNYLKQTGCDLHDIRNAPKL 1652

Query: 697  NILRGLIMSSGX-------XXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYL---SIK 746
              LR L+   G                       HR LIF Q+  +LD++ + L    + 
Sbjct: 1653 TALRTLLFECGIGEADMDKKVTGEQLLTGSVISQHRALIFCQLKDMLDMIENDLFKRYMP 1712

Query: 747  GINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWN 806
             +++ RLDG+V    R+  +  FN + S D   LL+T+ GGLG+NL  ADTVI  + DWN
Sbjct: 1713 SVSYMRLDGSVDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWN 1771

Query: 807  PQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS-----LGVT 861
            P  DLQAM RAHR+GQK  V VYR V+K T+EE+++   + KM +   +++     L   
Sbjct: 1772 PMNDLQAMDRAHRLGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASM 1831

Query: 862  DGNKISST--KKNEPS--AGELSE 881
            D +++       N PS  AGE++E
Sbjct: 1832 DTHQLLDLFDTDNVPSNNAGEVAE 1855

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  263 bits (671), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 174/529 (32%), Positives = 271/529 (51%), Gaps = 66/529 (12%)

Query: 380  PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG- 438
            P  IK   LR +Q  G+NW+AFL   + +GIL D+MGLGKT+QT+  I+   Y R ++  
Sbjct: 1280 PVAIKA-TLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDYK 1338

Query: 439  ----------PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQ 488
                      P L++ P S    W++ F +++P LN + Y G  + R  +Q       P 
Sbjct: 1339 KTQSEKTRPLPSLIICPPSLTGHWEQEFQQYSPTLNVLVYAGGPSVRYPLQGQV----PT 1394

Query: 489  AKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 548
            A        ++++T+Y+    D   L    + +  +DE H +KN++S L +++      +
Sbjct: 1395 A--------DIVVTSYDVARNDVDFLKKYDYNYCVLDEGHIIKNSQSKLAKAVKLINSNH 1446

Query: 549  RLLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEQQEE--- 593
            RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   ++QE    
Sbjct: 1447 RLVLTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQERFAKPIASSRNSKTSSKEQEAGAL 1506

Query: 594  YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI 653
             +  LHK++ PF+LRRLK++V   LP K  +    ELSD+Q + Y + + K  + +   I
Sbjct: 1507 ALEALHKQVLPFMLRRLKEEVLSDLPPKIIQDYYCELSDLQKQLYNDFVKKQKNVVEKDI 1566

Query: 654  KG-----GHVSLLNVMNELKKASNHPYLFDNAE-------ERVLSKFG-----DGHKSRE 696
            +          +   +  ++K  NHP L  N+        +  LS+ G      GH  + 
Sbjct: 1567 ENTAEVENKQHIFQALQYMRKLCNHPSLVLNSSHPQFQQVQSYLSQTGMDLHDIGHAPKL 1626

Query: 697  NILRGLIMSSGXXXXXXXXXXXX------XXDGHRVLIFSQMVRILDILGDYL---SIKG 747
              L+ L++  G                      HRVLIF Q+  +LD++ + L    +  
Sbjct: 1627 EALKTLLLECGIGIQDVEKKSNKNPSIDNVISQHRVLIFCQLKDMLDMVENDLLKKHLPS 1686

Query: 748  INFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNP 807
            + F RLDG+V S  R+  +  FN + S D   LL+T+ GGLG+NL  ADTVI  + DWNP
Sbjct: 1687 VTFMRLDGSVDSRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNP 1745

Query: 808  QADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 856
              DLQAM RAHR+GQK  V VYR ++K T+EE+++   + KM +   I+
Sbjct: 1746 MNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTIV 1794

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  257 bits (657), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 168/525 (32%), Positives = 254/525 (48%), Gaps = 76/525 (14%)

Query: 388 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLS 447
           L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q +SF++ L ++   +GP L+V P +
Sbjct: 285 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIISFLASLHHSGMLDGPILIVCPAT 344

Query: 448 TMPAWQETFDKWAPGLNCVYY------MGNQ--ASRDLIQDYEFYTNPQ----------- 488
            M  W   F  W P    V        M N+   S D +++    +NP+           
Sbjct: 345 VMKQWCNEFHTWWPPFRAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSK 404

Query: 489 -AKGKKHLKFN-------------VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAE 534
             K     K N             VL+TTY  +      L  +KW +  +DE H+++N +
Sbjct: 405 KTKSTMESKLNLTKLVDKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPD 464

Query: 535 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGR----------FTIDQEID- 583
           S +  +    K +NR++++GTP+QNN+ EL +L +F+ PGR          F I   +  
Sbjct: 465 SDISLTCKQLKTSNRVILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGG 524

Query: 584 FENQDEQQEEY-------IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTE 636
           + N    Q +        +RDL   + P++LRR+K DV K LP K E +L  +L+  Q  
Sbjct: 525 YANATNIQVQTGYKCAVALRDL---ISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRN 581

Query: 637 YYKNILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRE 696
            Y   L    S     IK G   +L  ++ L+K  NHP +           +GD  +S  
Sbjct: 582 KYLQFLN---SGDLVKIKNGKRQVLYGIDILRKICNHPDILVRDMRHSEESYGDPKRS-- 636

Query: 697 NILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLS-----IKGINFQ 751
                     G               GH+ L+F+Q  ++LDIL  ++S     +  + + 
Sbjct: 637 ----------GKMQVVKQLLKLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYL 686

Query: 752 RLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADL 811
           R+DGT   A R+  +D FN E  +  VFLL+TR GGLG+NL  A+ +IIFD DWNP  DL
Sbjct: 687 RMDGTTNIAARQHLVDKFNNELYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDL 744

Query: 812 QAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 856
           QA  RA RIGQK  V +YR +   ++EE++  R   K  L   I+
Sbjct: 745 QARERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLTNKIL 789

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  256 bits (655), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 174/560 (31%), Positives = 274/560 (48%), Gaps = 89/560 (15%)

Query: 387 ELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPL 446
           +L  +Q T + W+  L  +N  GI+ DEMGLGKT+Q VSF++ L ++ +  GP LVV P 
Sbjct: 262 KLFSYQKTCVQWLYELHQQNCGGIVGDEMGLGKTIQIVSFLASLHHSGKLKGPVLVVCPA 321

Query: 447 STMPAWQETFDKWAPGLNCV--YYMG-----------NQASRDLIQD------YEFYTNP 487
           + M  W   F  W P    V  + +G            Q    L++D      YE Y N 
Sbjct: 322 TVMKQWCSEFQTWWPPFRAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYAN- 380

Query: 488 QAKGKKHLKF---------------NVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKN 532
             + KK L+                ++L+TTY  +      L  + W +  +DE H+++N
Sbjct: 381 LGRTKKQLEARRGIESLVQKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRN 440

Query: 533 AESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI------ 582
            ++ +  +    +  +R++++GTP+QNN+ EL +L +F+ PG+        Q+       
Sbjct: 441 PDAGISLTCKRLRTPHRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINA 500

Query: 583 -DFENQDEQQEE-------YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQ 634
             + N    Q +        +RDL   + P++LRR+K DV K LP K E +L  +++  Q
Sbjct: 501 GGYANATNIQVQTGYKCAVALRDL---ISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQ 557

Query: 635 TEYYKNILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKS 694
            E Y   L    S     IK G   +L  ++ L+K  NHP L +    +    FGD  +S
Sbjct: 558 KEKYLQFLN---SEDMIKIKNGRRQVLYGIDILRKICNHPDLLERDFRKHEPSFGDPRRS 614

Query: 695 -RENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLS-----IKGI 748
            +  +++ L+++                 GH+ L+F+Q  ++LDIL  Y+S     + G+
Sbjct: 615 GKMTVIKQLLLT-------------WKKQGHKALLFTQSRQMLDILEAYISHKDPELAGL 661

Query: 749 NFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQ 808
            + R+DGT   A R+  +D FN  +    +FLL+TR GGLG+NL  A+ +IIFD DWNP 
Sbjct: 662 QYLRMDGTTNIAHRQALVDRFN--NGPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPS 719

Query: 809 ADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKISS 868
            DLQA  RA RIGQK  V +Y  +   ++EE++  R   K  L   ++S    D  +   
Sbjct: 720 TDLQARERAWRIGQKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVLS----DPKQKRF 775

Query: 869 TKKNEPSAGELSEILKFGAG 888
            K N     EL ++  FG G
Sbjct: 776 FKMN-----ELHDLFSFGPG 790

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  260 bits (665), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 173/533 (32%), Positives = 266/533 (49%), Gaps = 72/533 (13%)

Query: 380  PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG- 438
            P  IK   LR +Q  G+NW+AFL   + +GIL D+MGLGKT+QT+  I+   Y R+++  
Sbjct: 1265 PIAIKA-TLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYE 1323

Query: 439  ----------PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQ 488
                      P L++ P S    W+  FD++AP L  V Y G    R           PQ
Sbjct: 1324 KTRSVESRALPSLIICPPSLTGHWENEFDQYAPFLKVVVYAGGPTVR-------LTLRPQ 1376

Query: 489  AKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 548
                     ++++T+Y+    D + L   ++ +  +DE H +KN++S L +++      +
Sbjct: 1377 LSDA-----DIIVTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANH 1431

Query: 549  RLLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEQQEE--- 593
            RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   ++QE    
Sbjct: 1432 RLILTGTPIQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVL 1491

Query: 594  YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-------KNILTKNY 646
             +  LHK++ PF+LRRLK+DV   LP K  +    EL D+Q + Y       KN++ K+ 
Sbjct: 1492 ALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDI 1551

Query: 647  SALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKS------------ 694
                S I  G   +   +  ++K  NHP L  +     L++  D  K             
Sbjct: 1552 E--NSEIADGKQHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGLDLHDIINAP 1609

Query: 695  RENILRGLIMSSGX--------XXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYL--- 743
            + + LR L+   G                        HR LIF Q+  +LD++ + L   
Sbjct: 1610 KLSALRTLLFECGIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKK 1669

Query: 744  SIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDS 803
             +  + + RLDG++    R+  +  FN + S D   LL+T+ GGLG+NL  ADTVI  + 
Sbjct: 1670 YMPSVTYMRLDGSIDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEH 1728

Query: 804  DWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 856
            DWNP  DLQAM RAHRIGQK  V VYR ++K T+EE+++   + KM +   ++
Sbjct: 1729 DWNPMNDLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVV 1781

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  260 bits (664), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 181/552 (32%), Positives = 279/552 (50%), Gaps = 85/552 (15%)

Query: 380  PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG- 438
            P  IK   LR +Q  GINW+AFL   + +GIL D+MGLGKT+QT+  I+   Y R+++  
Sbjct: 1272 PVAIKA-TLRKYQQEGINWLAFLNHYHLHGILCDDMGLGKTLQTICIIASDQYLRQEDYK 1330

Query: 439  ----------PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQ 488
                      P L+V P S    W++ F+++AP L  + Y G  ++R     Y       
Sbjct: 1331 TTKSVETRPLPSLIVCPPSLTGHWEQEFEQYAPFLTVLVYAGGPSTR-----YPL----- 1380

Query: 489  AKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 548
             +GK     ++++T+Y+    D   +    + +  +DE H +KN++S L +++ S +  +
Sbjct: 1381 -RGKLG-DADIVVTSYDVARNDIDIISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANH 1438

Query: 549  RLLITGTPLQNNIKELAALVNFLMPG----------RFT--IDQEIDFENQDEQQEE--- 593
            RL++TGTP+QNN+ EL +L +FLMPG          RF   I    + +   ++QE    
Sbjct: 1439 RLILTGTPIQNNVVELWSLFDFLMPGFLGSEKAFQERFAKPIAASRNSKTSSKEQEAGAL 1498

Query: 594  YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI 653
             +  LHK++ PF+LRRLK+DV   LP K  +    ELSD+Q + YK+   K  + +   I
Sbjct: 1499 ALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDI 1558

Query: 654  KG-------GHVSLLNVMNELKKASNHPYLF-------DNAEERVLSKFG-----DGHKS 694
            +         H+     +  ++K  NHP L         N  +  LS+ G       H  
Sbjct: 1559 ENTMELESKNHI--FQALQYMRKLCNHPSLVLSKDHPQYNQVQDYLSQTGMDIHDIAHAP 1616

Query: 695  RENILRGLIMSSGX------XXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYL---SI 745
            +   LR L++  G                      HR LIF Q+  +LD++ + L    +
Sbjct: 1617 KLGALRNLLLECGIGVQDVDQNSISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKYL 1676

Query: 746  KGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDW 805
              + + RLDG+V S  R+  +  FN + S D   LL+T+ GGLG+NL  ADTVI  + DW
Sbjct: 1677 PSVTYMRLDGSVESRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFIEHDW 1735

Query: 806  NPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLGVTDGNK 865
            NP  DLQAM RAHR+GQK  V VYR ++K ++EE+++   + KM                
Sbjct: 1736 NPMNDLQAMDRAHRLGQKKVVNVYRIITKGSLEEKIMGLQKFKM---------------N 1780

Query: 866  ISSTKKNEPSAG 877
            I+ST  N+ +AG
Sbjct: 1781 IASTVVNQQNAG 1792

>Scas_549.4
          Length = 1079

 Score =  256 bits (654), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 156/524 (29%), Positives = 260/524 (49%), Gaps = 72/524 (13%)

Query: 388 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLS 447
           L ++Q T + W+  L+ +N  GI+ DEMGLGKT+Q ++F++ L ++   NGP L+V P +
Sbjct: 304 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIIAFLASLHHSGLLNGPVLIVCPAT 363

Query: 448 TMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDY--------------------EFYTNP 487
            M  W      W P L  +      +     +++                    +F    
Sbjct: 364 VMKQWCNELHHWWPPLRTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRS 423

Query: 488 QAKGKKHLKFNV-------------LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAE 534
           + K      FN+             ++TTY  +      L  + W +  +DE H+++N +
Sbjct: 424 KTKASLESTFNIQSLIDKVINDGHIIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPD 483

Query: 535 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRF----TIDQEI-------D 583
           S +  +    K  NR++++GTP+QNN+ EL +L +F+ PG+        Q+         
Sbjct: 484 SDISLTCKKIKTPNRIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGG 543

Query: 584 FEN----QDEQQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK 639
           + N    Q +   +    L   + P++LRR+K DV K LP K E +L  +L+  Q   Y 
Sbjct: 544 YANATNIQVQTGVKCATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYL 603

Query: 640 NILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKS-RENI 698
             L  N   LT  I+GG   +L  ++ L+K  NHP L +  E +  + +G+  +S +  +
Sbjct: 604 EFLNSN--ELTQ-IRGGRRHVLYGIDILRKICNHPDLLEREERQYETDYGNPKRSGKMQV 660

Query: 699 LRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKG-----INFQRL 753
           ++ L++                 +GH+ L+F+Q  ++LDIL  ++  K      + + R+
Sbjct: 661 VKQLLL-------------LWHKEGHKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRM 707

Query: 754 DGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQA 813
           DGT   ++R+  +D FN ED +  VFLL+TR GGLG+NL  A+ +II+D DWNP  D+QA
Sbjct: 708 DGTSNISKRQGLVDQFNNEDYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQA 765

Query: 814 MARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 857
             RA RIGQK  V +YR +   ++EE++  R   K  L   I++
Sbjct: 766 RERAWRIGQKREVSIYRLMVSGSIEEKIYHRQIFKQFLTNKILT 809

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  255 bits (651), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 170/549 (30%), Positives = 268/549 (48%), Gaps = 82/549 (14%)

Query: 371 PKFEKLDAQPSFIKGGE----LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSF 426
           PK    +    F+  G+    L  +Q T + W+  L+ +   GI+ DEMGLGKT+Q ++F
Sbjct: 244 PKISDANISEDFMVPGDIFPLLFPYQKTCVQWLCELYQQGCGGIIGDEMGLGKTIQIIAF 303

Query: 427 ISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYM--------GNQASRDLI 478
           ++ L ++R+ NGP LVV P + M  W   F  W P    V           G Q   + +
Sbjct: 304 LATLHHSRKLNGPVLVVCPATVMKQWCNEFHTWWPPFRAVILHSIGAGMNKGTQIPEEEL 363

Query: 479 Q--------------DYEFY--TNPQAKGKKHLK---------FNVLLTTYEYILKDRST 513
           +              DYE    T    + +K +K          ++++TTY  +      
Sbjct: 364 EKMLMTSNYGTFTYNDYEKKEKTRTSLESRKSVKKLLEKVITDGHIIITTYVGLRLHSEA 423

Query: 514 LGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMP 573
           L +++W +  +DE H+++N +S +  +    K  NR++++GTP+QNN+ EL +L +F+ P
Sbjct: 424 LLNVRWGYAILDEGHKIRNPDSDISLTCKQLKTQNRIILSGTPIQNNLTELWSLFDFVYP 483

Query: 574 GRF----TIDQEI-------DFENQDEQQEEY-------IRDLHKRLQPFILRRLKKDVE 615
           G+        Q+         + N    Q +        +RDL   + P++LRR+K DV 
Sbjct: 484 GKLGTLPVFQQQFANPINMGGYANASNIQVKTGYKCAVALRDL---ISPYLLRRVKSDVA 540

Query: 616 KSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPY 675
           K LP K E +L  +L+  Q   Y   L   +S     I+ G   +L  ++ L+K  NHP 
Sbjct: 541 KDLPKKNEMVLFCKLTQYQKSKYLEFL---HSDELMKIRKGKRQVLYGIDILRKICNHPD 597

Query: 676 LFDNAEERVLSKFGD---GHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 732
           L D  + + ++ + D   G+ +R          SG               GH+ L+F+Q 
Sbjct: 598 LLD-LKRKKMNDYEDADYGNPAR----------SGKMQVVKQLLLLWHSQGHKTLLFTQS 646

Query: 733 VRILDILGDYLSIKG-----INFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGG 787
            ++LDIL +++S K      + F R+DGT     R+  +D FN E  +  VFLL+TR GG
Sbjct: 647 RQMLDILQEFISYKDPELSDLKFLRMDGTTNIGSRQSLVDKFNNEPYD--VFLLTTRVGG 704

Query: 788 LGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARK 847
           LGINL  A+ +IIFD DWNP  D+QA  RA RIGQK  V +YR +   ++EE++  R   
Sbjct: 705 LGINLTGANRIIIFDPDWNPSTDMQARERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIF 764

Query: 848 KMILEYAII 856
           K  L   I+
Sbjct: 765 KQFLSNKIL 773

>Scas_664.9
          Length = 1859

 Score =  256 bits (654), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 171/533 (32%), Positives = 266/533 (49%), Gaps = 72/533 (13%)

Query: 380  PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG- 438
            P  IK   LR +Q  G+NW+AFL     +GIL D+MGLGKT+QT+  I+   Y R ++  
Sbjct: 1260 PVAIKA-TLRKYQQDGVNWLAFLNKYRLHGILCDDMGLGKTLQTICIIASDQYLRAEDYK 1318

Query: 439  ----------PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQ 488
                      P L+V P S    W+  F+++AP L  + Y G  + R  ++D E  +   
Sbjct: 1319 KTNSVETRKLPSLIVCPPSLTGHWENEFEQYAPFLKIIVYAGGPSMRIPLRD-ELGSA-- 1375

Query: 489  AKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 548
                     ++++T+Y+    D S +    + +  +DE H +KNA+S L +++      +
Sbjct: 1376 ---------DIVITSYDVARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQISANH 1426

Query: 549  RLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI------------DFENQDEQQEE--- 593
            RL++TGTP+QNN+ EL +L +FLMPG    ++              + +   ++QE    
Sbjct: 1427 RLILTGTPIQNNVVELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVL 1486

Query: 594  YIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY-------KNILTKNY 646
             +  LHK++ PF+LRRLK+DV   LP K  +    ELSD+Q + Y       KN++ K+ 
Sbjct: 1487 ALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVEKDI 1546

Query: 647  SALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKS------------ 694
               T      H+     +  ++K  NHP L  +     L++  D  K             
Sbjct: 1547 ENTTDTDNSQHI--FQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGIDLHDVINAP 1604

Query: 695  RENILRGLIMSSGX--------XXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYL--- 743
            + N LR L+   G                        HR LIF Q+  +LD++ + L   
Sbjct: 1605 KLNALRTLLFECGIGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLDMVENDLFKR 1664

Query: 744  SIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDS 803
             +  + + RLDG+V    R+  +  FN + S D   LL+T+ GGLG+NL  ADTVI  + 
Sbjct: 1665 YMPSVTYMRLDGSVDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEH 1723

Query: 804  DWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 856
            DWNP  DLQAM RAHR+GQK  V VYR ++K T+EE+++   + KM +   ++
Sbjct: 1724 DWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVV 1776

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  249 bits (637), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 179/539 (33%), Positives = 264/539 (48%), Gaps = 80/539 (14%)

Query: 388  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLS 447
            L+D+Q TGINW+  L+    + ILAD+MGLGKT Q +SF+++L     Q  PHL+VVP S
Sbjct: 572  LKDYQQTGINWLNLLYHNQISCILADDMGLGKTCQVISFLAYLKQIG-QPSPHLIVVPSS 630

Query: 448  TMPAWQETFDKWAPGLNCVYYMGNQASR-DLIQDYEFYTNPQAKGKKHLKFNVLLTTYEY 506
            T+  W   F K+ P L    Y G Q  R DL +  E         +   K++V++TTY  
Sbjct: 631  TLENWLREFQKFCPSLKIEPYYGTQQERADLREILE---------RNDGKYDVIVTTYNL 681

Query: 507  ILK---DRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKE 563
                  D S L +  +  +  DE H LKN+ S  +  L       RLL+TGTPLQNN+KE
Sbjct: 682  AAGNKYDVSFLKTRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLKE 741

Query: 564  LAALVNFLMPGRFTIDQE---IDFENQDEQQ-----------EEYIRDLHKRLQPFILRR 609
            L +L+ F+MP  F   +E     F+ + +             ++ I      ++PFILRR
Sbjct: 742  LMSLLEFIMPNLFVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQAITRAKTMMKPFILRR 801

Query: 610  LKKDVEKSLPSKTERILRVELSDVQTEYYK---NILTKNYSALTSGI---------KGGH 657
             K  V K LP+K  R     ++D Q E Y     ++ ++   +  G          K  +
Sbjct: 802  RKDQVLKHLPAKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKERSKIEN 861

Query: 658  VSLLNVMNELKKASNHP----YLFDNA----------EERVLSKFGDGHKSRENI----- 698
             S  N++  L+KAS HP    +++D+A          +E   ++ G+    RE++     
Sbjct: 862  NSSKNLIMSLRKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENGNKEYIREDMSFMTD 921

Query: 699  --LRGLI-----------------MSSGXXXXXXXXXXXXXXDG-HRVLIFSQMVRILDI 738
              L  L                  M+SG                  +VLIF+   ++LDI
Sbjct: 922  FELHRLCCNFPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIFTLFTQVLDI 981

Query: 739  LGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTV 798
            L   LS     F RLDG+     R+  ID F  +D+   +F+LSTRAGG GINL+ A+ V
Sbjct: 982  LEKVLSTLNYKFLRLDGSTQVNDRQTMIDKF-YDDNTIPIFMLSTRAGGFGINLVCANHV 1040

Query: 799  IIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 857
            IIFD  +NP  D QA  RAHR+GQ   V V   ++KD++EE++ + A+ K+ L+  + S
Sbjct: 1041 IIFDQSFNPHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAKTKLALDSQVSS 1099

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
           Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  229 bits (583), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 193/340 (56%), Gaps = 35/340 (10%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           PS ++G  LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT+S +S+L   +   GP
Sbjct: 621 PSLLRGT-LRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLSYLACEKHNWGP 679

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
           HL+VVP S +  W+  F ++APG   + Y GN   R   +  + +  P A       F+V
Sbjct: 680 HLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGNPQQRK--EKRKGWNKPDA-------FHV 730

Query: 500 LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 559
            + +Y+ I++D+ +    KWQ++ +DEAH +KN  S+ +++L +F    R+L+TGTPLQN
Sbjct: 731 CIVSYQLIVQDQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQN 790

Query: 560 NIKELAALVNFLMPGRFTIDQEID-------FEN-----------------QDEQQEEYI 595
           NI EL +L+ FLMP      Q++        F+                  QD + +  +
Sbjct: 791 NIAELWSLLYFLMPQTVIDGQKVSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTV 850

Query: 596 RDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG 655
             LH+ L+P++LRRLK DVEK +P K E I+  +LS  Q   Y + +++  +  T    G
Sbjct: 851 EKLHQVLRPYLLRRLKADVEKQIPGKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLA-SG 909

Query: 656 GHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSR 695
             +S++N + +L+K  NHP LF+    +    FG+   +R
Sbjct: 910 NFMSIVNCLMQLRKVCNHPDLFEVRPIKTSFLFGESVIAR 949

 Score =  142 bits (357), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 90/137 (65%), Gaps = 1/137 (0%)

Query: 723  GHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLS 782
            GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I  + FN+ D    VF+LS
Sbjct: 1194 GHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNS-DPKITVFILS 1252

Query: 783  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVL 842
            +R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YRFVS+ T+E  +L
Sbjct: 1253 SRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNIL 1312

Query: 843  ERARKKMILEYAIISLG 859
            ++A +K  L+  II  G
Sbjct: 1313 KKANQKRQLDDVIIQKG 1329

>Scas_646.3*
          Length = 1456

 Score =  226 bits (575), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 119/324 (36%), Positives = 192/324 (59%), Gaps = 37/324 (11%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           PS ++G  LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT+S +++L   ++  GP
Sbjct: 637 PSLLRGT-LRTYQKQGLNWLASLFNNNTNGILADEMGLGKTIQTISLLAYLACEKQNWGP 695

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
           HL+VVP S +  W+  F ++ PGL  + Y G+   R   +  + +  P A       F+V
Sbjct: 696 HLIVVPTSVLLNWEMEFKRFCPGLKVLTYYGSPQQRK--EKRKGWNKPDA-------FHV 746

Query: 500 LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 559
            + +Y+ +++D+ +    KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTPLQN
Sbjct: 747 CIVSYQLVVQDQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQN 806

Query: 560 NIKELAALVNFLMP----------------------GRFTIDQEIDF---ENQDEQQEEY 594
           N+ EL +L+ FLMP                      GR  +D+ I+      QD + ++ 
Sbjct: 807 NLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGR-PVDKLIETGAGYQQDAETKKT 865

Query: 595 IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIK 654
           +  LH+ L+P++LRRLK DVEK +P+K E I+   LS  Q   Y + ++++ +  T    
Sbjct: 866 VSKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCRLSKRQRFLYDDFMSRSQTKATLA-S 924

Query: 655 GGHVSLLNVMNELKKASNHPYLFD 678
           G  +S++N + +L+K  NHP LF+
Sbjct: 925 GNFMSIVNCLMQLRKVCNHPDLFE 948

 Score =  140 bits (353), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 90/138 (65%), Gaps = 1/138 (0%)

Query: 722  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLL 781
            +GHR LIF+QM ++LD+L  +L+  G  + RLDG      R+I  + FN  D    VF+L
Sbjct: 1204 NGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVEDRQILTERFN-NDPRVTVFIL 1262

Query: 782  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 841
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YRFVS+ T+E  +
Sbjct: 1263 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNI 1322

Query: 842  LERARKKMILEYAIISLG 859
            L++A +K  L+  +I  G
Sbjct: 1323 LKKANQKRQLDNVVIQRG 1340

>Kwal_34.16082
          Length = 726

 Score =  219 bits (557), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 144/479 (30%), Positives = 234/479 (48%), Gaps = 70/479 (14%)

Query: 388 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLS 447
           L ++Q T + W+  L+ +   GI+ DEMGLGKT+Q ++F++ L ++ + +GP L+V P +
Sbjct: 263 LFNYQKTCVQWLYELFQQQCGGIIGDEMGLGKTIQIIAFLASLHHSGKLDGPVLIVCPAT 322

Query: 448 TMPAWQETFDKWAPGLNCVYYMGNQA--------SRDLIQDYEFYTNPQ----------- 488
            +  W + F  W P    V      A        S + +++    +NP+           
Sbjct: 323 VLRQWCKEFHTWWPPFRTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSK 382

Query: 489 ----------AKGKKHLKF----NVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAE 534
                     A+ K   K     ++L+TTY  +      L +++W +  +DE H+++N +
Sbjct: 383 RTKSTLESGMARSKLINKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPD 442

Query: 535 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGR----------FTIDQEI-D 583
           + +  +    K  NR++++GTP+QNN+ EL +L +F+ PGR          F+I   +  
Sbjct: 443 ADISLTCKKLKTKNRIILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGG 502

Query: 584 FEN----QDEQQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYK 639
           + N    Q +   +    L   + P++LRR+K DV K LP K E +L  +L+  Q   Y 
Sbjct: 503 YANATNIQVQTGYKCAIALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRRKYL 562

Query: 640 NILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENIL 699
             L  N   LT  IK G   +L  ++ L+K  NHP L +  +    S +GD  +      
Sbjct: 563 QFL--NSEDLTK-IKNGKRQVLFGIDILRKICNHPDLLEKDKRENESSYGDPKR------ 613

Query: 700 RGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIK-----GINFQRLD 754
                 SG               GH+ L+F+Q  ++LDIL  ++S K      + + R+D
Sbjct: 614 ------SGKMQVVKQLLRLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYLRMD 667

Query: 755 GTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQA 813
           GT     R+  +D FN    +  VFLL+TR GGLG+NL  A+ +IIFD DWNP  D+QA
Sbjct: 668 GTTNIGSRQALVDSFNNGLYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQA 724

>Kwal_55.20143
          Length = 1494

 Score =  224 bits (571), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 188/323 (58%), Gaps = 35/323 (10%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           PS ++G  LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT+S +++L   +   GP
Sbjct: 664 PSLLRGT-LRIYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLAYLACEKHNWGP 722

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
           HL++VP S +  W+  F ++APG   + Y G+   R   +  + +  P A       F+V
Sbjct: 723 HLIIVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRK--EKRKGWNRPDA-------FHV 773

Query: 500 LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 559
            +T+Y+ ++ D+ +    KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTPLQN
Sbjct: 774 CITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQN 833

Query: 560 NIKELAALVNFLMP----------------------GRFT--IDQEIDFENQDEQQEEYI 595
           N+ EL +L+ FLMP                      GR    I Q  +   QDE+  + +
Sbjct: 834 NLAELWSLLYFLMPQTAGTNGGIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEETRKTV 893

Query: 596 RDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG 655
             LH+ L+P++LRRLK DVEK +P+K E ++   LS  Q   Y + +++  +  T    G
Sbjct: 894 TKLHQVLRPYLLRRLKADVEKQMPAKHEHVVYCRLSKRQRFLYDDFMSRAQTKETLS-SG 952

Query: 656 GHVSLLNVMNELKKASNHPYLFD 678
             +S++N + +L+K  NHP LF+
Sbjct: 953 NFMSIINCLMQLRKVCNHPDLFE 975

 Score =  140 bits (353), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 98/160 (61%), Gaps = 1/160 (0%)

Query: 723  GHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLS 782
            GHR LIF+QM ++LD+L  +L+  G  + RLDG     +R+I  + FN  D+    F+LS
Sbjct: 1233 GHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQILTERFNT-DNRITAFILS 1291

Query: 783  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVL 842
            +R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YRFVS+ T+E  +L
Sbjct: 1292 SRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNIL 1351

Query: 843  ERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEI 882
            ++A +K  L+  +I  G    + ++     +    EL +I
Sbjct: 1352 KKANQKRQLDNVVIQRGDFTTDYLTKLSVKDLVGAELPDI 1391

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  224 bits (571), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 190/323 (58%), Gaps = 35/323 (10%)

Query: 380  PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
            PS ++G  LR +Q  G+NW+A L++   NGILADEMGLGKT+QT+S +++L   +   GP
Sbjct: 758  PSLLRGT-LRIYQKQGLNWLASLYNNKTNGILADEMGLGKTIQTISLLAYLACEKENWGP 816

Query: 440  HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
            HL+VVP S +  W+  F ++APG   + Y G+   R   +  + +  P A       F+V
Sbjct: 817  HLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRR--EKRKGWNKPDA-------FHV 867

Query: 500  LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 559
             +T+Y+ ++ D+ +    KWQ++ +DEAH +KN  S+ +++L +F    RLL+TGTPLQN
Sbjct: 868  CITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQN 927

Query: 560  NIKELAALVNFLMP------GRFTIDQEID-FEN-----------------QDEQQEEYI 595
            N+ EL +L+ FLMP      G+ +   ++D F+                  QDE+ ++ +
Sbjct: 928  NLAELWSLLYFLMPQTALENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETKKTV 987

Query: 596  RDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG 655
              LH+ L+P++LRRLK DVEK +P K E I+   LS  Q   Y + +++  +  T    G
Sbjct: 988  SKLHQVLRPYLLRRLKADVEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLA-SG 1046

Query: 656  GHVSLLNVMNELKKASNHPYLFD 678
              +S++N + +L+K  NHP LF+
Sbjct: 1047 NFMSIINCLMQLRKVCNHPDLFE 1069

 Score =  143 bits (361), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 116/214 (54%), Gaps = 14/214 (6%)

Query: 722  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLL 781
            +GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I  + FN+ D    VF+L
Sbjct: 1325 NGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQILTERFNS-DPRITVFIL 1383

Query: 782  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 841
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YRFVS  T+E  +
Sbjct: 1384 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSDHTIESNI 1443

Query: 842  LERARKKMILEYAIISLGVTDGNKISSTKKNEPSAGELSEILKFGAGNMFKPNDNQQKLE 901
            L++A +K  L+  +I  G    +  +     +    E  E +         P+D     +
Sbjct: 1444 LKKANQKRHLDNVVIQTGDFTTDYFTKLSVKDLLGAEAPEDI---------PDDKPLLQD 1494

Query: 902  DLNLDEVLNHAEDH----ITTPELGESNLGGEEF 931
              NL+++L  AED          L E N+  E+F
Sbjct: 1495 QKNLNKLLAQAEDEDDAKAAKSALREVNVDNEDF 1528

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score =  220 bits (561), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 147/479 (30%), Positives = 241/479 (50%), Gaps = 36/479 (7%)

Query: 410 ILADEMGLGKTVQTVSFISWLIY-----ARRQNGPHLVVVPLSTMPAWQETFDKW-APG- 462
           I+ADEMGLGKT+Q ++ + W +       RR     ++V P S +  W    DKW  PG 
Sbjct: 329 IMADEMGLGKTLQCLALM-WTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGS 387

Query: 463 LNCVYYMGNQASRDLIQDYEFYTN-PQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQF 521
           L+ +   G ++S +     +  ++   A+G+  +K  VL+ +Y+ + ++   L + +   
Sbjct: 388 LSSLAIDGKKSSLNNGNVADSVSHWASAQGRNIVK-PVLIISYDTLRRNVEQLKNCEVGL 446

Query: 522 LAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG------- 574
           +  DE HRLKNA+S  + +L+S +   R++++GTP+QN++ E  AL+NF  PG       
Sbjct: 447 MLADEGHRLKNADSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRND 506

Query: 575 -----RFTIDQEIDFENQDEQ---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERIL 626
                   I Q  D    DE+    ++ +R L   +  FI+RR    + K LP K E ++
Sbjct: 507 FRKNFELPILQSRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVI 566

Query: 627 RVELSDVQTEYYKNILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFD------NA 680
            + L+  Q   Y++ +     A+   +KG     L  +  LKK  NHP L +       +
Sbjct: 567 FINLTPFQQSLYQHFIESR--AVKKIVKGDSNQPLKAIGLLKKLCNHPDLLELSEDIPGS 624

Query: 681 EERVLSKFGDGHKSRENILRGLI---MSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILD 737
           EE +   +     SR +  R +I    SS                  ++++ S   + LD
Sbjct: 625 EELIPDDYQSSVDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLD 684

Query: 738 ILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADT 797
           ++            RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL+ A+ 
Sbjct: 685 LIEKMCFSNHYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANR 744

Query: 798 VIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 856
           +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM L   ++
Sbjct: 745 LILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVV 803

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
           complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  223 bits (569), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 117/323 (36%), Positives = 187/323 (57%), Gaps = 36/323 (11%)

Query: 380 PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
           P  ++G  LR +Q  G+NW+A L++ N NGILADEMGLGKT+QT++ +++L   +   GP
Sbjct: 664 PPLLRGT-LRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTIALLAYLACEKENWGP 722

Query: 440 HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHL-KFN 498
           HL++VP S +  W+  F ++APG   + Y G+   R            + +G   L  F+
Sbjct: 723 HLIIVPTSVLLNWEMEFKRFAPGFKVLSYYGSPQQR----------KEKRRGWNKLDAFH 772

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           V +T+Y+ ++ D+ +    KWQ++ +DEAH +KN +S+ +++L +F    RLL+TGTPLQ
Sbjct: 773 VCITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFKSTRWQALLNFNTRRRLLLTGTPLQ 832

Query: 559 NNIKELAALVNFLMP------GRFTIDQEIDFENQ-----------------DEQQEEYI 595
           NNI EL +L+ FLMP      G+ +   ++D   Q                 D++    +
Sbjct: 833 NNIAELWSLLYFLMPQTALENGKISGFADLDAFQQWFGKPVDKIIAANDSEHDDETRRTV 892

Query: 596 RDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG 655
             LH+ L+P++LRRLK DVEK +P+K E IL   LS  Q   Y + +++  +  T    G
Sbjct: 893 SKLHQVLRPYLLRRLKADVEKQMPAKYEHILYCRLSKRQRFLYDDFMSRAQTKATLA-SG 951

Query: 656 GHVSLLNVMNELKKASNHPYLFD 678
             +S++N + +L+K  NHP LF+
Sbjct: 952 NFMSIINCLMQLRKVCNHPDLFE 974

 Score =  139 bits (349), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 89/138 (64%), Gaps = 1/138 (0%)

Query: 722  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLL 781
            +GHR LIF+QM ++LDIL  +L+  G  + RLDG      R+I  + FN  D    VF+L
Sbjct: 1232 EGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNT-DPRITVFIL 1290

Query: 782  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 841
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YRF S+ T+E  +
Sbjct: 1291 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFASEHTIESNI 1350

Query: 842  LERARKKMILEYAIISLG 859
            L++A +K  L+  +I  G
Sbjct: 1351 LKKANQKRQLDNIVIQKG 1368

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  223 bits (568), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 192/324 (59%), Gaps = 37/324 (11%)

Query: 380  PSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP 439
            PS ++G  LR +Q  G+NW+A L++ + NGILADEMGLGKT+QT+S +++L   +   GP
Sbjct: 689  PSLLRGN-LRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKENWGP 747

Query: 440  HLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
            HL+VVP S +  W+  F ++APG   + Y G+   R   +  + +  P A       F+V
Sbjct: 748  HLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRK--EKRKGWNKPDA-------FHV 798

Query: 500  LLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQN 559
             + +Y+ +++D+ +    +WQ++ +DEAH +KN  S+ +++L +F    RLL+TGTPLQN
Sbjct: 799  CIVSYQLVVQDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQN 858

Query: 560  NIKELAALVNFLMP----------------------GRFTIDQEIDFEN---QDEQQEEY 594
            N+ EL +L+ FLMP                      GR  +D+ I+      QD++ ++ 
Sbjct: 859  NLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGR-PVDKIIETGQNFGQDKETKKT 917

Query: 595  IRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIK 654
            +  LH+ L+P++LRRLK DVEK +P+K E I+  +LS  Q   Y + +++  +  T    
Sbjct: 918  VAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLA-S 976

Query: 655  GGHVSLLNVMNELKKASNHPYLFD 678
            G  +S++N + +L+K  NHP LF+
Sbjct: 977  GNFMSIVNCLMQLRKVCNHPNLFE 1000

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 91/138 (65%), Gaps = 1/138 (0%)

Query: 722  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLL 781
            +GHR LIF+QM ++LD+L  +L+  G  + RLDG      R+I  + FN  DS   VF+L
Sbjct: 1261 NGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNT-DSRITVFIL 1319

Query: 782  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 841
            S+R+GGLGINL  ADTVI +DSDWNP  D Q   R HRIGQ   V +YRFVS+ T+E  +
Sbjct: 1320 SSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNI 1379

Query: 842  LERARKKMILEYAIISLG 859
            L++A +K  L+  +I  G
Sbjct: 1380 LKKANQKRQLDNVVIQEG 1397

>Scas_668.18
          Length = 875

 Score =  218 bits (555), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 163/544 (29%), Positives = 262/544 (48%), Gaps = 61/544 (11%)

Query: 364 NYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFL-----------WSKNDNG--- 409
           N P    PK  K+  +P  ++G +     +TG+    FL             +N+ G   
Sbjct: 249 NVPVVIDPKLTKI-LRPHQVEGVKFLYRCVTGLVMKDFLDAEAVNTGIVKTEQNNRGAYG 307

Query: 410 -ILADEMGLGKTVQTVSFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFDKW-APG 462
            I+ADEMGLGKT+Q ++ + W +  +   G  L+     V P S +  W     KW  PG
Sbjct: 308 CIMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPG 366

Query: 463 -LNCVYYMGNQ---ASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIK 518
            L+ +   G +   AS +       ++  QA G+  +K  VL+ +YE + ++   L +  
Sbjct: 367 TLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVK-PVLIISYETLRRNVDQLRNCD 425

Query: 519 WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTI 578
              +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG    
Sbjct: 426 VGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 485

Query: 579 DQEI------------DFENQDEQ---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTE 623
             E             D ++ DE+    EE ++ L   +  FI+RR    + K LP K E
Sbjct: 486 RSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYE 545

Query: 624 RILRVELSDVQTEYYKNIL-TKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEE 682
            ++ V L   Q + Y  +L +++ + +  G+ G     L  +  LKK  NHP L +  EE
Sbjct: 546 HVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQP--LKAIGVLKKLCNHPNLINLDEE 603

Query: 683 RVLSKFGD----------GHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQM 732
             +  F D          G KSR+   +    S                   ++++ S  
Sbjct: 604 --IDDFDDLEIPDEYNMQGSKSRDVQPQ---FSGKFAILERFLHKIKTESDDKIVLISNY 658

Query: 733 VRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINL 792
            + LD++      K  +  RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL
Sbjct: 659 TQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 718

Query: 793 MTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 852
           + A+ +I+ D DWNP AD QA+AR  R GQK    +YRF+S  ++EE++ +R   KM L 
Sbjct: 719 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLS 778

Query: 853 YAII 856
             ++
Sbjct: 779 SCVV 782

>Scas_669.20
          Length = 1397

 Score =  215 bits (547), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 121/329 (36%), Positives = 192/329 (58%), Gaps = 21/329 (6%)

Query: 379 QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG 438
           QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ++S ++ L       G
Sbjct: 637 QPKML-ACTLKEYQLKGLNWLASLYDQGINGILADEMGLGKTVQSISVLAHLAEKHNIWG 695

Query: 439 PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFN 498
           P+LVV P ST+  W     K+ P    + Y GN A R +++  +F+     +  K   F+
Sbjct: 696 PYLVVTPASTLHNWVNEITKFVPQFKILPYWGNAADRKVLR--KFWDRKNLRYTKDSPFH 753

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TGTP+Q
Sbjct: 754 VMITSYQMVVSDVTYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQ 813

Query: 559 NNIKELAALVNFLMPGRFTIDQEI------DFENQDEQQEEY----IRDLHKRLQPFILR 608
           NN++EL AL++F+MP  F    E       D E+  E   +     +R LH  L+PF+LR
Sbjct: 814 NNMQELWALLHFIMPSLFDSHDEFSEWFAKDIESHAEANTQLNHQQLRRLHMILKPFMLR 873

Query: 609 RLKKDVEKSLPSKTERILRVELSDVQTEYYKNI-LTKNYSALTSGIKGGHVS----LLNV 663
           R+KK+V+  L  K E  +  +L+  Q + Y+ +  T NY A+ +       S    L+N 
Sbjct: 874 RVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSTSNYDAIENAAGSDEFSSDQNLVNT 933

Query: 664 MNELKKASNHPYLFDNAEER---VLSKFG 689
           + + +K  NHP LF+ A+       +KFG
Sbjct: 934 VMQFRKVCNHPDLFERADINSPFAFTKFG 962

 Score =  136 bits (342), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 97/147 (65%), Gaps = 2/147 (1%)

Query: 722  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLL 781
            +GHRVLI+ QM +++D++ +YL+ +  N  RLDG+     RR  +  +  +    FVFLL
Sbjct: 1235 EGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLVHDWQTK-PEIFVFLL 1293

Query: 782  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 841
            STRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYR + + T+EE +
Sbjct: 1294 STRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERM 1353

Query: 842  LERARKKMILEYAIISLGVTDGNKISS 868
             +RA++K  ++  ++  G T  N + +
Sbjct: 1354 RDRAKQKEQVQQVVME-GKTQENNVKT 1379

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  214 bits (545), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 198/351 (56%), Gaps = 25/351 (7%)

Query: 379  QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG 438
            QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ++S ++ L       G
Sbjct: 714  QPKML-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEHHNIWG 772

Query: 439  PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFN 498
            P LVV P ST+  W     K+ P    + Y G+   R +++  +F+     +  +   F+
Sbjct: 773  PFLVVTPASTLHNWVNEISKFVPQFKILPYWGSANDRKVLR--KFWDRKNLRYSEKSPFH 830

Query: 499  VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
            V++T+Y+ ++ D S L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TGTP+Q
Sbjct: 831  VMITSYQMVVADASYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQ 890

Query: 559  NNIKELAALVNFLMPGR----------FTIDQEIDFENQDEQQEEYIRDLHKRLQPFILR 608
            NN++EL AL++F+MP            F+ D E   E      ++ +R LH  L+PF+LR
Sbjct: 891  NNMQELWALLHFIMPSLFDSHDEFNEWFSRDIESHAEGNSSLNQQQLRRLHMILKPFMLR 950

Query: 609  RLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSALT------SGIKGG--- 656
            R+KK+V+  L  K E  +  +L+  QT+ Y   K+ ++ NY A+       S I GG   
Sbjct: 951  RIKKNVQSELGDKIEIDVMCDLTQRQTKLYQVLKSQMSSNYDAIENAAAEGSDIAGGGNS 1010

Query: 657  HVSLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSG 707
              S++N + + +K  NHP LF+ A+      F    K+   I   +  S G
Sbjct: 1011 DQSIINAVMQFRKVCNHPDLFERADINSPFSFTSFGKTSSLISSSIATSGG 1061

 Score =  135 bits (339), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 95/146 (65%), Gaps = 2/146 (1%)

Query: 724  HRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLST 783
            HRVLI+ QM +++D++ +YL+ +  N  RLDG+     RR  + H    +   F+FLLST
Sbjct: 1312 HRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRR-DLVHDWQTNPEIFIFLLST 1370

Query: 784  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 843
            RAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYR + + T+EE + +
Sbjct: 1371 RAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVYRLLVRGTIEERMRD 1430

Query: 844  RARKKMILEYAIISLGVTDGNKISST 869
            RA++K  ++  ++  G T    I +T
Sbjct: 1431 RAKQKEQVQQVVME-GKTKDTNIQTT 1455

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  214 bits (544), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 122/330 (36%), Positives = 196/330 (59%), Gaps = 26/330 (7%)

Query: 379  QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQN- 437
            QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ++S ++ L  A R N 
Sbjct: 738  QPKML-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--ADRYNI 794

Query: 438  -GPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLK 496
             GP +VV P ST+  W     ++ P    + Y GN   R  ++  +F+     +  +   
Sbjct: 795  WGPFIVVTPASTLHNWVNEISRFVPQFKILPYWGNANDRKTLR--KFWDRKHLRYGRDAP 852

Query: 497  FNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 556
            F+V++T+Y+ ++ D S L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TGTP
Sbjct: 853  FHVMVTSYQMVVSDASYLQKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLLTGTP 912

Query: 557  LQNNIKELAALVNFLMPGR----------FTIDQEIDFENQDEQQEEYIRDLHKRLQPFI 606
            +QNN++EL AL++F+MP            F+ D E   E+  E  +E +R LH  L+PF+
Sbjct: 913  IQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAESNTELNQEQLRRLHMVLKPFM 972

Query: 607  LRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSALTSGIKGGHVS---- 659
            LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++  Y A+ +      V+    
Sbjct: 973  LRRIKKNVQSELGDKIEIDVLCDLTFRQAKLYQVLKSQVSGGYDAIENAAGNDDVTSDQK 1032

Query: 660  LLNVMNELKKASNHPYLFDNAEERVLSKFG 689
            L+N++ E +K  NHP LF+ A+  V+S F 
Sbjct: 1033 LVNLVMEFRKVCNHPDLFERAD--VMSPFS 1060

 Score =  130 bits (327), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 90/133 (67%), Gaps = 1/133 (0%)

Query: 724  HRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLST 783
            HRVLI+ QM +++D++ +YL+ +     RLDG+     RR  +  +  +  + F+FLLST
Sbjct: 1336 HRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRDLVHDWQTK-PDIFIFLLST 1394

Query: 784  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 843
            RAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYR + + T+EE + +
Sbjct: 1395 RAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERMRD 1454

Query: 844  RARKKMILEYAII 856
            RA++K  ++  ++
Sbjct: 1455 RAKQKEHVQQVVM 1467

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score =  208 bits (529), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 146/481 (30%), Positives = 235/481 (48%), Gaps = 38/481 (7%)

Query: 410 ILADEMGLGKTVQTVSFISWLIYARRQNGP----HLVVVPLSTMPAWQETFDKWAPGLNC 465
           I+ADEMGLGKT+Q ++ +  L+    Q  P     ++V P S +  W     KW  G + 
Sbjct: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWL-GPDA 385

Query: 466 VYYMGNQASRDLIQDYEFYTNPQ----AKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQF 521
           +  +     +  + +     + +    A+G+  +K  VL+ +YE + ++   L   K   
Sbjct: 386 LSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVK-PVLIISYETLRRNVENLKGCKVGL 444

Query: 522 LAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG------R 575
           +  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  PG      +
Sbjct: 445 MLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQ 504

Query: 576 FTIDQEI------DFENQDEQ---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERIL 626
           F  + EI      D +  D++    E  + +L + +  FI+RR    + K LP K E IL
Sbjct: 505 FRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHIL 564

Query: 627 RVELSDVQTEYYKNILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLS 686
            V LS +Q   Y++ +     A    +KG     L  +  LKK  NHP L D  +E   S
Sbjct: 565 FVNLSPMQKAIYEHFVRSREVAKL--MKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGS 622

Query: 687 K--FGDGHKS---------RENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRI 735
                D ++S         R ++      SS                  ++++ S   + 
Sbjct: 623 TNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQT 682

Query: 736 LDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTA 795
           LD++            RLDGT+   +R+  +D FN     +F+FLLS++AGG GINL+ A
Sbjct: 683 LDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGA 742

Query: 796 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 855
           + +I+ D DWNP AD QA+AR  R GQK    +YRF++  ++EE++ +R   KM L   +
Sbjct: 743 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCV 802

Query: 856 I 856
           +
Sbjct: 803 V 803

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
           complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  210 bits (535), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 120/329 (36%), Positives = 196/329 (59%), Gaps = 31/329 (9%)

Query: 379 QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQN- 437
           QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ++S ++ L  A R N 
Sbjct: 647 QPKIL-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL--AERYNI 703

Query: 438 -GPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLK 496
            GP +VV P ST+  W     K+ P    + Y GN   R +++   F+     +  K   
Sbjct: 704 WGPFIVVTPASTLHNWVNEIQKFVPDFKILPYWGNGNDRKILR--RFWDRKHLRYSKDAP 761

Query: 497 FNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTP 556
           F+V++T+Y+ I+ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TGTP
Sbjct: 762 FHVMITSYQMIVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTP 821

Query: 557 LQNNIKELAALVNFLMPGR----------FTIDQEIDFENQDEQQEEYIRDLHKRLQPFI 606
           +QN+++EL AL++F+MP            F+ D E   ++  +  ++ +R LH  L+PF+
Sbjct: 822 IQNSMQELWALLHFIMPSLFDSHDEFNDWFSKDIESHAQSNTQLNQQQLRRLHMILKPFM 881

Query: 607 LRRLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL------TSGIKGGH 657
           LRR+KK+V+  L  K E  +  +L+  Q + Y   K+ ++ +Y A+      +SG   G+
Sbjct: 882 LRRIKKNVQSELGDKIEIDVMCDLTHRQAKLYQVLKSQVSASYDAIENAASNSSGDDSGN 941

Query: 658 VSL-----LNVMNELKKASNHPYLFDNAE 681
           +SL     +N + E +K  NHP LF+ A+
Sbjct: 942 MSLSDSKIMNTVMEFRKVCNHPDLFERAD 970

 Score =  136 bits (342), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 98/149 (65%), Gaps = 2/149 (1%)

Query: 724  HRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLST 783
            HRVLI+ QM R++D++ +YL+ +     RLDG+     RR  +  +  + S+ F+FLLST
Sbjct: 1257 HRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDRRDLVHDWQTK-SDIFIFLLST 1315

Query: 784  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 843
            RAGGLGINL +ADTVI +DSDWNP  D QAM RAHR+GQ   V VYR + K T+EE + +
Sbjct: 1316 RAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVYRLLIKGTIEERMRD 1375

Query: 844  RARKKMILEYAIISLGVTDGNKISSTKKN 872
            RA++K  ++  ++  G T  N + +   N
Sbjct: 1376 RAKQKEHVQQVVME-GKTKENNVQTITAN 1403

>Kwal_14.1537
          Length = 842

 Score =  206 bits (523), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 146/480 (30%), Positives = 231/480 (48%), Gaps = 38/480 (7%)

Query: 410 ILADEMGLGKTVQTVSFISWLIYARRQNGP----HLVVVPLSTMPAWQETFDKWAP--GL 463
           I+ADEMGLGKT+Q ++ +  L+    Q  P     ++V P S +  W     KW     L
Sbjct: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419

Query: 464 NCVYYMGNQASRD---LIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQ 520
             +   G ++S +   + Q    +    A+G+  +K  VL+ +YE + ++   L + +  
Sbjct: 420 ASLPIDGKKSSLNNGTVAQAVRGWA--LARGRSVVK-PVLIISYETLRRNVEHLNNCEIG 476

Query: 521 FLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQ 580
            L  DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG      
Sbjct: 477 LLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 536

Query: 581 EI--DFEN-------------QDEQQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERI 625
           E   +FEN             +  +  E ++ L   +  FI+RR    + K LP K E +
Sbjct: 537 EFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHV 596

Query: 626 LRVELSDVQTEYYKNILTKNYSALTSGIKGGHVS--LLNVMNELKKASNHPYLF------ 677
           L V L   Q   Y+ +L      L   +K G      L  +  LKK  NHP L       
Sbjct: 597 LFVNLKPFQRSVYELMLKCRDVKL--AVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDV 654

Query: 678 DNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGH-RVLIFSQMVRIL 736
           + +E+ +   + +   S+          SG              +   +++I S   + L
Sbjct: 655 EGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTL 714

Query: 737 DILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTAD 796
           D++            RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL+ A+
Sbjct: 715 DVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGAN 774

Query: 797 TVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAII 856
            +I+ D DWNP AD QA+AR  R GQK    +YRF+   T+EE++ +R   KM L   ++
Sbjct: 775 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLSSCVV 834

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score =  206 bits (523), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 146/486 (30%), Positives = 231/486 (47%), Gaps = 51/486 (10%)

Query: 410 ILADEMGLGKTVQTVSFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFDKWAPGLN 464
           I+ADEMGLGKT+Q ++ + W +  +   G  L+     V P S +  W     KW  G N
Sbjct: 332 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWL-GPN 389

Query: 465 CVYYM-----------GNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRST 513
            +  +           GN      I  +      QA+G+  +K  VL+ +YE + ++   
Sbjct: 390 TLTPLAVDGKKSSMGGGNTTVSQAIHAWA-----QAQGRNIVK-PVLIISYETLRRNVDQ 443

Query: 514 LGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMP 573
           L +     +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL++F  P
Sbjct: 444 LKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNP 503

Query: 574 GRFTIDQEI--DFEN-------------QDEQQEEYIRDLHKRLQPFILRRLKKDVEKSL 618
           G      E   +FEN             +  + E  ++ L   +  FI+RR    + K L
Sbjct: 504 GLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYL 563

Query: 619 PSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFD 678
           P K E ++ V L  +Q E Y N L K+          G    L  +  LKK  NHP L +
Sbjct: 564 PCKYEHVIFVNLKPLQNELY-NKLIKSREVKKVVKGVGGSQPLRAIGILKKLCNHPNLLN 622

Query: 679 NAEERVLSKFGD--------GHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFS 730
             +E       +        G K+R+   +    S+                  ++++ S
Sbjct: 623 FEDEFDDEDDLELPDDYNMPGSKARDVQTK---YSAKFSILERFLHKIKTESDDKIVLIS 679

Query: 731 QMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGI 790
              + LD++      K  +  RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GI
Sbjct: 680 NYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGI 739

Query: 791 NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMI 850
           NL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM 
Sbjct: 740 NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMS 799

Query: 851 LEYAII 856
           L   ++
Sbjct: 800 LSSCVV 805

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  208 bits (529), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 116/327 (35%), Positives = 191/327 (58%), Gaps = 27/327 (8%)

Query: 379  QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG 438
            QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ++S ++ L       G
Sbjct: 698  QPKIL-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENHNIWG 756

Query: 439  PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFN 498
            P LVV P ST+  W     K+ P    + Y GN   R +++  +F+     +  K+  F+
Sbjct: 757  PFLVVTPASTLHNWVNEISKFLPQFKILPYWGNANDRKVLR--KFWDRKNLRYNKNAPFH 814

Query: 499  VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
            V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TGTP+Q
Sbjct: 815  VMVTSYQMVVTDANYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQ 874

Query: 559  NNIKELAALVNFLMPGRFTIDQEI------DFENQDEQ----QEEYIRDLHKRLQPFILR 608
            N+++EL AL++F+MP  F    E       D E+  E      ++ +R LH  L+PF+LR
Sbjct: 875  NSMQELWALLHFIMPSLFDSHDEFNEWFSKDIESHAEANTKLNQQQLRRLHMILKPFMLR 934

Query: 609  RLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSAL-----------TSGIK 654
            R+KK+V+  L  K E  +  +L+  Q + Y   K+ ++ NY A+           ++   
Sbjct: 935  RVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSQISTNYDAIENAATNDSTSNSASNS 994

Query: 655  GGHVSLLNVMNELKKASNHPYLFDNAE 681
            G   +L+N + + +K  NHP LF+ A+
Sbjct: 995  GSDQNLINAVMQFRKVCNHPDLFERAD 1021

 Score =  136 bits (343), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 66/135 (48%), Positives = 92/135 (68%), Gaps = 1/135 (0%)

Query: 722  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLL 781
            +GHRVLI+ QM +++D++ +YL+ +  N  RLDG+     RR  + H    +   FVFLL
Sbjct: 1314 EGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRR-DLVHDWQTNPEIFVFLL 1372

Query: 782  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 841
            STRAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYR + + T+EE +
Sbjct: 1373 STRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVRGTIEERM 1432

Query: 842  LERARKKMILEYAII 856
             +RA++K  ++  ++
Sbjct: 1433 RDRAKQKEQVQQVVM 1447

>Kwal_27.11388
          Length = 1334

 Score =  207 bits (526), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 198/344 (57%), Gaps = 23/344 (6%)

Query: 379 QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG 438
           QP  +    L+++QL G+NW+A L+ +  NGILADEMGLGKTVQ++S ++ L       G
Sbjct: 586 QPKLLTCT-LKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENYNIWG 644

Query: 439 PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFN 498
           P +VV P ST+  W     K+ P    + Y GN   R +++   F+   Q +  K   F+
Sbjct: 645 PFIVVTPASTLHNWVNEISKFLPDFKILPYWGNGNDRKILR--RFWDRKQFRYGKDAPFH 702

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           V++T+Y+ ++ D + L  +KWQ++ +DEA  +K+++SS +++L SF   NRLL+TGTP+Q
Sbjct: 703 VMVTSYQMVVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQ 762

Query: 559 NNIKELAALVNFLMPGRFTIDQEI------DFENQDEQ----QEEYIRDLHKRLQPFILR 608
           NN++EL AL++F+MP  F    E       D E+  +      ++ +R LH  L+PF+LR
Sbjct: 763 NNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAQSNTKLNQQQLRRLHMILKPFMLR 822

Query: 609 RLKKDVEKSLPSKTERILRVELSDVQTEYY---KNILTKNYSALTSGIKGGHVS----LL 661
           R+KK+V+  L  K E  +  +L+  Q + Y   K+ ++  Y A+ +       S    ++
Sbjct: 823 RIKKNVQSELGEKIEIDVMCDLTRRQHKLYQVLKSQMSAAYDAIENAAGSDEASSDQNIV 882

Query: 662 NVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILR--GLI 703
           N + + +K  NHP LF+  + R    F D  +S  +ILR  G+I
Sbjct: 883 NTVMQFRKVCNHPDLFEREDVRSPFAFTDFGRS-GSILREGGMI 925

 Score =  131 bits (329), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 89/133 (66%), Gaps = 1/133 (0%)

Query: 724  HRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLST 783
            HRVLI+ QM +++D++ +YLS +     RLDG+     RR  +  +  +    F+FLLST
Sbjct: 1187 HRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLEDRRDLVHDWQTK-PEIFIFLLST 1245

Query: 784  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 843
            RAGGLGINL  ADTVI +DSDWNP  D QAM RAHR+GQ   V VYR + + T+EE + +
Sbjct: 1246 RAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERMRD 1305

Query: 844  RARKKMILEYAII 856
            RA++K  ++  ++
Sbjct: 1306 RAKQKEQVQQVVM 1318

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score =  204 bits (519), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 149/488 (30%), Positives = 237/488 (48%), Gaps = 55/488 (11%)

Query: 410 ILADEMGLGKTVQTVSFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFDKW----- 459
           I+ADEMGLGKT+Q ++ + W +  +   G  L+     V P S +  W     KW     
Sbjct: 376 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434

Query: 460 -AP----GLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTL 514
            +P    G       G  +  + I+++      QA+G+  +K  VL+ +Y+ + ++   L
Sbjct: 435 LSPLAVDGKKSSLASGATSVAEAIKNWA-----QAQGRNIVK-PVLIISYDTLRRNVKQL 488

Query: 515 GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG 574
            + +   L  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG
Sbjct: 489 QNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 548

Query: 575 RFTIDQEI--DFE-------------NQDEQQEEYIRDLHKRLQPFILRRLKKDVEKSLP 619
                 E   +FE             N  +  E+ ++ L   +  FI+RR    + K LP
Sbjct: 549 LLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLP 608

Query: 620 SKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG-GHVSLLNVMNELKKASNHPYLFD 678
            K E ++ V L+  Q + Y N+L K+   +   +KG G    L  +  LKK  NHP L  
Sbjct: 609 CKYEHVIFVNLTPFQKQVY-NMLIKSRD-IKKVVKGDGGSQPLKAIGVLKKLCNHPDLIK 666

Query: 679 NAEERVLSKFGD----------GHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVLI 728
             EE  L  + D            KSR+   +    S                   ++++
Sbjct: 667 LDEE--LDNYNDLDIPDDYSIPTGKSRDVQTQ---FSGKFAILERFLHKIKTESDDKIVL 721

Query: 729 FSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGL 788
            S   + LD++      +     RLDGT+   +R+  +D FN  +  +F+FLLS++AGG 
Sbjct: 722 ISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGC 781

Query: 789 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKK 848
           GINL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   K
Sbjct: 782 GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMK 841

Query: 849 MILEYAII 856
           M L   ++
Sbjct: 842 MSLSSCVV 849

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  201 bits (510), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 160/283 (56%), Gaps = 30/283 (10%)

Query: 379 QPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNG 438
           QP  +K   L+ +QL G+NW+  L+    NGILADEMGLGKTVQ+++ +++ IY     G
Sbjct: 213 QPRLLKNCILKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAF-IYEMDTKG 271

Query: 439 PHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFN 498
           P LV  PLST+  W   F K+AP L  + Y G    ++     + +       K+H    
Sbjct: 272 PFLVTAPLSTLDNWMNEFAKFAPDLPVLKYYGTNGYKERSAKLKNFF------KQHGGTG 325

Query: 499 VLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQ 558
           +++T+YE IL+D   + S  W+FL VDE HRLKN    L + L     +NRLL+TGTPLQ
Sbjct: 326 IVITSYEIILRDTDLIMSQNWKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPLQ 385

Query: 559 NNIKELAALVNFLMPGRFTIDQEI-----DFEN----------------QDEQQEEYIRD 597
           NN+ EL +L+NF+MP  F  D EI     DF++                 DE Q+  I +
Sbjct: 386 NNLAELWSLLNFIMPDIFA-DFEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKNLISN 444

Query: 598 LHKRLQPFILRRLKKDVEKS-LPSKTERILRVELSDVQTEYYK 639
           LH  L+PF+LRRLKK V  + LP K E I+   ++  Q ++YK
Sbjct: 445 LHTILKPFLLRRLKKVVLANILPPKREYIINCPMTSAQEKFYK 487

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 101/161 (62%)

Query: 699 LRGLIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVP 758
           L  L+ +SG              +GH+VLI+SQ V +LD++ D+  +      R+DG+V 
Sbjct: 595 LETLLKTSGKLQILQKLIPPLISEGHKVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVN 654

Query: 759 SAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAH 818
           +  R+  ++ FN+      +FLLSTRA GLGINL+ ADTV++FDSDWNPQ DLQAM R H
Sbjct: 655 NETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCH 714

Query: 819 RIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLG 859
           RIGQ++ V+VYR    +T+E  +L RA  K  LE  +I +G
Sbjct: 715 RIGQESPVIVYRLCCDNTIEHVILTRAANKRNLERMVIQMG 755

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  196 bits (499), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 142/484 (29%), Positives = 238/484 (49%), Gaps = 63/484 (13%)

Query: 410 ILADEMGLGKTVQTVSFISWLIYAR-------RQNGPHL--------VVVPLSTMPAWQE 454
           +LADEMGLGKT+ T++ I W +  +        Q G  L        +V P++ +  W++
Sbjct: 317 LLADEMGLGKTLMTITLI-WTLLKQTPYPTIINQRGVTLAGEISKVLIVCPVTLIGNWKK 375

Query: 455 TFDKWAPGLNCVYYMG----NQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKD 510
            F KW P +N +  +     N  + D  Q   F   P+        + VL+  YE +L  
Sbjct: 376 EFKKWLP-MNRIGVLTLHSRNSPTEDKAQVRSFLKVPRT-------YQVLIVGYEKLLSI 427

Query: 511 RSTLGSIK--WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALV 568
           +  L + K     +  DE HRLKN +S + + L S  +  +++++GTP+QN+++E   ++
Sbjct: 428 KDELQNEKRNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDLEEFYTII 487

Query: 569 NFLMPG------RFTIDQEIDF---------ENQDEQQEEYIRD--LHKRLQPFILRRLK 611
           +F+ PG      RF  +  +           +NQ   ++  +R   L +  + FILRR  
Sbjct: 488 DFINPGILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKRFILRRTN 547

Query: 612 KDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTSGIKGGHVSLLN-VMNEL 667
           + +++ LP +T+ I+  + +  Q E +  ILT+   N+S +T     G ++L   + N  
Sbjct: 548 EILQQYLPPRTDLIIFCKPTAEQVEAFHKILTEGQLNFSNMTFNSSLGLITLFKKICNST 607

Query: 668 KKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVL 727
           +     PY     EER LS+      S      G   S                   +V+
Sbjct: 608 RLIKTDPYY----EER-LSQVQTSSTS------GKFTSGKLRILLSLLHELKTKTDEKVV 656

Query: 728 IFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGG 787
           + S   + LDI+  + S +G    RLDG+  +  R   +  FN  D + FVFLLS ++GG
Sbjct: 657 VISNYTQTLDIIEGHCSSEGYTSARLDGSTATKTRDQIVTSFN-NDPSIFVFLLSAKSGG 715

Query: 788 LGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARK 847
           +G+NL+ A  +++FD+DWNP  DLQAM+R HR GQ+    +YR V+   ++E++L+R   
Sbjct: 716 VGLNLIGASRLVLFDNDWNPSIDLQAMSRIHRDGQRRPCFIYRLVTTGCIDEKILQRQLM 775

Query: 848 KMIL 851
           K+ L
Sbjct: 776 KIAL 779

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  194 bits (492), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 145/496 (29%), Positives = 233/496 (46%), Gaps = 62/496 (12%)

Query: 410 ILADEMGLGKTVQTVSFISWLI----YARRQNGPHL------------VVVPLSTMPAWQ 453
           ILAD+MGLGKT+ T++ I  L+    +A +     L            +V P++ +  W+
Sbjct: 311 ILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGNWK 370

Query: 454 ETFDKWAPGLNCVYYMG----NQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILK 509
             F KW  GLN +  +     N    D I    F    +      L +  +LT  E +LK
Sbjct: 371 REFKKWL-GLNRIGILTLNPKNNVDMDKISVRNFIKVNRTYQVLILGYEKVLTVQEELLK 429

Query: 510 DRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVN 569
            +      K   L  DE HRLKN  S + + L S  +  ++++TGTP+QN++ E   +++
Sbjct: 430 QKD-----KLDLLICDEGHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNEFFTIID 484

Query: 570 FLMPGRF------------TIDQEIDFENQ-----DEQQEEYIRDLHKRLQPFILRRLKK 612
           F+ PG               I +  D  N+      EQ EE    L +  + FILRR   
Sbjct: 485 FVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKSNQLIEFTKRFILRRSNN 544

Query: 613 DVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGHVSLLNVMNELKKA-- 670
            + K LP KT+ IL    +  Q + +++I+      + +      + L+N+M ++  +  
Sbjct: 545 ILSKFLPPKTDIILFCRPTIEQIKAFRDIIENVRVDMNNITFNTSLGLINLMKKVCNSPS 604

Query: 671 --SNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDG--HRV 726
              N PY   N +  +   F   +KS          SSG                   +V
Sbjct: 605 LLCNDPYYQSNVDSNI---FTVSNKSN---------SSGKLTVLLELLLEIKATSPMEKV 652

Query: 727 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAG 786
           +I S   + LDI+   ++   ++  RLDG  P+ QR + ++ FN  + N F FLLS +AG
Sbjct: 653 VIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFN-NNPNIFGFLLSAKAG 711

Query: 787 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERAR 846
           G+G+NL+ A  +++FD+DWNP  DLQAM+R HR GQK    +YR ++   ++E++L+R  
Sbjct: 712 GVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDEKILQRQL 771

Query: 847 KKMILEYAIISLGVTD 862
            K  L    +S   +D
Sbjct: 772 MKHNLTRKFLSSNTSD 787

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  193 bits (490), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 138/484 (28%), Positives = 228/484 (47%), Gaps = 65/484 (13%)

Query: 410 ILADEMGLGKTVQTVSFISWLI--YARRQNGPH--------------LVVVPLSTMPAWQ 453
           +LADEMGLGKT  T++ I  L+  + R  + P               LVV P++ +  W+
Sbjct: 295 LLADEMGLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGNWK 354

Query: 454 ETFDKWAPGLNCVYYMG----NQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILK 509
           + F KW P +N +  +     N   +D      F        +    + VL+  YE +L 
Sbjct: 355 KEFIKWLP-MNRIGILTLSSKNTPEKDKNDVRNFL-------RVQRTYQVLILGYEKLLN 406

Query: 510 DRSTL--GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAAL 567
             S L     K   L  DE HRLKN+ S + + L   ++  ++++TGTP+QN++ E   +
Sbjct: 407 VFSELDQAKSKLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFYTI 466

Query: 568 VNFLMPGRF------------TIDQEIDFENQDEQQ-----EEYIRDLHKRLQPFILRRL 610
           +NF+ PG               I +  D  N+   Q     E   +DL +  + FILRR 
Sbjct: 467 INFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILRRT 526

Query: 611 KKDVEKSLPSKTERILRVELSDVQTEYYKNILT------KNYSALTSGIKGGHVSLLNVM 664
              +   LP +T+ ++  + +  Q + +  +L       +N S  +S         L ++
Sbjct: 527 SSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRVDFQNMSFNSS---------LGLI 577

Query: 665 NELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGH 724
              KK  N P L  +++    SK   G  +   I +                     D  
Sbjct: 578 TLFKKICNSPSLV-SSDSYFQSKVNGGTPALR-IAQSTTSGKLKVLMSLLHQIAHRSDNE 635

Query: 725 RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTR 784
           +V++ S   + LDI+G+ +S   +++ RLDG+ P+ +R   ++ FN   +  F FLLS +
Sbjct: 636 KVVVISNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQT-IFGFLLSAK 694

Query: 785 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 844
           +GG+G+NL+ A  +I+FD+DWNP  DLQAM+R HR GQK    +YR V+   ++E++ +R
Sbjct: 695 SGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIFQR 754

Query: 845 ARKK 848
              K
Sbjct: 755 QLMK 758

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  192 bits (488), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 150/490 (30%), Positives = 241/490 (49%), Gaps = 78/490 (15%)

Query: 410 ILADEMGLGKTVQTVSFISWLI----YARRQNGPH------------LVVVPLSTMPAWQ 453
           +LAD+MGLGKT+ +++ I  LI    +A + +               LVV P++ +  W+
Sbjct: 309 LLADDMGLGKTLMSITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWK 368

Query: 454 ETFDKWAPGLNC----VYYMGNQASRDL----IQDYEFYTNPQAKGKKHLKFNVLLTTYE 505
             F KW   LN     V  + ++ S D+    ++++          K    + VL+  YE
Sbjct: 369 REFGKW---LNLSRIGVLTLSSRNSPDMDKMAVRNFL---------KVQRTYQVLIIGYE 416

Query: 506 YILKDRSTLGSIK--WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKE 563
            +L     L   K     L  DE HRLKN  S +  +L S  +  +LL+TGTP+QN++ E
Sbjct: 417 KLLSVSEELEKNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQNDLNE 476

Query: 564 LAALVNFLMPG----------RFTI------------DQEIDFENQDEQQEEYIRDLHKR 601
              +++F+ PG          RF I            ++E+  E  +E+ +E I ++ KR
Sbjct: 477 FFTIIDFINPGILGSFASFKRRFIIPITRARDTANRYNEEL-LEKGEERSKEMI-EITKR 534

Query: 602 LQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTSGIKGGHV 658
              FILRR    +EK LP KT+ IL  +    Q   +K+IL     ++  LT     G +
Sbjct: 535 ---FILRRTNAILEKYLPPKTDIILFCKPYSQQILAFKDILQGARLDFGQLTFSSSLGLI 591

Query: 659 SLLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXX 718
           +LL      KK  N P L   ++    S   D  +S+++  R L  S             
Sbjct: 592 TLL------KKVCNSPGLV-GSDPYYKSHIKD-TQSQDSYSRSL-NSGKLKVLMTLLEGI 642

Query: 719 XXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFV 778
                 +V++ S   + LDI+ + +++ G++  RLDG++P+ QR   +  FN  +   F 
Sbjct: 643 RKGTKEKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFN-RNPAIFG 701

Query: 779 FLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVE 838
           FLLS ++GG+G+NL+    +I+FD+DWNP  DLQAM+R HR GQK    +YR V+   ++
Sbjct: 702 FLLSAKSGGVGLNLVGRSRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCID 761

Query: 839 EEVLERARKK 848
           E++L+R   K
Sbjct: 762 EKILQRQLMK 771

>Scas_718.40
          Length = 926

 Score =  187 bits (476), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 147/496 (29%), Positives = 231/496 (46%), Gaps = 58/496 (11%)

Query: 410 ILADEMGLGKTVQTVSFISWLI--------YARRQNGPHL--------VVVPLSTMPAWQ 453
           +LADEMGLGKT+ T++ I  L+         A  Q+G  L        VV P++ +  W+
Sbjct: 305 LLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGNWK 364

Query: 454 ETFDKWAPGLNCVYYMG----NQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILK 509
             F KW   LN +  +     N    D      F        +    F VL+  YE +L 
Sbjct: 365 REFAKWL-NLNRIGILTLSSRNTPEMDKTAVKNFL-------RVQRTFQVLVIGYEKLLS 416

Query: 510 DRSTLGSIK--WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAAL 567
               L   +     L  DE HRLKN  S +   L + ++  ++L++GTP+QN++ E   +
Sbjct: 417 VSEELHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFYTI 476

Query: 568 VNFLMPG----------RFT--IDQEIDFENQD-----EQQEEYIRDLHKRLQPFILRRL 610
           ++FL PG          RF   I +  D EN+      E  E   +++    + F LRR 
Sbjct: 477 IDFLNPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRKFTLRRT 536

Query: 611 KKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTSGIKGGHVSLLNVMNEL 667
              + K LP KT+ IL  + +  Q   + +IL++   +++ L+     G ++L       
Sbjct: 537 NAILSKYLPPKTDIILFCKPTQSQLLAFNDILSRSRIDFANLSFNSSLGLITLF------ 590

Query: 668 KKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGHRVL 727
           KK  N P L  + +    SK       +E   R L                   +  +V+
Sbjct: 591 KKICNSPTLIGD-DSYYQSKIRPDGVIQERYDRSLNSGKLKILMTLLEKIKGNTNNEKVV 649

Query: 728 IFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGG 787
           I S   + LDI+ + ++   +   RLDG+ P+ QR   ++ FN   S  F FLLS ++GG
Sbjct: 650 IVSNYTQTLDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNRNPS-IFAFLLSAKSGG 708

Query: 788 LGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARK 847
           +G+NL+ A  +I+FD+DWNP  DLQAM+R HR GQK H  +YR ++   ++E++L+R   
Sbjct: 709 VGLNLIGASRLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEKILQRQLM 768

Query: 848 KMILEYAIISLGVTDG 863
           K  L    +    T G
Sbjct: 769 KHSLSKKFLDSSYTTG 784

>Kwal_27.10513
          Length = 900

 Score =  185 bits (469), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 136/487 (27%), Positives = 233/487 (47%), Gaps = 67/487 (13%)

Query: 410 ILADEMGLGKTVQTVSFISWLIYAR---------RQNGPHL--------VVVPLSTMPAW 452
           +LADEMGLGKT+ T++ + W +  +          QNG  L        VV P++ +  W
Sbjct: 295 LLADEMGLGKTLMTITLV-WTLLKQTPIPSKANSSQNGISLQGLCNKILVVCPVTLIGNW 353

Query: 453 QETFDKWAPGLNCVYYMG-------NQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYE 505
           +  F KW   LN V  +G       + A +D +    F    +      + +  LL+  E
Sbjct: 354 KREFSKW---LN-VNRIGILTLSSKSNAEKDKLTVRNFLRVQRTYQVLVIGYEKLLSVTE 409

Query: 506 YILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELA 565
            +L+ +S     K   +  DE HRLKN +S   ++++S +V  ++++TGTP+QN++ E  
Sbjct: 410 ELLEAKS-----KIDLVICDEGHRLKNGQSKTLKAISSLEVPRKIMLTGTPIQNDLAEFF 464

Query: 566 ALVNFL---MPGRFT---------IDQEIDFENQ-----DEQQEEYIRDLHKRLQPFILR 608
            + +FL   + G F+         I +  D  N+      E+  +  ++L +  + F LR
Sbjct: 465 TIADFLNDGILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRDKTQELIEITKNFTLR 524

Query: 609 RLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTK---NYSALTSGIKGGHVSLLN-VM 664
           R  + + K LPSKT+ +L  + +  Q + ++  L+    ++S LT     G ++L   + 
Sbjct: 525 RTAETISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLDFSRLTFNSSLGLITLFKKIC 584

Query: 665 NELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGXXXXXXXXXXXXXXDGH 724
           N     S   Y  +  +     K       +  +L  L+                     
Sbjct: 585 NSPSLISQDSYYLETIKPNSEVKISAPDSGKLRVLMALL-----------DNLRKLSPQE 633

Query: 725 RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTR 784
           +V+I S   + LDI+ + +    ++F RLDG+  +  R   ++ FN   S  F FLLS +
Sbjct: 634 KVVIVSNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSFNTVPS-IFAFLLSAK 692

Query: 785 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 844
           +GG+G+NL+ A  +I+FD+DWNP  DLQAM+R HR GQK    +YR ++   ++E++ +R
Sbjct: 693 SGGMGLNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIYRLLTTGCIDEKIFQR 752

Query: 845 ARKKMIL 851
              K  L
Sbjct: 753 QLAKTSL 759

>Kwal_26.7123
          Length = 1081

 Score =  171 bits (433), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 116/327 (35%), Positives = 167/327 (51%), Gaps = 50/327 (15%)

Query: 388 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQN---GPHLVVV 444
           L+D+Q TGINW+  L+  N + ILADEMGLGKT Q ++F+S+L    +QN   GPHLVVV
Sbjct: 524 LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579

Query: 445 PLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTY 504
           P ST+  W   F+K+ P L    Y G+Q  R  ++D     + Q        ++V++TTY
Sbjct: 580 PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQ--------YDVIVTTY 631

Query: 505 EYILKDRSTLGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 561
                ++  +  +K   +  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN+
Sbjct: 632 NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691

Query: 562 KELAALVNFLMPGRFTIDQEIDFENQDEQQ---------------EEYIRDLHKRLQPFI 606
           KEL +L+ F+MP  F I ++ D      Q+               +E I      ++PFI
Sbjct: 692 KELMSLLEFIMPNLF-ISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFI 750

Query: 607 LRRLKKDVEKSLPSKTERILRVELSDVQTEYY----------KNILTKNYSALTSGI--- 653
           LRR K  V K LP K  +I   E+SDVQ   Y          K +L +     ++     
Sbjct: 751 LRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLREREEEGSAEEPRP 810

Query: 654 ---KGGHVSLLNVMNELKKASNHPYLF 677
               GG     N++  L+KA+ HP LF
Sbjct: 811 TKKNGGAQISKNLIMSLRKAALHPLLF 837

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/131 (43%), Positives = 87/131 (66%), Gaps = 1/131 (0%)

Query: 725  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTR 784
            +VL+FS   ++LDIL   L+   INF RLDG+     R+  ID F+ +D+   VF+LST+
Sbjct: 924  KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTK 982

Query: 785  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 844
            AGG GINL+ A+ VIIFD  +NP  D QA  R+HR+GQ   V +   ++++++EE++L+ 
Sbjct: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQL 1042

Query: 845  ARKKMILEYAI 855
            A+ K+ L+  I
Sbjct: 1043 AKNKLALDTYI 1053

>Scas_548.4
          Length = 1054

 Score =  157 bits (398), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 162/320 (50%), Gaps = 40/320 (12%)

Query: 388 LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLS 447
           L+D+Q TGINW+  L+    + ILAD+MGLGKT Q +SF ++L     + GPHLVVVP S
Sbjct: 496 LKDYQQTGINWLNLLYHNQMSCILADDMGLGKTCQVISFFAYLKQIN-EPGPHLVVVPSS 554

Query: 448 TMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYI 507
           T+  W   F K+ P L    Y G+Q  R  +++    T  Q        ++V++TTY   
Sbjct: 555 TLENWLREFQKFCPTLKIEPYYGSQNERADLREILERTAGQ--------YDVIVTTYNLA 606

Query: 508 LK---DRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKEL 564
                D S L + ++  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN++EL
Sbjct: 607 AGNKYDVSFLRNRQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTPLQNNLREL 666

Query: 565 AALVNFLMPGRFTIDQEIDFENQDEQQ---------------EEYIRDLHKRLQPFILRR 609
            +L+ F+MP  F I ++    +  +Q+               +E I      ++PFILRR
Sbjct: 667 MSLLEFIMPALF-ISKKESLASVFKQRAKTTDDNKGHNPLLVQEAIERAKTMMKPFILRR 725

Query: 610 LKKDVEKSLPSKTERILRVELSDVQTEYY----KNILTKNYSALTSGI--------KGGH 657
            K  V K LP+K  +I    + D+Q + Y    K ++      L   +        K   
Sbjct: 726 RKDQVLKHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMILDGTLPDDPKERAKIQS 785

Query: 658 VSLLNVMNELKKASNHPYLF 677
            S  N++  L+KA+ HP LF
Sbjct: 786 SSSSNLIMTLRKAALHPLLF 805

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (62%), Gaps = 1/131 (0%)

Query: 725  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTR 784
            +VLIFS   ++LDIL   LS     F RLDG+     R+  ID F  ED    +F+LST+
Sbjct: 892  KVLIFSLFTQVLDILELVLSELNYKFLRLDGSTQVNDRQSLIDKF-YEDDTIPIFILSTK 950

Query: 785  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 844
            AGG GINL+ A+ VIIFD  +NP  D QA  RAHR+GQ   V +   ++KD++EE++ + 
Sbjct: 951  AGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIFQL 1010

Query: 845  ARKKMILEYAI 855
            A+ K+ L+  I
Sbjct: 1011 AKNKLALDSHI 1021

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  145 bits (366), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/162 (47%), Positives = 101/162 (62%), Gaps = 5/162 (3%)

Query: 702 LIMSSGXXXXXXXXXXXXXXDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQ 761
           L+ +SG              +GH+VLIFSQ V +LD++ D+  +      R+DG++ +  
Sbjct: 29  LLQTSGKLQILQQLVPKLINEGHKVLIFSQFVNMLDLIEDWCELNDFQACRIDGSMDNEV 88

Query: 762 RRISIDHFNAEDS----NDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARA 817
           R+  I  FN++ +    ND VFLLSTRAGGLGINL  AD+V+IFDSDWNPQ DLQAM R 
Sbjct: 89  RQEQIGKFNSKTTDSHAND-VFLLSTRAGGLGINLTAADSVVIFDSDWNPQVDLQAMDRT 147

Query: 818 HRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIISLG 859
           HRIGQ   V+VYR    +TVE  +L RA  K  LE  +I +G
Sbjct: 148 HRIGQDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLVIQMG 189

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score =  100 bits (248), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 110/216 (50%), Gaps = 44/216 (20%)

Query: 378 AQPSFIKGGELRDFQLTGINWMAFLWSKND---NGILADEMGLGKTVQTVSFISWLIYAR 434
           AQP+ +    L  FQL G++WMA L   N+    G+LADEMG+GKTVQ +S    L++A 
Sbjct: 133 AQPAGLTV-PLLPFQLEGLHWMA-LQENNERYRGGVLADEMGMGKTVQMISL---LLHAN 187

Query: 435 RQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNP--QAKGK 492
           +  GP LVV P   +  W+   DK+  G          A R L+     +  P   A  +
Sbjct: 188 K--GPTLVVAPTVALIQWKNEIDKYTGG----------ALRSLV-----FHGPGRSAVSE 230

Query: 493 KHLKFNVLLTTYEY-----------------ILKDRSTLGSIKWQFLAVDEAHRLKNAES 535
           +    +V+LTTY                   +++++S L ++ +  + +DEAH +K+  S
Sbjct: 231 ELAAADVVLTTYAVLESVYRKQTQGFRRKAGVVREQSPLHAVDFYRVVLDEAHNIKDRSS 290

Query: 536 SLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL 571
               S+N+ +   R  +TGTPLQN I E+ +L+ FL
Sbjct: 291 GTARSVNALRAVRRWCLTGTPLQNRIGEMYSLIRFL 326

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 727 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAG 786
           ++FSQ   +LD++   L   G    +L G++   QR  +I++F  ++ +  VFL+S +AG
Sbjct: 597 IVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPTQRAETINYF-MDNVHCEVFLVSLKAG 655

Query: 787 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERAR 846
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + RF  +D++E  ++E   
Sbjct: 656 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQHRPVKITRFCIEDSIESRIIELQE 715

Query: 847 KKMILEYAIISLGVTDG 863
           KK  + +A  +LG  +G
Sbjct: 716 KKANMIHA--TLGQDEG 730

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/260 (30%), Positives = 127/260 (48%), Gaps = 55/260 (21%)

Query: 339 VKMAPEQVKEFQNRTNSKIM---PQNSSNYPANQR-PKFEKLDAQPSFIKGGELRDFQLT 394
           +K+ P Q      RT  ++    P+ ++ +P  Q  PK+E   A      G +L  FQL 
Sbjct: 178 IKLTPYQ------RTTLRLFEHHPELANVFPDLQNAPKYEPHRAPQPADMGVKLLPFQLE 231

Query: 395 GINWMAFLWSKNDN----GILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMP 450
           G++WM    S+ D+    G+LADEMG+GKT+QT++    L+   R   P LVV P   + 
Sbjct: 232 GLHWML---SQEDSIYNGGVLADEMGMGKTIQTIA----LLMNDRSKKPSLVVAPTVALM 284

Query: 451 AWQETFDKWAPG-LNCVYYMGNQASRDL-IQDYEFYTNPQAKGKKHLKFNVLLTTYEYI- 507
            W+   ++   G L+   Y G  ASR + I D +               +V+LTTY  + 
Sbjct: 285 QWKNEIEQHTNGALSTYIYHG--ASRTINIHDLK-------------DIDVILTTYSVLE 329

Query: 508 ----------------LKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLL 551
                           +K++S L +I +    +DEAH +K+  S+   ++N+ K   R  
Sbjct: 330 SVFRKQNYGFRRKNGLVKEKSLLHNIDFYRAILDEAHNIKDRTSNTSRAVNALKTQKRWC 389

Query: 552 ITGTPLQNNIKELAALVNFL 571
           ++GTPLQN I E+ +L+ FL
Sbjct: 390 LSGTPLQNRIGEMYSLIRFL 409

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 1/130 (0%)

Query: 727 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAG 786
           ++FSQ   +LD++   L   G    +L G++   QR  +I +F  ++    VFL+S +AG
Sbjct: 681 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDQTIKYF-MDNIECEVFLVSLKAG 739

Query: 787 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERAR 846
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + RF  +D++E  ++E   
Sbjct: 740 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQE 799

Query: 847 KKMILEYAII 856
           KK  + +A I
Sbjct: 800 KKANMIHATI 809

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 88/144 (61%), Gaps = 3/144 (2%)

Query: 725  RVLIFSQMVRILDILGDYLSIK-GINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLST 783
            +++IFSQ     +ILG ++    G+NF R DG++ S+QR   I+ F  +D+N  V L+S 
Sbjct: 1448 KLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESF-YQDNNYRVMLISM 1506

Query: 784  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 843
            +AG  G+ L  A+ VI+ D  WNP  + QAM R HRI Q+  V V+R + K +VE+ ++E
Sbjct: 1507 KAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVEDRIVE 1566

Query: 844  -RARKKMILEYAIISLGVTDGNKI 866
             + +KK ++  A+    + + NK+
Sbjct: 1567 LQNKKKTLVNLAMDPTQIREVNKL 1590

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 78/382 (20%), Positives = 157/382 (41%), Gaps = 99/382 (25%)

Query: 392  QLTGINWMAFLW-SKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPH--------LV 442
            Q  G+ W+  +  S    G+LAD+MGLGKTVQ+++ +         N P         LV
Sbjct: 923  QRQGLRWLVSMEKSSKRGGLLADDMGLGKTVQSLALL-------MANKPEPKSAIKTTLV 975

Query: 443  VVPLSTMPAWQ-ETFDKWAPGLNC--VYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNV 499
            V P++ +  W+ E   K    +N   V + G + +    + +          K   ++++
Sbjct: 976  VAPVAVLRVWKDEVAVKIKKDVNVKVVIFGGGENNSSKFRSW----------KDLAEYDI 1025

Query: 500  LLTTYEYILKDRSTLGSIKW-----------------------------------QF--L 522
            +L +Y+ +  +      + W                                   +F  +
Sbjct: 1026 VLVSYQTLASEFKKHWPLSWKNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRV 1085

Query: 523  AVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL-MP-----GRF 576
             +DEA  +KN ++   ++  +     R  ++GTP+QNNI EL +L+ FL +P      +F
Sbjct: 1086 ILDEAQNIKNKKTQAAKACCTISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKF 1145

Query: 577  ------TIDQEIDFENQDEQQEEYIRDLHKRLQPFILRRLK------KDVEKSLPSKTER 624
                   ++ +  ++  D +++  ++ +   L+  +LRR K      K + + LP K  +
Sbjct: 1146 HSDIGAVLNTKKPYDYNDSERQRAMKKVQVLLRAIMLRRTKTSQIDGKPILQ-LPEKHLK 1204

Query: 625  ILRVELSDVQTEYYKNILTKNYSALTSGI-----KGGHVSLLNVMNELKKASNHPYLFDN 679
                +L   + E+Y+ + +K+       +     +G + S+L ++  L++A  H  L   
Sbjct: 1205 ESANKLEGDELEFYQALESKSRDKAKKMLESKQKQGAYSSILTLLLRLRQACLHSELV-- 1262

Query: 680  AEERVLSKFGDGHKSRENILRG 701
                   K G+ +     I+ G
Sbjct: 1263 -------KIGESNAKSSKIING 1277

>Scas_591.10
          Length = 772

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 113/236 (47%), Gaps = 55/236 (23%)

Query: 360 QNSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMA------FLWSKNDNGILAD 413
           +NSS Y A + P+ E +  +        L  FQL G++W+       F       G+LAD
Sbjct: 146 KNSSPYVAIRAPQPEGMSIK--------LLPFQLEGLHWLIQQEEGIF-----KGGVLAD 192

Query: 414 EMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPG-LNCVYYMGNQ 472
           EMG+GKT+QT++ +   +  R    P LVV P   +  W+   ++   G L    + G  
Sbjct: 193 EMGMGKTIQTIALLMNDLTKR----PSLVVAPTVALMQWKNEINQHTDGKLKVYMFHGTS 248

Query: 473 ASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEY-----------------ILKDRSTLG 515
            + D+              K   +++V+LTTY                   ++K+ S L 
Sbjct: 249 KNIDI--------------KTLSEYDVVLTTYAVLESVFRKQNYGFKRKHGVVKELSVLH 294

Query: 516 SIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL 571
           +I++  + +DEAH +K+ +S+   ++N+ K   R  +TGTPLQN I E+ +L+ FL
Sbjct: 295 NIEFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLTGTPLQNRIGEMYSLIRFL 350

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (54%), Gaps = 5/133 (3%)

Query: 727 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHF--NAEDSNDFVFLLSTR 784
           ++FSQ   +LD++   L   G    +L G++   QR  +I +F  N E     VFL+S +
Sbjct: 623 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDETIKYFMNNIECE---VFLVSLK 679

Query: 785 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 844
           AGG+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + RF  +D++E  ++E 
Sbjct: 680 AGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIEL 739

Query: 845 ARKKMILEYAIIS 857
             KK  + +A I+
Sbjct: 740 QEKKANMIHATIN 752

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 104/213 (48%), Gaps = 43/213 (20%)

Query: 387 ELRDFQLTGINWMAFLWSKNDN----GILADEMGLGKTVQTVSFISWLIYARRQNGPHLV 442
           +L  FQL G++W   L S+ ++    G+LADEMG+GKT+QT++    L+       P LV
Sbjct: 183 KLLPFQLEGLHW---LISQEESIYAGGVLADEMGMGKTIQTIA----LLMNDLTKSPSLV 235

Query: 443 VVPLSTMPAWQETFDKWAPG-LNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLL 501
           V P   +  W+   ++   G L    Y G   + D I+D + Y             +V+L
Sbjct: 236 VAPTVALMQWKNEIEQHTKGQLKIYIYHGASRTTD-IKDLQGY-------------DVVL 281

Query: 502 TTYEYI-----------------LKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSF 544
           TTY  +                  K  S L +I +  + +DEAH +K+ +S+   ++N+ 
Sbjct: 282 TTYAVLESVFRKQNYGFRRKNGLFKQPSVLHNIDFYRVILDEAHNIKDRQSNTARAVNNL 341

Query: 545 KVANRLLITGTPLQNNIKELAALVNFLMPGRFT 577
           K   R  ++GTPLQN I E+ +L+ FL    FT
Sbjct: 342 KTQKRWCLSGTPLQNRIGEMYSLIRFLNINPFT 374

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (54%), Gaps = 1/131 (0%)

Query: 727 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAG 786
           ++FSQ   +LD++   L   G    +L G++   QR  +I +F      + VFL+S +AG
Sbjct: 641 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDETIKYFMNNIQCE-VFLVSLKAG 699

Query: 787 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERAR 846
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + RF  +D++E  ++E   
Sbjct: 700 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQE 759

Query: 847 KKMILEYAIIS 857
           KK  + +A I+
Sbjct: 760 KKANMIHATIN 770

>Kwal_14.1868
          Length = 1357

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 91/378 (24%), Positives = 164/378 (43%), Gaps = 87/378 (23%)

Query: 373  FEKLDAQPSFIKGGELRDFQLT---------GINWMAFLWSKN-DNGILADEMGLGKTVQ 422
             E L    + I+G EL   ++T         G++W+  +   N   G+LAD+MGLGKTVQ
Sbjct: 651  LEGLKTAETEIEGEELTPPEMTINLMKHQRQGLHWLLTVEKSNRKGGLLADDMGLGKTVQ 710

Query: 423  TVSFISWLIYARRQNGPHLVVVPLSTMPAWQ---ETFDKWAPGLNCVYYMGNQASRDLIQ 479
             ++ +            +L+V P++ +  WQ   +T  K   GL  + Y G   ++  ++
Sbjct: 711  AIALMLANKSGVENCKTNLIVAPVAVLRVWQAEVKTKVKKTSGLKVLIYGGGNGAK--VE 768

Query: 480  DYEFYTNPQAKGKKHLKFNVLLTTYEYI-----------------------LKDRSTLGS 516
            +Y          +  L+ +V+L +Y+ +                       + D   L S
Sbjct: 769  NY----------RSLLRHDVVLVSYQTLASELKKHWPARLSEDSEEAKITDIPDLKALNS 818

Query: 517  IK-----W--------QF--LAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 561
            +K     W        +F  + +DEA  +KN ++   ++  +     R  ++GTP+QNNI
Sbjct: 819  LKERKEYWSPFYCNESKFYRIILDEAQNIKNKKTQSAKACCTLDATYRWALSGTPMQNNI 878

Query: 562  KELAALVNFLMPGRFTIDQEI-------------DFENQDEQQEEYIRDLHKRLQPFILR 608
             EL +L+ FL    +  +Q+              D+++ D QQ   I+ +   L+  +LR
Sbjct: 879  MELYSLIRFLKISPYKREQKFKLDIGNPLGKATNDYDSHDRQQA--IKKVQVLLRAIMLR 936

Query: 609  RLK--KDVEKSLPSKTERILRVE---LSDVQTEYYKNILTKNYSA----LTSGIKGGHVS 659
            R K  K   K +    E+I+      L   + ++Y ++  KN       L +  KG + S
Sbjct: 937  RTKDSKIDGKPILELPEKIITNREDVLQGAELQFYSDLEAKNQKKVEKLLNNRAKGSYSS 996

Query: 660  LLNVMNELKKASNHPYLF 677
            +L ++  L++A  HP L 
Sbjct: 997  ILTLLLRLRQACCHPELV 1014

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 70/125 (56%), Gaps = 2/125 (1%)

Query: 725  RVLIFSQMVRILDILGDYLSIK-GINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLST 783
            ++++FSQ     D+L  ++    G  + R DG++ S  R  +I+ F        + L+S 
Sbjct: 1196 KIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATIEEF-YRSLERRILLISM 1254

Query: 784  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 843
            +AG  G+ L  A+ VI+ D  WNP  + QAM R +RI Q   V V+R + K++VE+ +LE
Sbjct: 1255 KAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRDVQVHRLLVKNSVEDRILE 1314

Query: 844  RARKK 848
              +KK
Sbjct: 1315 LQKKK 1319

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 104/209 (49%), Gaps = 37/209 (17%)

Query: 388 LRDFQLTGINWMAFLWSKNDNG-ILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPL 446
           L  FQL G++W+      + NG +LADEMG+GKT+QT++    L+ +     P LVV P 
Sbjct: 194 LLPFQLEGLHWLQQQEESDYNGGVLADEMGMGKTIQTIA----LLMSDITRKPSLVVAPT 249

Query: 447 STMPAWQETFDKWAPGLNCVY-YMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYE 505
             +  W+   ++       VY Y G   + +L  D++               +V+LTTY 
Sbjct: 250 VALMQWKNEIEQHTNKKLSVYMYHGANRTNNL-GDFK-------------DVDVILTTYA 295

Query: 506 YI-----------------LKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN 548
            +                 +K++S L SI +  + +DEAH +K+  S+  +++NS +   
Sbjct: 296 VLESVYRKQVYGFKRKAGTVKEKSLLHSINFYRVILDEAHNIKDRTSNTAKAVNSLQTKK 355

Query: 549 RLLITGTPLQNNIKELAALVNFLMPGRFT 577
           R  ++GTPLQN I E+ +L+ FL    FT
Sbjct: 356 RWCLSGTPLQNRIGEMYSLIRFLNIEPFT 384

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 74/131 (56%), Gaps = 1/131 (0%)

Query: 727 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAG 786
           ++FSQ   +LD++   L   G    +L G++   QR  +I +F  E+ +  VFL+S +AG
Sbjct: 651 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYF-MENIHCEVFLVSLKAG 709

Query: 787 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERAR 846
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + RF  +D++E  ++E   
Sbjct: 710 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIELQE 769

Query: 847 KKMILEYAIIS 857
           KK  + +A I+
Sbjct: 770 KKASMIHATIN 780

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 95/346 (27%), Positives = 150/346 (43%), Gaps = 58/346 (16%)

Query: 392  QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMP 450
            Q  G+ W+     SK   G+LAD+MGLGKTVQ ++ +     +      +L+V P+S + 
Sbjct: 737  QRLGLQWLLNAETSKRKGGLLADDMGLGKTVQAIALMLANRSSNESKKTNLIVAPVSVLR 796

Query: 451  AWQ---ETFDKWAPGLNCVYYMGNQA----SRDLIQDYEF----YTNPQAKGKKH----L 495
             W+   ET  K +   N   Y G       S D + +++     Y     + KKH    L
Sbjct: 797  VWKGEIETKIKESSDFNSAIYGGVNGIKFRSWDKLSNFDVILVSYQTLANELKKHWPERL 856

Query: 496  K--------------FNVLLTTYEY---ILKDRSTLGSIKWQFLAVDEAHRLKNAESSLY 538
            K               N L T  EY      D ST   I      +DE   +KN ++   
Sbjct: 857  KTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRI-----ILDEGQNIKNMKTQAA 911

Query: 539  ESLNSFKVANRLLITGTPLQNNIKELAALVNFL-MPG-----RFTIDQEIDFEN-----Q 587
            ++  +     R +++GTP+QNN++EL +L+ FL +P      RF  D    F N      
Sbjct: 912  KACCTVNSVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDIGRPFSNLKQNYD 971

Query: 588  DEQQEEYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTEYYKNIL 642
             E +++ I+ +   L+  +LRR K D         LP K          D + E+YK + 
Sbjct: 972  SESRKQAIKKVRVLLRAIMLRRSKTDKIDGVPILELPPKNVNAQETTFKDDELEFYKALE 1031

Query: 643  TKNYS----ALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERV 684
             KN       L S ++G + S+L ++  L++A  HP L    E++ 
Sbjct: 1032 HKNKQLAKKLLESKVQGNYSSVLTLLLRLRQACCHPELVILGEKKA 1077

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 83/149 (55%), Gaps = 3/149 (2%)

Query: 722  DGHRVLIFSQMVRILDILGDYLSIK-GINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFL 780
            D  +++IFSQ    LD+L   L+ +  I+  +  G + +  R   I  F +E+ +  V L
Sbjct: 1249 DSEKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYSEE-DKRVLL 1307

Query: 781  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEE 840
            +S +AG  G+ L  A+ V+I D  WNP  + QA  R +RI Q   V V+R   K++VE+ 
Sbjct: 1308 ISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLFIKNSVEDR 1367

Query: 841  VLERAR-KKMILEYAIISLGVTDGNKISS 868
            +LE  + K+ +++ A+ +  + D NK+ +
Sbjct: 1368 ILELQKLKRDMVDAAMDAKKIKDINKLGT 1396

>Kwal_23.3660
          Length = 768

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 75/131 (57%), Gaps = 1/131 (0%)

Query: 727 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAG 786
           ++FSQ   +LD++   L   G    +L G++   QR  +I +F  ++++  VFL+S +AG
Sbjct: 619 IVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYF-MDNTHCEVFLVSLKAG 677

Query: 787 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERAR 846
           G+ +NL  A  V I D  WNP  + Q+  R HRIGQ   V + RF  +D++E  ++E   
Sbjct: 678 GVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIESRIIELQE 737

Query: 847 KKMILEYAIIS 857
           KK  + +A I+
Sbjct: 738 KKANMIHATIN 748

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 108/230 (46%), Gaps = 45/230 (19%)

Query: 361 NSSNYPANQRPKFEKLDAQPSFIKGGELRDFQLTGINWMAFL-WSKNDNGILADEMGLGK 419
           N++ Y A++ P+   L  +        L  FQL G++W+     S  + G+LADEMG+GK
Sbjct: 143 NATPYKAHRAPQPNGLTIK--------LLPFQLEGLHWLISQEHSVYNGGVLADEMGMGK 194

Query: 420 TVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQ 479
           T+QT++    L+       P LVV P   +  W+   ++   G               ++
Sbjct: 195 TIQTIA----LLMNDVTKKPSLVVAPTVALMQWKNEIEQHTGGK--------------LK 236

Query: 480 DYEFYTNPQAKGKKHLK-FNVLLTTYEY-----------------ILKDRSTLGSIKWQF 521
            + F+   +       K  +VLLTTY                   + K+ S L ++ +  
Sbjct: 237 THIFHGANRTSNVGEFKDVDVLLTTYAVLESVFRKQNYGFKRKSGVYKEPSVLHNMNFYR 296

Query: 522 LAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL 571
           + +DEAH +K+ +S+  +++NS     +  +TGTPLQN I E+ +L+ FL
Sbjct: 297 VILDEAHNIKDRQSNTAKAVNSLLTEKKWCLTGTPLQNRIGEMYSLIRFL 346

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 80/133 (60%), Gaps = 3/133 (2%)

Query: 725  RVLIFSQMVRILDILGDYLS-IKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLST 783
            ++++FSQ     DIL  ++  +  +++ R DGT+    R   I+ F  E  N+ + L+S 
Sbjct: 1420 KLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYRE-KNERLLLISM 1478

Query: 784  RAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLE 843
            +AG  G+ L  A+ VI+ D  WNP  + QAM R +RI Q+  V ++R + K+T+E+ ++E
Sbjct: 1479 KAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDRIVE 1538

Query: 844  -RARKKMILEYAI 855
             + RK+ ++E A+
Sbjct: 1539 LQNRKRTLVENAM 1551

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 144/350 (41%), Gaps = 79/350 (22%)

Query: 392  QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMP 450
            Q  G+ W+     SK   G+LAD+MGLGKTVQ ++ +     A      +LVV P++ + 
Sbjct: 900  QRQGLYWLLKTESSKFKGGLLADDMGLGKTVQAIALMLANRSADSTCKTNLVVGPVAVLR 959

Query: 451  AWQETFD---KWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYI 507
             W +  +   K     + + Y G    +  +++++   N          ++V+L +Y+ +
Sbjct: 960  VWHDEINTKVKKQAQFSVMIYGGFGGKK--VENFKAMHN----------YDVVLVSYQTL 1007

Query: 508  -----------LKDRSTLG-------SIK-----------WQ----------FLAVDEAH 528
                       L+  S  G       SIK           W            + +DEA 
Sbjct: 1008 AVEFKKHWPARLQGTSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQ 1067

Query: 529  RLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI------ 582
             +KN ++   ++  +     R  ++GTP+QNNI EL +L+ FL    +  +Q+       
Sbjct: 1068 NIKNKQTQAAKACCTLNGTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGN 1127

Query: 583  -------DFENQDEQQEEYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVEL 630
                   DF++ D ++   ++ +   L+  +LRR K           LP+K  R     L
Sbjct: 1128 ALLSRGGDFDSMDTKRA--LKKVRVLLRAIMLRRAKTSQINGQPILELPAKHIRKKEDIL 1185

Query: 631  SDVQTEYYKNI---LTKNYSALTSGIKGGHVS-LLNVMNELKKASNHPYL 676
                 E+YK++         AL +  K    S +L ++  L++A  H  L
Sbjct: 1186 DGQDLEFYKSLEHETAIQARALLNERKASSSSNILTLLLRLRQACCHQEL 1235

>Scas_721.100
          Length = 1137

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 76/136 (55%), Gaps = 6/136 (4%)

Query: 723  GHRVLIFSQMVRILDILGDYLS----IKGINFQRLDGTVPSAQRRISIDHFNAED-SNDF 777
            G +V+IFSQ    LDIL D L            + DG +   +R   +  F  +D S   
Sbjct: 980  GEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLKERSTVLQDFQIKDLSRQK 1039

Query: 778  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 837
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N+V V RF+ ++++
Sbjct: 1040 ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHRIGQTNNVKVVRFIIENSI 1099

Query: 838  EEEVLE-RARKKMILE 852
            EE++L  + RK+ I E
Sbjct: 1100 EEKMLRIQERKRTIGE 1115

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 134/305 (43%), Gaps = 68/305 (22%)

Query: 409 GILADEMGLGKTVQTVSFISWLIYAR---------------RQNGPHL---------VVV 444
           GIL+DEMGLGKT+ T++ I    Y                 R+  PHL         +VV
Sbjct: 502 GILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIVV 561

Query: 445 PLSTMPAWQETFDKWAPGLNC---VYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLL 501
           P+S +  W   F+K     +    +YY GN +S             +   K H    V++
Sbjct: 562 PMSLLNQWNTEFNKANNSSDMRSEIYYGGNVSSLK-----------KLLTKTHNPPTVVI 610

Query: 502 TTYEYI----------------LKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFK 545
           TTY  +                ++  S L S+ +  + +DE H ++N  +   +++    
Sbjct: 611 TTYGIVQSEWSKIFKKQNIGAEIQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDLT 670

Query: 546 VANRLLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDEQQEEYIRDLH 599
              + ++TGTP+ N + +L +LV FL        G + +     FEN++ +Q   +  ++
Sbjct: 671 SKCKWVLTGTPIINRLDDLYSLVRFLKLEPWSQIGYWKMFVSTPFENKNFKQAFDV--VN 728

Query: 600 KRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI 653
             L+P +LRR K  KD++      LP K   + R++LS  Q   YK +L +   ++  G+
Sbjct: 729 AILEPVLLRRTKQMKDIDGKPLVELPPKEVIVERLKLSKAQNAVYKYLLDRAEQSVILGL 788

Query: 654 KGGHV 658
             G +
Sbjct: 789 ARGDL 793

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 723  GHRVLIFSQMVRILDILGDYL----SIKGINFQRLDGTVPSAQRRISIDHFNAED-SNDF 777
            G +V+IFSQ    LDIL   L    S       + DG +   +R   +  F  +D S   
Sbjct: 1012 GEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSLKERTSVLADFAVKDYSRQK 1071

Query: 778  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 837
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N V V RF+ +D++
Sbjct: 1072 ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLHRIGQTNSVKVMRFIIQDSI 1131

Query: 838  EEEVLERARKKMILEYAI 855
            EE++L    KK  +  A+
Sbjct: 1132 EEKMLRIQEKKRTIGEAM 1149

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 87/339 (25%), Positives = 143/339 (42%), Gaps = 78/339 (23%)

Query: 409 GILADEMGLGKTVQTVSFISWLIY---------------ARRQNGPH------------- 440
           GIL+DEMGLGKTV   S +    +               A   N P              
Sbjct: 528 GILSDEMGLGKTVAAYSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKPYASKT 587

Query: 441 -LVVVPLSTMPAWQETFDKW--APGL-NCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLK 496
            L+VVP+S +  W   F K   +P + + VYY GN +S                 K    
Sbjct: 588 TLIVVPMSLLTQWSNEFTKANNSPDMYHEVYYGGNVSSLK-----------TLLTKTKTP 636

Query: 497 FNVLLTTYEYI----------------LKDRSTLGSIKWQFLAVDEAHRLKNAESSLYES 540
             V+LTTY  +                +   S L S+ +  + +DE H ++N  +   ++
Sbjct: 637 PTVVLTTYGIVQNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSKA 696

Query: 541 LNSFKVANRLLITGTPLQNNIKELAALVNFLM--PGR----FTIDQEIDFENQDEQQEEY 594
           + + +   + ++TGTP+ N + +L +LV FL   P R    +       FE+++ +Q   
Sbjct: 697 VMALQGKCKWVLTGTPIINRLDDLYSLVKFLELDPWRQINYWKTFVSTPFESKNYKQAFD 756

Query: 595 IRDLHKRLQPFILRRLKKDVEK------SLPSKTERILRVELSDVQTEYYKNILTKNYSA 648
           +  ++  L+P +LRR K+  +K       LP K   I R+  S  Q   YK +L K   +
Sbjct: 757 V--VNAILEPVLLRRTKQMKDKDGKPLVELPPKEVVIKRLPFSKSQDLLYKFLLDKAEVS 814

Query: 649 LTSGIKGG-----HVSLLNVMNELKKASNHPYLFDNAEE 682
           + SGI  G     + ++L  +  L++   HP L  + +E
Sbjct: 815 VKSGIARGDLLKKYSTILVHILRLRQVCCHPGLIGSQDE 853

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 723  GHRVLIFSQMVRILDILGDYL----SIKGINFQRLDGTVPSAQRRISIDHFNAED-SNDF 777
            G +V++FSQ    LDIL   L    S   +   + DG +   +R   ++ F  +D +   
Sbjct: 993  GEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLKERTAVLEDFKVKDYAVQK 1052

Query: 778  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 837
            V LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N V V RFV   ++
Sbjct: 1053 VLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHRIGQTNSVKVIRFVIDGSI 1112

Query: 838  EEEVLERARKKMILEYAI 855
            EE++L    +K  L  A+
Sbjct: 1113 EEKMLRIQDRKRTLGEAM 1130

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 81/316 (25%), Positives = 137/316 (43%), Gaps = 75/316 (23%)

Query: 404 SKNDNGILADEMGLGKTVQTVSFISW-----------LIYARRQN--------------- 437
           S  + GIL+DEMGLGKT+  +S +             L +    N               
Sbjct: 504 SFKNGGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERS 563

Query: 438 ---GPHLVVVPLSTMPAWQETFDKWA--PGLNC-VYYMGNQAS-RDLIQDYEFYTNPQAK 490
                 L++VP+S +  W++ FDK     GL C +YY GN +S + L+   +   NP   
Sbjct: 564 YAYKTTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLLIKRK---NPPT- 619

Query: 491 GKKHLKFNVLLTTYEYI----------------LKDRSTLGSIKWQFLAVDEAHRLKNAE 534
                   V+LTTY  +                L   S + SI++  + +DE H ++N  
Sbjct: 620 --------VVLTTYGIVQNEWTKLSKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRNKS 671

Query: 535 SSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQD 588
           +   +++       R ++TGTP+ N + +L +LV FL        G +       FE ++
Sbjct: 672 TITSKAVLELSSKYRWILTGTPIINRLDDLYSLVKFLKLEPWSQIGYWKQFITNPFEERN 731

Query: 589 EQQEEYIRDLHKRLQPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTEYYKNIL 642
            +Q   +  ++  ++P +LRR K  KD + +    LP K   I +++LS  Q   Y+  L
Sbjct: 732 FKQAFDV--VNAIMEPVLLRRTKQMKDTDGNPLVQLPPKEIVIEKLQLSKKQKLIYEEFL 789

Query: 643 TKNYSALTSGIKGGHV 658
            +      SG++ G +
Sbjct: 790 QRAEKTFRSGLQSGDL 805

>Kwal_47.17771
          Length = 972

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 72/138 (52%), Gaps = 5/138 (3%)

Query: 723 GHRVLIFSQMVRILDIL----GDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDF- 777
           G ++++FSQ    LDI+        S       + DG +   +R   +  F  +D     
Sbjct: 815 GEQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGRLSMKERSKVLQDFAVKDMTRLK 874

Query: 778 VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 837
           + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ N+V V RF+ + ++
Sbjct: 875 ILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQVNNVKVVRFIIEHSI 934

Query: 838 EEEVLERARKKMILEYAI 855
           EE++L    +K  L  A+
Sbjct: 935 EEKMLRIQERKRTLGEAV 952

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 94/367 (25%), Positives = 153/367 (41%), Gaps = 88/367 (23%)

Query: 409 GILADEMGLGKTVQTVSFISWL----IYARRQ---------------------------N 437
           GILADEMGLGKT+  ++ I  +     Y + +                           +
Sbjct: 336 GILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYAS 395

Query: 438 GPHLVVVPLSTMPAWQETFDKWAPG--LNC-VYYMGNQAS-RDLIQDYEFYTNPQAKGKK 493
           G  LVVVP+S +  WQ+ F+K +      C +YY GN +S + L+             K 
Sbjct: 396 GTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNTSSLKSLLT------------KT 443

Query: 494 HLKFNVLLTTYEYIL--------------KDRSTLGSIKWQFLAVDEAHRLKNAESSLYE 539
                VL+TTY  +                D S L S+++  + +DE H ++N  +    
Sbjct: 444 KSPPTVLITTYGTVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSR 503

Query: 540 SLNSFKVANRLLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDEQQEE 593
           SL   K     ++TGTP+ N + +L +LV F+        G +       FE ++ +   
Sbjct: 504 SLMDLKSTRSWILTGTPIINRLDDLYSLVKFMRLEPWSQIGYWKTFVSDPFEKKNYKAAF 563

Query: 594 YIRDLHKRLQPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTEYYKNILTKNYS 647
            I  +   L+P ILRR K  +DV+      LP K   I +V  +  +   YK  L K  S
Sbjct: 564 DI--VSSILEPVILRRTKGMRDVDGKRLVELPPKEVIIEKVAFNKNEDALYKYFLNKAES 621

Query: 648 ALTSGIKGG-----HVSLLNVMNELKKASNHPYLF--------DNAEERVLSKFGDGHKS 694
           ++  G+  G     + ++L  +  L++   H  L         D AE R+L++     + 
Sbjct: 622 SVKEGLDRGDLLKKYSTILVHILRLRQVCCHADLLGSQDENDEDIAENRLLAEKASTQRP 681

Query: 695 RENILRG 701
             N ++G
Sbjct: 682 IVNEVKG 688

>Scas_674.12d
          Length = 1323

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 2/128 (1%)

Query: 722  DGHRVLIFSQMVRILDILGDYL-SIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFL 780
            D  +++IFSQ     DI   +L  +  + + +  G + + QR   I  F  + +N+ + L
Sbjct: 1164 DTEKIIIFSQFTSFFDIFQHFLEKLLKVPYLKYTGAMTAQQRADVITKFYRQ-ANERILL 1222

Query: 781  LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEE 840
            +S +AG  G+ L  A+ VII D  WNP  + QA  R +RI Q   V V+R   KD+VE+ 
Sbjct: 1223 ISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVHRLFIKDSVEDR 1282

Query: 841  VLERARKK 848
            + E   KK
Sbjct: 1283 IAELQEKK 1290

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 142/338 (42%), Gaps = 60/338 (17%)

Query: 392 QLTGINWMAFL-WSKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMP 450
           Q  G++W+  +  SK   G+LAD+MGLGKTVQ ++ +       +    +L+V P++ + 
Sbjct: 654 QKIGLHWLLNVEASKKKGGLLADDMGLGKTVQGIALMLANRSKDQACKTNLIVAPVAVLR 713

Query: 451 AW---QETFDKWAPGLNCVYYMGNQ--ASRDLIQDYEF----YTNPQAKGKKH------- 494
            W    ET  K     +   Y G    A+   + +Y+     Y     + KKH       
Sbjct: 714 VWGGELETKIKKEANFSAFIYGGGDKLATWKELSEYDAIMVSYPTLAIEFKKHWPASLGK 773

Query: 495 -----------LKFNVLLTTYEYI---LKDRSTLGSIKWQFLAVDEAHRLKNAESSLYES 540
                         N L    EY      + ST   I      +DE   +KN ++   ++
Sbjct: 774 DQKQLPAIPQLAAMNSLKKKDEYFSPFFCNESTFYRI-----ILDEGQNIKNKKTRAAKA 828

Query: 541 LNSFKVANRLLITGTPLQNNIKELAALVNFL-MP------------GRFTIDQEIDFENQ 587
             S     R + +GTP+QN++ EL +L+ FL +P            GR  + +  ++++ 
Sbjct: 829 CCSLDATYRWVFSGTPIQNSMDELYSLIRFLRIPPYHREERFMADIGRPFLRKNGNYDDF 888

Query: 588 DEQQEEYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTEYYKNIL 642
           D +Q   I+ +   L   +LRR K D+        LP K   I    L   + E+Y ++ 
Sbjct: 889 DRKQA--IKKVQVLLSAIMLRRSKSDMIDGKPLLELPPKQIEIDSAALEGDELEFYTDLE 946

Query: 643 TKNYS----ALTSGIKGGHVSLLNVMNELKKASNHPYL 676
            KN       L    KG + S+L ++  L++A  H  L
Sbjct: 947 AKNRKLAERLLKRKAKGNYSSVLTLLLRLRQACVHSEL 984

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 70/129 (54%), Gaps = 5/129 (3%)

Query: 725  RVLIFSQMVRILDILGDYL----SIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDF-VF 779
            +V++FSQ    LDIL + L    +       + DG +   +R   +  F  +      V 
Sbjct: 930  QVVVFSQFSSYLDILENELRQSFASDICEIYKFDGRLDLKERSNVLAKFTEKSLVKMKVL 989

Query: 780  LLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEE 839
            LLS +AGG+G+NL  A    I D  W+P  + QAM R HRIGQ N V +YRF+ ++++EE
Sbjct: 990  LLSLKAGGVGLNLTCASHAFIMDPWWSPGMEDQAMDRIHRIGQSNTVKIYRFIVENSIEE 1049

Query: 840  EVLERARKK 848
            ++L    KK
Sbjct: 1050 KMLRIQEKK 1058

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 81/332 (24%), Positives = 147/332 (44%), Gaps = 70/332 (21%)

Query: 409 GILADEMGLGKTVQTVSFISW-------LIYARRQNGP--------------------HL 441
           GILADEMGLGKT+  ++ I+        L+   ++  P                     L
Sbjct: 456 GILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTTL 515

Query: 442 VVVPLSTMPAWQETFDKW--APGLNC-VYYMGNQAS-RDLIQDYEFYTNPQAKGKKHLKF 497
           +VVP+S +P W+  F +     GL C VYY GN ++ R L+             K+    
Sbjct: 516 IVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNVSNLRTLLV------------KQKSPP 563

Query: 498 NVLLTTYEYILKDRSTLG------------SIKWQFLAVDEAHRLKNAESSLYESLNSFK 545
           +V+LTTY  +  + S L             S+++  + +DE H ++N  +   +++ +  
Sbjct: 564 SVVLTTYGVVQTEWSKLQQFDYEASNEGLFSVEFFRIILDEGHNIRNRTTKTSKAVMALT 623

Query: 546 VANRLLITGTPLQNNIKELAALVNFL-MPGRFTIDQEIDFENQDEQQEEY---IRDLHKR 601
              + ++TGTP+ N + +L +L+ F+       ID    F +   ++++Y   +  +   
Sbjct: 624 SRRKWVLTGTPIMNRLDDLFSLIKFMNFEPWCKIDYWRQFVSDPFEKKDYSSALEVIQAV 683

Query: 602 LQPFILRRLK--KDVEKS----LPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG 655
           + P +LRR K  KD + +    LP K   I  +  SD +   YK  L+K   ++   +  
Sbjct: 684 MGPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLYKYFLSKAEHSVKESLAR 743

Query: 656 G-----HVSLLNVMNELKKASNHPYLFDNAEE 682
           G     + ++L  +  L++   H  L  + +E
Sbjct: 744 GDLLKKYSTILLHILRLRQVCCHFKLLGSQDE 775

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 76/134 (56%), Gaps = 6/134 (4%)

Query: 723  GHRVLIFSQMVRILDILG----DYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDF- 777
            G ++++FSQ    LDIL      +L    +   + DG +   +R   ++ F+ +D +   
Sbjct: 957  GEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDMKERTRILEQFHDKDLSCIK 1016

Query: 778  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 837
            + LLS + GG+G+NL  A    + D  W+P  + QA+ R HRIGQ+  V V RF+  ++V
Sbjct: 1017 LLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRIHRIGQQQTVKVVRFIIDNSV 1076

Query: 838  EEEVLE-RARKKMI 850
            EE++L  + RK+M+
Sbjct: 1077 EEKMLRIQERKRML 1090

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 134/308 (43%), Gaps = 75/308 (24%)

Query: 407 DNGILADEMGLGKTVQTVSFISWLIY---------------------------ARRQNGP 439
           + GILADEMGLGKT+  ++ I    Y                            R     
Sbjct: 478 NGGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHK 537

Query: 440 H--------LVVVPLSTMPAWQETFDKWAPGLN--CVYYMGNQASRDLIQDYEFYT-NPQ 488
           H        L+VVP+S +  WQ  F+K    L   C  Y GN      I+D   Y   P 
Sbjct: 538 HDTYAYRTTLIVVPMSLLNQWQSEFEKANKDLKKRCEIYYGNN-----IKDLRAYVLGPN 592

Query: 489 AKGKKHLKFNVLLTTY-----EYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNS 543
           A        +V++TTY     EY     S L ++ +  + +DE H ++N  +   +++ +
Sbjct: 593 AP-------SVIITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIA 645

Query: 544 FKVANRLLITGTPLQNNIKELAALVNFL---------MPGRFTIDQEIDFENQDEQQEEY 594
            + + + ++TGTP+ N + +L +LV FL            R+     + FE  +  Q   
Sbjct: 646 LRSSRKWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYV---SVPFEKGNYAQAFD 702

Query: 595 IRDLHKRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSA 648
           +  ++  L+P +LRR K  KDV+     SLP K   + +++LS  +   Y+++L    ++
Sbjct: 703 V--INAVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVYQSMLEDAENS 760

Query: 649 LTSGIKGG 656
           +  G+  G
Sbjct: 761 VKEGLAKG 768

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 147/334 (44%), Gaps = 72/334 (21%)

Query: 409 GILADEMGLGKTVQTVSFISWLI--------------------YARRQNGPH-----LVV 443
           G+LADEMGLGKT+ T++ IS +                     Y  + + P+     L+V
Sbjct: 496 GLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLIV 555

Query: 444 VPLSTMPAWQETFDKWA--PGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLL 501
           VP+S +  WQ+ F+K    P  +C  Y G +A  +LI       NP           ++L
Sbjct: 556 VPMSLLFQWQKEFEKANNNPNAHCEIYYGGRAG-NLITLLTKTKNPPT---------IIL 605

Query: 502 TTYEYILKDRSTLG----------------SIKWQFLAVDEAHRLKNAESSLYESLNSFK 545
           T+Y  I  + S L                 S+++  + +DE H ++N  +   +++    
Sbjct: 606 TSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAVMDLS 665

Query: 546 VANRLLITGTPLQNNIKELAALVNFL------MPGRFTIDQEIDFENQDEQQEEYIRDLH 599
            + + ++TGTP+ N + +L +LV F+        G +       FE ++ +Q   +  + 
Sbjct: 666 SSRKWVLTGTPIINRLDDLFSLVKFMKLEPWSQIGYWKSFVSGPFEKKNYKQAFDV--VS 723

Query: 600 KRLQPFILRRLK--KDVEK----SLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGI 653
             L+P +LRR K  KD+      +LP K   I +V+ +  +   YK  L K  +++   +
Sbjct: 724 SVLEPVLLRRTKQMKDINGKPLVTLPLKEIVIEKVKFNTSEDILYKFFLNKAENSVKESL 783

Query: 654 KGG-----HVSLLNVMNELKKASNHPYLFDNAEE 682
             G     + ++L  +  L++   H  L  + +E
Sbjct: 784 ARGDLLKKYSTILVHILRLRQVCCHIELLGSRDE 817

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 5/138 (3%)

Query: 723  GHRVLIFSQMVRILDILGDYL----SIKGINFQRLDGTVPSAQRRISIDHF-NAEDSNDF 777
            G +V++FSQ    LDIL + L    S       + DG +    R   +D F   + S   
Sbjct: 970  GEQVVVFSQFSSYLDILENELTSSFSKADAKIYKFDGRLNLKDRSRVLDTFATKDLSKLK 1029

Query: 778  VFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTV 837
            + LLS +AGG+G+NL  A    + D  W+P  + QA+ R HRIGQ+++V + RF+ ++++
Sbjct: 1030 ILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRVHRIGQESNVKIIRFIMENSI 1089

Query: 838  EEEVLERARKKMILEYAI 855
            EE++L    +K  L  A+
Sbjct: 1090 EEKMLSIQDRKRTLGEAV 1107

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 76/134 (56%), Gaps = 5/134 (3%)

Query: 725  RVLIFSQMVRILDILGDYLSIKGINFQRLD--GTVPSAQRRISIDHFNAEDSNDFVFLLS 782
            +++IFSQ     +IL  +L  K +NF  L   G++ +AQRR  + +    D    + L+S
Sbjct: 1463 KIIIFSQFTTFFEILEHFLKNK-LNFPYLKYIGSM-NAQRRSDVINEFYRDPEKRILLIS 1520

Query: 783  TRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVL 842
             +AG  G+ L  A+ V+I D  WNP  + QA  R +RI Q   V V++   KD+VE+ + 
Sbjct: 1521 MKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKVQVHKLFIKDSVEDRIS 1580

Query: 843  E-RARKKMILEYAI 855
            E + RKK +++ A+
Sbjct: 1581 ELQKRKKEMVDSAM 1594

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 86/366 (23%), Positives = 158/366 (43%), Gaps = 64/366 (17%)

Query: 392  QLTGINWMAFLW-SKNDNGILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVVPLSTMP 450
            Q  G++W+  +  S    G+LAD+MGLGKT+Q ++ +        +   +L+V P+S + 
Sbjct: 947  QRLGLHWLLQVENSAKKGGLLADDMGLGKTIQAIALMLANRSEESKCKTNLIVAPVSVLR 1006

Query: 451  AWQ-------------ETFDKWAPGLNCVYYMGNQASRD-LIQDYEFYTNP--------- 487
             W+              TF     G   V +  + A  D ++  Y+   N          
Sbjct: 1007 VWKGELETKVKKRAKFTTFIFGGSGNGKVKHWRDLARYDAVLVSYQTLANEFKKHWPKKL 1066

Query: 488  -----QAKGKKHLK-FNVLLTTYEY---ILKDRSTLGSIKWQFLAVDEAHRLKNAESSLY 538
                 Q     H++  N L T+ EY      + ST   I      +DE   +KN  +   
Sbjct: 1067 DGEQNQLPAVPHIQALNRLKTSNEYYSPFFCNDSTFYRI-----LLDEGQNIKNKNTRAS 1121

Query: 539  ESLNSFKVANRLLITGTPLQNNIKELAALVNFL-MP-----GRFTID--------QEIDF 584
            ++  +     R +++GTP+QN++ EL +L+ FL +P      RF +D        ++  +
Sbjct: 1122 KACCTINGMYRWVLSGTPIQNSMDELYSLIRFLRIPPYHKEQRFKLDIGRFFQRNKQYQY 1181

Query: 585  ENQDEQQEEYIRDLHKRLQPFILRRLKKDVEKS-----LPSKTERILRVELSDVQTEYYK 639
            +N+D  ++  +R +   L   +LRR K D         LP K   +    L   + ++Y 
Sbjct: 1182 DNED--RKNALRKVRVLLNAIMLRRSKADKIDGKPLLELPPKIVEVDESRLKGEELKFYT 1239

Query: 640  NILTKNYS----ALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVL-SKFGDGHKS 694
             + +KN +     L +  +G + S+L ++  L++A  H  L    E++   +K  +G   
Sbjct: 1240 ALESKNQALAKKLLNNSTRGSYSSVLTLLLRLRQACCHSELVVMGEKKAEGTKVANGKSF 1299

Query: 695  RENILR 700
             ++ LR
Sbjct: 1300 EDDWLR 1305

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 68/130 (52%), Gaps = 6/130 (4%)

Query: 722  DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLL 781
            D  +V+++SQ    L ++G  L +  I  + L     +A    +I++F  + S     LL
Sbjct: 1378 DPPQVILYSQKTEYLKVIGKVLKLYHI--EHLACLSNTANVGETINNFKRQPSVT-CLLL 1434

Query: 782  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 841
            + +  G G+NL+ A  + + D   N   +LQAM R +RIGQ     V+ F+ ++TVEE +
Sbjct: 1435 NVKTLGAGLNLINAKHIFLLDPILNNSDELQAMGRNNRIGQDEETFVWNFMIRNTVEENI 1494

Query: 842  LERARKKMIL 851
            L   R K IL
Sbjct: 1495 L---RYKCIL 1501

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 87/214 (40%), Gaps = 48/214 (22%)

Query: 409 GILADEMGLGKTVQTVSFISWLIYARRQNGPHLVVV-----------------PLSTMPA 451
           G+LA+EMGLGKT++ +S I  L+  R+        +                 P + +  
Sbjct: 387 GVLAEEMGLGKTIEILSLI--LLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQ 444

Query: 452 WQETFDKWAPGLNCVYYMG-----------NQASRDLIQDYEFYT---NPQAKGKKHLKF 497
           W E  +  A  L    Y G           ++A + L Q Y+      N  A    H +F
Sbjct: 445 WLEEIELHANSLKWYTYRGYNEIMKDCKTVDEAVQQLCQ-YDIIVTSYNIIATEVHHAEF 503

Query: 498 NVLLTT-------YEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRL 550
           N  + +       Y+Y     S L  +++  + +DE   L+++ +   +  +     +  
Sbjct: 504 NRSIRSRRLKSPKYDY----SSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRIHTW 559

Query: 551 LITGTPLQNNIKELAALVNFLMPGRFTIDQEIDF 584
            ++GTP+Q NI     ++++L    F    E+DF
Sbjct: 560 GVSGTPIQ-NIYNFRMIMSYLKLHPFC--DEVDF 590

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 69/131 (52%), Gaps = 12/131 (9%)

Query: 725  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNA---EDSNDFVFLL 781
            ++L++SQ    + ++   LS+  IN       +   Q   ++    A   + S+    LL
Sbjct: 1299 QILMYSQSFDFMKVVSQVLSLHNIN------NICCLQNNRNVGDMIARFKKTSDITCLLL 1352

Query: 782  STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEV 841
            + R+ G G+NL+ A  + + D   N   ++QAM+R +RIGQ+    V+ F+ ++TVEE +
Sbjct: 1353 NIRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVEESI 1412

Query: 842  LERARKKMILE 852
            +   R K +LE
Sbjct: 1413 M---RYKCVLE 1420

>Scas_573.9
          Length = 1502

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 62/123 (50%), Gaps = 3/123 (2%)

Query: 725  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTR 784
            ++L++SQ    L +LG  L+   I  + L     S+     I  F ++ SN    LL+ +
Sbjct: 1333 QILLYSQSANFLKVLGKILTKNDI--EHLTCLSNSSTIGKKIARFKSQ-SNITCLLLNVK 1389

Query: 785  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 844
              G G+NL+ A  + + D   N   +LQAM R +RIGQK    V+  +  ++VEE + + 
Sbjct: 1390 TLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVEENIFKY 1449

Query: 845  ARK 847
              K
Sbjct: 1450 KCK 1452

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 56/116 (48%), Gaps = 24/116 (20%)

Query: 409 GILADEMGLGKTVQTVSFISWLIYAR----------------RQNGPHLVVVPLSTMPAW 452
           G+L++EMGLGKT++ ++ I  ++  R                R+    L+V P + +  W
Sbjct: 371 GLLSEEMGLGKTIEVLALI--MLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQW 428

Query: 453 QETFDKWAPGLNCVYYMGNQASRDLIQDYEFYT-NPQAKGKKHLKFNVLLTTYEYI 507
               +     L   +YMG+ A+R      +F T N Q    +  ++++++T+Y+ +
Sbjct: 429 INETNAHTENLKIFHYMGSLATR-----IQFDTDNIQEILDRLSEYDIIITSYDIV 479

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 66/128 (51%), Gaps = 7/128 (5%)

Query: 725  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTR 784
            +++IFS     L IL   L+   +   R       A+   ++D F  +D N    LL+  
Sbjct: 1353 QIVIFSSHSAFLSILSTLLTAHNVTHARPLRNTKFAK---AVDTFR-KDPNCTCLLLNVH 1408

Query: 785  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 844
            +   G+ L+ A  +I+ +   +   + QA++R HRIGQK+   V+ F+ ++TVEE ++  
Sbjct: 1409 SQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYVWNFMVRNTVEESIM-- 1466

Query: 845  ARKKMILE 852
             + K +LE
Sbjct: 1467 -KYKAVLE 1473

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 26/121 (21%)

Query: 405 KNDNGILADEMGLGKTVQTVSFISWLIY----------------ARRQNGPHLVVVPLST 448
           K   G+LADEMGLGKT++ ++ IS  +                   R+   +L+V P S 
Sbjct: 349 KKARGVLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCPESI 408

Query: 449 MPAWQETFD----KWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHL-KFNVLLTT 503
           +  W +  D    K        +Y G + +R+     +F T+  A+  + + +++V++ +
Sbjct: 409 LQQWIDEIDLHINKKVSDFKVFHYEGFEKTRN-----KFNTDSPAEIVELMSQYDVVICS 463

Query: 504 Y 504
           Y
Sbjct: 464 Y 464

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 69/155 (44%), Gaps = 16/155 (10%)

Query: 725  RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTR 784
            +++I+SQ   +L+I+   L    I F      V +  +   ++ F A D      LL T+
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQNSIKFLTTTKNVRNFAK--VVETFKA-DPEITCLLLDTK 1415

Query: 785  AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 844
                G+ L+ A  V + +   N   + QA+ R HRIGQ +   V+ F+  +TVE  +L  
Sbjct: 1416 RQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSIL-- 1473

Query: 845  ARKKMILEYAIISLGVTDGNKISSTKKNEPSAGEL 879
             R K ILE           NK  STK      G L
Sbjct: 1474 -RYKSILE----------KNKGDSTKGTRQQGGGL 1497

>Kwal_14.1287
          Length = 1518

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 52/117 (44%), Gaps = 17/117 (14%)

Query: 755  GTVPSAQRRISIDHFNAEDSNDF--------------VFLLSTRAGGLGINLMTADTVII 800
            G +    ++ SI H N   S  F                LL+      G+ L+ A  V I
Sbjct: 1344 GLLSKVLKQHSIQHCNTAGSGKFSKIVEKFKKNPEVTCLLLNVTRQATGLTLVNATHVFI 1403

Query: 801  FDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAIIS 857
             D   N   +LQA+ R HRIGQ     V+ FV ++TVE+ ++   R K +LE  I S
Sbjct: 1404 MDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIV---RLKGVLEERIAS 1457

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 57/134 (42%), Gaps = 35/134 (26%)

Query: 405 KNDNGILADEMGLGKTVQTVSFISWLIYARRQNGP----------------HLVVVPLST 448
           K+  G+L++EMGLGKT++ ++ +  L++ R  NG                 +L+V P S 
Sbjct: 351 KHAKGVLSEEMGLGKTLEILALM--LVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSI 408

Query: 449 MPAWQETFDKWAP------GLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLT 502
           +  W +  +           +N  +Y G Q  +       F T   A    H      L+
Sbjct: 409 LQQWIDEVEAHVVSEASHRSMNIFHYRGYQEVKK-----HFDTEDIAAIVSH------LS 457

Query: 503 TYEYILKDRSTLGS 516
           TY+ IL   +T+ S
Sbjct: 458 TYDIILCSYATVSS 471

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 67/159 (42%), Gaps = 27/159 (16%)

Query: 370  RPKFEKLDAQPSFIKGGELRDFQLT---------GINWMAFLWSKND-NGILADEMGLGK 419
            R   E L    + I+G EL   +LT         G++W+  +   N   G+LAD+MGLGK
Sbjct: 858  RNLLEGLKQHETEIEGEELTPEELTVNLLKHQRRGLHWLLNVEKSNKRGGLLADDMGLGK 917

Query: 420  TVQTVSFISWLIYARRQNGPHLVVVPLSTMPAWQ---ETFDKWAPGLNCVYYMGNQASRD 476
            TVQ ++ +            +L+V P++ +  WQ   +T  K         Y GN     
Sbjct: 918  TVQAIALMIANRSELESCKTNLIVAPVAVLRVWQAEIQTKIKKNATFKAFIYGGN----- 972

Query: 477  LIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLG 515
                     N     K  L+++ +L +Y+ +  +   +G
Sbjct: 973  ---------NKVVSYKDLLRYDAVLVSYQTLASELKNIG 1002

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 17/102 (16%)

Query: 765  SIDHFNAE--------------DSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQAD 810
            SI HFN E              DS+    L++ +    G+ L  A  VI+ +     +  
Sbjct: 1324 SISHFNTEFGQDLAKEAELFKRDSSITCLLMNPKWCSRGLKLTNATHVILMEPMSEGRIQ 1383

Query: 811  LQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILE 852
             QA+ R HRIGQ     V+  ++++T EE  L   + +M+LE
Sbjct: 1384 EQAVERIHRIGQGKDTFVWHLMTRNTAEESTL---KYRMLLE 1422

>CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces
           cerevisiae YKR024c DBP7 RNA helicase, start by
           similarity
          Length = 715

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 6/111 (5%)

Query: 723 GHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDS----NDFV 778
           G  V + S+  +IL  + D   + GI   +L G++    R +++ HF A DS       +
Sbjct: 439 GDSVRVLSKGNKILPSIKDE-ELPGIICYKLHGSLSQQMRTMTLKHF-ATDSEQTKGKHL 496

Query: 779 FLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVY 829
            L  T     G++L    TVI FD  +  +  L  + R  R G+    +++
Sbjct: 497 ILFCTDVASRGLDLPDVSTVIEFDPPFAVEDHLHRIGRTARAGRSGEALLF 547

>AFR082C [3274] [Homologous to ScYKR024C (DBP7) - SH]
           (576175..578307) [2133 bp, 710 aa]
          Length = 710

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 3/83 (3%)

Query: 750 FQRLDGTVPSAQRRISIDHFN---AEDSNDFVFLLSTRAGGLGINLMTADTVIIFDSDWN 806
           F +L G++P A R  ++ HF+   A      + L  T     G++L    TVI  D  + 
Sbjct: 467 FYKLHGSLPQAVRVATLRHFSSDAAATRGKHLVLFCTDVASRGLDLPRVSTVIEMDPPFA 526

Query: 807 PQADLQAMARAHRIGQKNHVMVY 829
            +  L  + R  R G     +++
Sbjct: 527 VEDHLHRIGRTARAGVAGESLLF 549

>KLLA0F10505g complement(966736..969174) some similarities with
           sp|P21372 Saccharomyces cerevisiae YBR237w PRP5 pre-mRNA
           processing RNA-helicase, hypothetical start
          Length = 812

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 53/124 (42%), Gaps = 4/124 (3%)

Query: 725 RVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTR 784
           + +IF    ++ D+L D L + GI    +    PSA+R  ++  F   D+     L+ T 
Sbjct: 502 KTIIFVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFKETDNG---ILICTE 558

Query: 785 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 844
               G+N+     VII+++       +  + R  R G  N V +   +  +     +L +
Sbjct: 559 VLSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGR-GTNNGVALSFVMVDELASAYILVK 617

Query: 845 ARKK 848
             K+
Sbjct: 618 CMKE 621

>Kwal_56.24760
          Length = 433

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 67/159 (42%), Gaps = 15/159 (9%)

Query: 727 LIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAG 786
           +IF       +IL   L    +    L   +P  +R  S+  F A   N    L++T   
Sbjct: 259 IIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRA---NAARVLIATDVA 315

Query: 787 GLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVE--EEVLER 844
             G+++ T   V+ +D   NP   +    R  R G+K   +   FV++  V   + + ER
Sbjct: 316 SRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESIC--FVAQRDVSRIQAIEER 373

Query: 845 ARKKM-----ILEYAIISLGVTDGNKISSTKKNEPSAGE 878
             KKM     + + A+I   +   NK+++ K+    A E
Sbjct: 374 INKKMEEFKDVHDTAVIRKAL---NKVTAAKRESLMAME 409

>Scas_711.3
          Length = 452

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 586 NQDEQQEEYIRD-LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSD--VQTEYYK-NI 641
           NQ++Q E+ I   L K L P  +  L K + K +   TE ILR+ L    +   Y +  I
Sbjct: 158 NQEQQMEDSIASKLTKNLNPIKISELAKSLSKIVVGDTEEILRIHLVHDLINYSYLQYQI 217

Query: 642 LTKNYSALTSGIKGG 656
            TK    L+S ++GG
Sbjct: 218 ETKFDQVLSSQVQGG 232

>ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C
           (DBP1) - SH] (225070..226941) [1872 bp, 623 aa]
          Length = 623

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 60/131 (45%), Gaps = 6/131 (4%)

Query: 722 DGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLL 781
           DG   L+F +  R+ D L D+L ++ ++   + G    A+R  ++  F    +N    L+
Sbjct: 401 DGGLTLVFVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGRAN---VLV 457

Query: 782 STRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKN-HVMVYRFVSKDTVEE- 839
           +T     G+++     VI +D   +    +  + R  R G        +   +K+ V+E 
Sbjct: 458 ATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLATAFFNRGNKNVVKEL 517

Query: 840 -EVLERARKKM 849
            ++LE A +++
Sbjct: 518 VDILEEANQEV 528

>Kwal_47.16671
          Length = 213

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 1016 NNLDAFGEREIRALYKCILRFGDIENKFEELIADGSLPVKSIDRYKELYHEMITEAETLM 1075
            + +++ G+  IR  +   L FG +E  F+ LI   +L V  +D  +   H  +TE E  +
Sbjct: 82   DQVESIGKEVIRTQW---LDFGSLEQHFDSLIGKRALIVDEVDDTRTTLHYALTELEKEV 138

Query: 1076 RDEEAK 1081
            ++++ K
Sbjct: 139  KEQQIK 144

>YDR110W (FOB1) [959] chr4 (676096..677796) Protein required for
            blocking the replication fork, for recombinational
            hotspot activity at the HOT1 site in rDNA, and for
            expansion and contraction of rDNA repeats [1701 bp, 566
            aa]
          Length = 566

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 6/97 (6%)

Query: 1049 DGSLPVKSIDRYKELYHEMITEAETLMRDEEAKRHEIFSKLEKDAAEYRQKIKNLEIKPE 1108
            D S+P +S+ R K    +  +  E+  R+    R  I   + +   EY     NLE+   
Sbjct: 14   DDSVPSESVTR-KSQRRKATSPGES--RESSKDRLLILPSMGESYTEYVDSYLNLELL-- 68

Query: 1109 DDAGKETPITLLSAKRREKRAILFEFHDTKALNADTL 1145
            +   +ETPI L S  R+  + I +E   TK+L ADTL
Sbjct: 69   ERGERETPIFLESLTRQLTQKI-YELIKTKSLTADTL 104

>Scas_587.7
          Length = 910

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 1389 HQQPSSRSGTPVVGSKKQQRKGKDIPLAPKADIRLPDKEYDSMDEEECK 1437
            HQ+ SS+S   +  +   Q   K++P  PK  I +PD  +DS++    +
Sbjct: 529  HQRNSSKSNPFLTPTVSVQSPEKELPSLPKGMIEIPDSNFDSLNSSSGR 577

>Scas_554.1
          Length = 289

 Score = 31.2 bits (69), Expect = 6.7,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 111 KRVEESDEENVVLPTRFSSRNNNKVINYTLNDDSNDEDLMESSEEQDEGHNLDSEDMDLQ 170
           K  E+   ++ +  T  +S NNNK+ N  +  ++ND D M +    + G+N D++D+ +Q
Sbjct: 166 KNTEQYQTKSPLGNTIVTSMNNNKIQNNDVTANTNDGDYMVT----NGGYNFDNDDLIIQ 221

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 51,993,758
Number of extensions: 2495134
Number of successful extensions: 12153
Number of sequences better than 10.0: 340
Number of HSP's gapped: 11982
Number of HSP's successfully gapped: 431
Length of query: 1501
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1386
Effective length of database: 12,615,039
Effective search space: 17484444054
Effective search space used: 17484444054
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)