Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17556g60759831780.0
AGR125W60759829130.0
YDR091C60859928990.0
CAGL0G08041g60759828510.0
Scas_636.1460859927810.0
Kwal_56.2342953953925750.0
KLLA0C16115g11833301525e-10
AEL032W7532281498e-10
Sklu_2403.511793261481e-09
Sklu_2187.27521891453e-09
AFL131W11893281436e-09
Scas_618.37931901401e-08
CAGL0B03487g10453191382e-08
Kwal_33.1556112971981382e-08
Kwal_0.16710442061373e-08
YPL226W (NEW1)11963231363e-08
YFR009W (GCN20)7521811336e-08
Kwal_34.162407522281311e-07
Scas_566.14662331291e-07
Kwal_0.32710192081292e-07
Scas_720.3611903331292e-07
Sklu_2442.2010441961283e-07
CAGL0D03674g11863111274e-07
CAGL0M13739g7272151274e-07
CAGL0K10472g7521811274e-07
KLLA0A10857g7521921265e-07
Scas_703.1710463071265e-07
AFR432W12842111257e-07
CAGL0K00363g12271731258e-07
Kwal_27.1271112462091241e-06
YKL209C (STE6)12901551241e-06
YMR301C (ATM1)6902151221e-06
Scas_716.8115651981212e-06
KLLA0F12210g10441961202e-06
AAL028W10442011194e-06
YLR249W (YEF3)10442031185e-06
CAGL0I08019g12852031176e-06
KLLA0D04554g10222541177e-06
KLLA0D03432g14832161168e-06
AGR047W14921841169e-06
YNL014W (HEF3)10443101151e-05
KLLA0A01452g6071791141e-05
Kwal_33.156235621981131e-05
YER036C6101791122e-05
Scas_288.14942131113e-05
Sklu_2152.56081791095e-05
AFR232C6071791086e-05
Scas_574.87022461087e-05
KLLA0D00748g7891991087e-05
Kwal_26.94807192231087e-05
CAGL0L07744g10552331087e-05
YDR011W (SNQ2)15012131088e-05
Scas_573.11689731079e-05
CAGL0C02343g6101791052e-04
CAGL0E03355g15351831052e-04
Kwal_56.223297762731042e-04
KLLA0A10131g7202181032e-04
Scas_40.1203201992e-04
Scas_695.2412881731042e-04
AGL335W6912111033e-04
AGL142C14971931033e-04
Kwal_47.191166071791033e-04
YOL075C12942351033e-04
KLLA0D02156g521841014e-04
Scas_712.296101991014e-04
CAGL0I04862g15072151024e-04
AER190W10111791014e-04
KLLA0C04477g12532151015e-04
Kwal_56.2274715382191006e-04
YLR188W (MDL1)695192998e-04
Scas_628.131060148980.001
ABR126W1512213970.001
Scas_108.1335131950.002
Scas_710.50602166960.002
CAGL0E00385g608181960.002
Scas_455.1925231930.004
YPL270W (MDL2)773325930.004
ACR022W754198920.005
Sklu_2343.3774366920.005
Scas_622.91657209920.005
Sklu_2316.11310241920.006
CAGL0M07293g1515193920.006
Scas_587.8715185910.008
YCR011C (ADP1)1049219900.009
Scas_707.8294167880.010
KLLA0B14256g127175900.011
KLLA0B09702g1518224900.011
Scas_468.1691176890.012
CAGL0L06402g1535156890.012
ABR125C1488179890.013
YDR135C (YCF1)1515173880.017
Kwal_23.51611489166880.018
YPL058C (PDR12)1511194880.019
KLLA0C14234g1454196870.022
KLLA0F08833g273174850.024
YLL048C (YBT1)1661207870.025
YLL015W (BPT1)1559168860.027
CAGL0K12474g294160850.027
CAGL0G00242g1477168850.037
Scas_693.421512153850.039
KLLA0F20075g1516277850.039
Scas_714.421520173850.042
KLLA0E00462g1650215840.050
Kwal_56.238441494151840.052
AFR683C677201830.058
YNR070W1333164830.062
CAGL0M02387g856177830.069
Scas_552.4720221820.077
CAGL0A01133g801258820.080
Kwal_27.96661474194820.088
CAGL0G05093g54472810.091
KLLA0D04059g1568161820.094
Scas_643.11289209820.096
Scas_627.1853371810.097
YHL035C1592197820.098
KLLA0D03476g1560195820.10
KLLA0C01991g706204810.10
YIL013C (PDR11)141168810.11
CAGL0M01760g1499171810.13
Scas_567.1810181790.20
Sklu_1870.3265158770.21
YGR281W (YOR1)1477171780.24
KLLA0F21692g1525233780.27
CAGL0L06644g828133770.34
YDR406W (PDR15)1529172770.36
KLLA0E19074g326118760.37
KLLA0A00286g128082760.42
YOR011W (AUS1)139445760.47
YKR104W (NFT1)306211740.55
Scas_612.11*1506153750.56
YNR011C (PRP2)876106750.59
Kwal_14.2435124783750.62
YOR328W (PDR10)1564194750.68
CAGL0C03289g1648196740.74
Scas_586.31531164740.87
Scas_711.39122782731.0
YPL147W (PXA1)870177731.0
Kwal_34.157701436164731.1
Scas_472.1*39351721.1
YOR153W (PDR5)1511173731.1
Scas_717.6*140086721.3
Scas_469.160950721.3
Kwal_27.1114732367711.4
Kwal_14.1242269155701.5
Kwal_26.8730831177711.7
YFL028C (CAF16)28920691.9
AFR152C27020692.0
YGL091C (NBP35)32881692.0
Sklu_2062.232893692.2
CAGL0H03091g33439692.2
Sklu_2361.8836184702.2
Kwal_26.670261796702.2
KLLA0B02563g80884702.3
CAGL0F01419g1398209702.6
Scas_640.8868185692.9
YGL120C (PRP43)76750693.2
Kwal_56.23638492243693.5
Kwal_26.95321471201683.8
YER013W (PRP22)1145136684.3
AAL182W123182684.3
CAGL0D00352g86150674.5
CAGL0F02717g1542197684.7
YLR362W (STE11)717133674.7
Kwal_23.404576152674.7
YJL074C (SMC3)123082674.8
KLLA0F14575g85184675.4
Kwal_14.172477067675.5
CAGL0E03982g165979676.1
AAR180C76673666.2
Kwal_23.611789751666.8
Scas_720.733265657.0
CAGL0K06281g18548647.5
YMR128W (ECM16)126762667.7
Scas_716.82675154658.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17556g
         (598 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...  1228   0.0  
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...  1126   0.0  
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...  1121   0.0  
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...  1102   0.0  
Scas_636.14                                                          1075   0.0  
Kwal_56.23429                                                         996   0.0  
KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomy...    63   5e-10
AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH] complement...    62   8e-10
Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement       62   1e-09
Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement         60   3e-09
AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH] complement(...    60   6e-09
Scas_618.3                                                             59   1e-08
CAGL0B03487g complement(345399..348536) highly similar to sp|P16...    58   2e-08
Kwal_33.15561                                                          58   2e-08
Kwal_0.167                                                             57   3e-08
YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the non-t...    57   3e-08
YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a prot...    56   6e-08
Kwal_34.16240                                                          55   1e-07
Scas_566.1                                                             54   1e-07
Kwal_0.327                                                             54   2e-07
Scas_720.36                                                            54   2e-07
Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement      54   3e-07
CAGL0D03674g 370066..373626 highly similar to tr|Q08972 Saccharo...    54   4e-07
CAGL0M13739g complement(1346231..1348414) similar to sp|P40416 S...    54   4e-07
CAGL0K10472g 1020016..1022274 highly similar to sp|P43535 Saccha...    54   4e-07
KLLA0A10857g complement(941784..944042) highly similar to sp|P43...    53   5e-07
Scas_703.17                                                            53   5e-07
AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH] complement(...    53   7e-07
CAGL0K00363g complement(37452..41135) similar to sp|P12866 Sacch...    53   8e-07
Kwal_27.12711                                                          52   1e-06
YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane tr...    52   1e-06
YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of...    52   1e-06
Scas_716.81                                                            51   2e-06
KLLA0F12210g 1125630..1128764 highly similar to sp|P16521 Saccha...    51   2e-06
AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W (H...    50   4e-06
YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongat...    50   5e-06
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...    50   6e-06
KLLA0D04554g complement(385733..388801) similar to sp|P25371 Sac...    50   7e-06
KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces c...    49   8e-06
AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH] complement(...    49   9e-06
YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongat...    49   1e-05
KLLA0A01452g 130078..131901 highly similar to sp|P40024 Saccharo...    49   1e-05
Kwal_33.15623                                                          48   1e-05
YER036C (YER036C) [1461] chr5 complement(223366..225198) Member ...    48   2e-05
Scas_288.1                                                             47   3e-05
Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement         47   5e-05
AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH] (859615..8...    46   6e-05
Scas_574.8                                                             46   7e-05
KLLA0D00748g complement(69839..72208) similar to sp|P33311 Sacch...    46   7e-05
Kwal_26.9480                                                           46   7e-05
CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces c...    46   7e-05
YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump invo...    46   8e-05
Scas_573.11                                                            46   9e-05
CAGL0C02343g 236840..238672 highly similar to sp|P40024 Saccharo...    45   2e-04
CAGL0E03355g complement(307242..311849) similar to sp|P14772 Sac...    45   2e-04
Kwal_56.22329                                                          45   2e-04
KLLA0A10131g complement(889688..891850) similar to sp|P40416 Sac...    44   2e-04
Scas_40.1                                                              43   2e-04
Scas_695.24                                                            45   2e-04
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    44   3e-04
AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH] (434247.....    44   3e-04
Kwal_47.19116                                                          44   3e-04
YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member...    44   3e-04
KLLA0D02156g complement(184520..186085) similar to sgd|S0002468 ...    44   4e-04
Scas_712.29                                                            44   4e-04
CAGL0I04862g complement(438338..442861) highly similar to sp|P32...    44   4e-04
AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -...    44   4e-04
KLLA0C04477g complement(409543..413304) similar to sp|Q08234 Sac...    44   5e-04
Kwal_56.22747                                                          43   6e-04
YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the ATP-b...    43   8e-04
Scas_628.13                                                            42   0.001
ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W (...    42   0.001
Scas_108.1                                                             41   0.002
Scas_710.50                                                            42   0.002
CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces cer...    42   0.002
Scas_455.1                                                             40   0.004
YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the ATP-bin...    40   0.004
ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH] complement(...    40   0.005
Sklu_2343.3 YPL270W, Contig c2343 2058-4382                            40   0.005
Scas_622.9                                                             40   0.005
Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement           40   0.006
CAGL0M07293g complement(733072..737619) similar to sp|Q02785 Sac...    40   0.006
Scas_587.8                                                             40   0.008
YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of t...    39   0.009
Scas_707.8                                                             39   0.010
KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces...    39   0.011
KLLA0B09702g complement(842245..846801) highly similar to sp|Q02...    39   0.011
Scas_468.1                                                             39   0.012
CAGL0L06402g 718726..723333 highly similar to sp|P39109 Saccharo...    39   0.012
ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W ...    39   0.013
YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar gl...    39   0.017
Kwal_23.5161                                                           39   0.018
YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein ...    39   0.019
KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces...    38   0.022
KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces c...    37   0.024
YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein wit...    38   0.025
YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporte...    38   0.027
CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces...    37   0.027
CAGL0G00242g complement(20428..24861) highly similar to sp|P5304...    37   0.037
Scas_693.42                                                            37   0.039
KLLA0F20075g complement(1868786..1873336) similar to sp|P39109 S...    37   0.039
Scas_714.42                                                            37   0.042
KLLA0E00462g complement(39173..44125) similar to sp|P32386 Sacch...    37   0.050
Kwal_56.23844                                                          37   0.052
AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH] (1697345..1...    37   0.058
YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidr...    37   0.062
CAGL0M02387g 280372..282942 similar to sp|P41909 Saccharomyces c...    37   0.069
Scas_552.4                                                             36   0.077
CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces c...    36   0.080
Kwal_27.9666                                                           36   0.088
CAGL0G05093g complement(483230..484864) similar to sp|Q12298 Sac...    36   0.091
KLLA0D04059g complement(338422..343128) similar to sp|P14772 Sac...    36   0.094
Scas_643.1                                                             36   0.096
Scas_627.18                                                            36   0.097
YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of...    36   0.098
KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces c...    36   0.10 
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    36   0.10 
YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane ...    36   0.11 
CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharo...    36   0.13 
Scas_567.1                                                             35   0.20 
Sklu_1870.3 YFL028C, Contig c1870 3336-4133                            34   0.21 
YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resista...    35   0.24 
KLLA0F21692g complement(2014152..2018729) gi|14571818|gb|AAK6729...    35   0.27 
CAGL0L06644g 748310..750796 some similarities with sp|P38850 Sac...    34   0.34 
YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-bin...    34   0.36 
KLLA0E19074g complement(1691643..1692623) highly similar to sp|P...    34   0.37 
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...    34   0.42 
YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in...    34   0.47 
YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the ATP-b...    33   0.55 
Scas_612.11*                                                           33   0.56 
YNR011C (PRP2) [4594] chr14 complement(644319..646949) Pre-mRNA ...    33   0.59 
Kwal_14.2435                                                           33   0.62 
YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-bind...    33   0.68 
CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces c...    33   0.74 
Scas_586.3                                                             33   0.87 
Scas_711.39                                                            33   1.0  
YPL147W (PXA1) [5300] chr16 (273254..275866) Protein required fo...    33   1.0  
Kwal_34.15770                                                          33   1.1  
Scas_472.1*                                                            32   1.1  
YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump in...    33   1.1  
Scas_717.6*                                                            32   1.3  
Scas_469.1                                                             32   1.3  
Kwal_27.11147                                                          32   1.4  
Kwal_14.1242                                                           32   1.5  
Kwal_26.8730                                                           32   1.7  
YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein tha...    31   1.9  
AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH] (710017..7...    31   2.0  
YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative ...    31   2.0  
Sklu_2062.2 YGL091C, Contig c2062 3197-4183                            31   2.2  
CAGL0H03091g complement(292976..293980) highly similar to sp|P52...    31   2.2  
Sklu_2361.8 YPL147W, Contig c2361 14520-17030                          32   2.2  
Kwal_26.6702                                                           32   2.2  
KLLA0B02563g complement(222951..225377) similar to sp|P34230 Sac...    32   2.3  
CAGL0F01419g complement(142623..146819) highly similar to tr|Q08...    32   2.6  
Scas_640.8                                                             31   2.9  
YGL120C (PRP43) [1866] chr7 complement(281638..283941) Pre-mRNA ...    31   3.2  
Kwal_56.23638                                                          31   3.5  
Kwal_26.9532                                                           31   3.8  
YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing f...    31   4.3  
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...    31   4.3  
CAGL0D00352g complement(42946..45531) similar to sp|P34230 Sacch...    30   4.5  
CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-bindi...    31   4.7  
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    30   4.7  
Kwal_23.4045                                                           30   4.7  
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...    30   4.8  
KLLA0F14575g complement(1351796..1354351) some similarities with...    30   5.4  
Kwal_14.1724                                                           30   5.5  
CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces c...    30   6.1  
AAR180C [368] [Homologous to ScYGL120C (PRP43) - SH] (665711..66...    30   6.2  
Kwal_23.6117                                                           30   6.8  
Scas_720.7                                                             30   7.0  
CAGL0K06281g complement(608987..609544) highly similar to sp|P15...    29   7.5  
YMR128W (ECM16) [4085] chr13 (523695..527498) Component of U3 sn...    30   7.7  
Scas_716.82                                                            30   8.8  

>KLLA0C17556g complement(1544404..1546227) highly similar to
           sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1,
           start by similarity
          Length = 607

 Score = 1228 bits (3178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/598 (100%), Positives = 598/598 (100%)

Query: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60
           MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI
Sbjct: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA
Sbjct: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKR 360
           YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKR 360

Query: 361 TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQK 420
           TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQK
Sbjct: 361 TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQK 420

Query: 421 IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLS 480
           IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLS
Sbjct: 421 IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLS 480

Query: 481 LGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           LGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF
Sbjct: 481 LGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540

Query: 541 DGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSGN 598
           DGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSGN
Sbjct: 541 DGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSGN 598

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
           complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 1126 bits (2913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/598 (90%), Positives = 570/598 (95%)

Query: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60
           MS KNTRIAIVS+DKCKPKKCRQECKRSCPVVKTGKLCIEV PTSK+AFISENLCIGCGI
Sbjct: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AI IINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR++DPPEW +IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240
           KGP+QKVGELLK R+EK + D K YI IL+L+NVL R+VSALSGGELQRFAIGMSCVQ+A
Sbjct: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAALIIRSLL+PTTYVICVEHDLSVLDYLSDF+CI+YGVPSV
Sbjct: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKR 360
           YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFR+A+AG+EL +DA RAF YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSDAMRAFQYPPMKR 360

Query: 361 TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQK 420
           TQGDF L VE GEFSDS+ILVMMGENGTGKTTLIKLLAGAI ADDG+DIPKLNVSMKPQK
Sbjct: 361 TQGDFVLNVEPGEFSDSEILVMMGENGTGKTTLIKLLAGAIAADDGKDIPKLNVSMKPQK 420

Query: 421 IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLS 480
           IAPKF GTVRQLFFKRIRAQFLNPQFQTDV KPL+IDDIIDQEVQHLSGGELQRVAIVL+
Sbjct: 421 IAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVLA 480

Query: 481 LGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF
Sbjct: 481 LGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540

Query: 541 DGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSGN 598
           +G PSK A+AR PESLLTGCNKFLKNLNVTFRRDP SFRPRINKLDSQMDKEQK SGN
Sbjct: 541 EGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN 598

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
           ortholog of human Rnase L inhibitor (RLI) of the
           interferon-regulated 2-5A pathway, putative ortholog of
           C. elegans Y39E4B.1, member of the non-transporter group
           in the ATP-binding cassette (ABC) superfamily [1827 bp,
           608 aa]
          Length = 608

 Score = 1121 bits (2899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/599 (90%), Positives = 570/599 (95%), Gaps = 1/599 (0%)

Query: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60
           MS KN+RIAIVS DKCKPKKCRQECKRSCPVVKTGKLCIEV PTSKIAFISE LCIGCGI
Sbjct: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAIQIINLPTNL++ VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRF+DPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLR+EKS +D KRYI ILQL+NVL R++  LSGGELQRFAIGMSCVQEA
Sbjct: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA IIRSLL PT YVICVEHDLSVLDYLSDFVCIIYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEAD-ASRAFTYPDMK 359
           YGVVTLP+SVREGINIFLDGHIP+ENLRFRTEALQFR+ADA ++L+ D ASRAF+YP +K
Sbjct: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360

Query: 360 RTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQ 419
           +TQGDF L VE GEFSDS+ILVMMGENGTGKTTLIKLLAGA+  D+GQDIPKLNVSMKPQ
Sbjct: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420

Query: 420 KIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 479
           KIAPKF GTVRQLFFK+IR QFLNPQFQTDVVKPL+IDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480

Query: 480 SLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
           +LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
Sbjct: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540

Query: 540 FDGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSGN 598
           F+GIPSK A ARAPESLLTGCN+FLKNLNVTFRRDP SFRPRINKLDSQMDKEQKSSGN
Sbjct: 541 FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGN 599

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
           Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 1102 bits (2851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/598 (88%), Positives = 562/598 (93%)

Query: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60
           MS K +RIA+V+ D+CKPKKCRQECKRSCPVVKTGKLCIEV PTSKIAFISE LCIGCGI
Sbjct: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNL+S VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRF+DPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180

Query: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLR+EK +D  K+YI  LQL ++LNRE+  LSGGELQRFAI MSCVQ+A
Sbjct: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAALIIRSLL P+ YVI VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKR 360
           YGVVTLPSSVREGINIFLDGHIPSEN+RFRTEALQFR+AD+  ++  DA+RA++YPDMKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRIADSAADIIVDATRAYSYPDMKR 360

Query: 361 TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQK 420
           TQGDF+L V++GEFSDS+ILVMMGENGTGKTTLIKLLAGAIPADDG  +PKLNVSMKPQ 
Sbjct: 361 TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQT 420

Query: 421 IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLS 480
           IAPKF GTVRQLFFK+IRAQFLNPQFQTDVVKPLKIDDIIDQEV+HLSGGELQRVAIVLS
Sbjct: 421 IAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLS 480

Query: 481 LGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF
Sbjct: 481 LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540

Query: 541 DGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSGN 598
           DG PS+   A APESLLTGCN+FLKNLNVTFRRDP SFRPRINKLDSQMDKEQK SGN
Sbjct: 541 DGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN 598

>Scas_636.14
          Length = 608

 Score = 1075 bits (2781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/599 (86%), Positives = 555/599 (92%), Gaps = 1/599 (0%)

Query: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60
           MS KN+RIAIVS D+CKPKKCRQECKRSCPVVKTGKLCIEV PTSKIAFISE LCIGCGI
Sbjct: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNL+  VTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRF+DPPEWQEIIKYFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLR+EK  +  K YI  LQL++VLNRE+  LSGGELQRFAIG+SCVQ+A
Sbjct: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA IIR LL PT YVI VEHDLSVLDYLSDFVCIIYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKR 360
           YGVVTLPSSVREGINIFLDGHIP+EN+RFR+EALQFR+ DA ++ + +A++ F YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKR 360

Query: 361 TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQD-IPKLNVSMKPQ 419
           TQGDFSLTVE+G+FSDS+ILVMMGENGTGKTTLIKLLAG I +D+  + + KLNVSMKPQ
Sbjct: 361 TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ 420

Query: 420 KIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 479
            IAPKF GTVRQLFFK+IR QFL+PQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 480

Query: 480 SLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
           +LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVIV
Sbjct: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV 540

Query: 540 FDGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSGN 598
           F+G PSK A ARAPESLLTGCN+FLKNLNVTFRRD TSFRPRINKLDSQMD+EQK SGN
Sbjct: 541 FEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSGN 599

>Kwal_56.23429
          Length = 539

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/539 (88%), Positives = 510/539 (94%), Gaps = 1/539 (0%)

Query: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60
           MS+KN RIAIV+EDKCKPKKCRQECKRSCPVVKTGKLCIEV PT+KIAFISE LCIGCGI
Sbjct: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60

Query: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAIQIINLPTNL+ +VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR++DPPEWQ+II+YFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240
           KGPVQKVGELLKLRLE+S+DDAK  I  L L++VL R+V ALSGGELQRFAIGMSCVQEA
Sbjct: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAAL+IRSLLN TTYVI VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEA-DASRAFTYPDMK 359
           YGVVTLPSSVREGINIFL+GHIPSEN+RFR EALQFRM DA ++LEA DA+R+F YP MK
Sbjct: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360

Query: 360 RTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQ 419
           RTQGDF L VE+G FSDS+ILVMMGENGTGKTTLIKLLAGA+  DDGQ +PKLNVSMKPQ
Sbjct: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420

Query: 420 KIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 479
           KIAPKF GTVRQLFFKRIR QFLNPQFQTDVVKPLKI+ IIDQEVQHLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480

Query: 480 SLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 538
           +LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVI
Sbjct: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMATYLADKVI 539

 Score =  105 bits (261), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/243 (33%), Positives = 121/243 (49%), Gaps = 50/243 (20%)

Query: 378 QILVMMGENGTGKTTLIKLLAGAIPADDGQ--DIPKLNVSMKPQKIAPKFTGTVRQLFFK 435
           Q+L ++G NG GK+T +K+LAG    + G+  D P+       Q I   F G+  Q +F 
Sbjct: 104 QVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEW------QDIIRYFRGSELQNYFT 157

Query: 436 R-----IRAQFLNPQF--------------------------QTD---VVKPLKIDDIID 461
           +     I+A  + PQ+                          Q D   V+K L +  ++ 
Sbjct: 158 KMLEDNIKA-IIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLK 216

Query: 462 QEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           ++V  LSGGELQR AI +S    AD+Y+ DEPS+YLD +QR+  + VIR  +  N  T  
Sbjct: 217 RDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL--NATTYV 274

Query: 522 I-VEHDFIMATYLADKVIVFDGIPSKQAFARAPESLLTGCNKFLK----NLNVTFRRDPT 576
           I VEHD  +  YL+D V +  G+PS       P S+  G N FL+    + N+ FR++  
Sbjct: 275 ISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEAL 334

Query: 577 SFR 579
            FR
Sbjct: 335 QFR 337

>KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomyces
           cerevisiae YPL226w NEW1, start by similarity
          Length = 1183

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 84/330 (25%), Positives = 127/330 (38%), Gaps = 82/330 (24%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ E  P+   +   F   +LQ       E 
Sbjct: 583 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPDKDTLRTCFVEHKLQGE-----EG 631

Query: 163 DIKAI----IKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNRE 218
           D+  +    + P   D     I   ++ VG           DD +R           ++ 
Sbjct: 632 DLDLVSFIALDPILKDVSKEDISNALESVG----------FDDYRR-----------SQT 670

Query: 219 VSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYV-ICV 277
           V +LSGG   +  +  + +Q ADV + DEP+++LDV    N   +   LL  T    + V
Sbjct: 671 VGSLSGGWKMKLELARAMLQRADVLLLDEPTNHLDVA---NVKWLQDYLLEHTDITSLIV 727

Query: 278 EHDLSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGH 321
            HD   LD                Y  +    +   P      TL +S  +        H
Sbjct: 728 SHDSGFLDTVCTDIIHYENKKLAYYKGNLADFVEQKPEAKAYYTLTNSNAQ-------MH 780

Query: 322 IPS----ENLRFRTEALQFRMADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDS 377
            P       ++  T A+  +M D            FTYP   +     SL+  +   S S
Sbjct: 781 FPPPGILSGVKSNTRAVA-KMTDV----------TFTYPGASKP----SLSNVSCALSLS 825

Query: 378 QILVMMGENGTGKTTLIKLLAGAIPADDGQ 407
             + ++G NG GK+TLIKLL G +  D G+
Sbjct: 826 SRVAILGPNGAGKSTLIKLLNGELLPDSGK 855

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 73/155 (47%), Gaps = 22/155 (14%)

Query: 382 MMGENGTGKTTLIKLLA-GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQ 440
           + G NG GK+TL++ +A G +     +D      +++   +  K  G    L      A 
Sbjct: 588 LCGRNGAGKSTLMRSIANGQLEGFPDKD------TLRTCFVEHKLQGEEGDLDLVSFIA- 640

Query: 441 FLNPQFQ-------TDVVKPLKIDDII-DQEVQHLSGGELQRVAIVLSLGMNADIYLIDE 492
            L+P  +       ++ ++ +  DD    Q V  LSGG   ++ +  ++   AD+ L+DE
Sbjct: 641 -LDPILKDVSKEDISNALESVGFDDYRRSQTVGSLSGGWKMKLELARAMLQRADVLLLDE 699

Query: 493 PSAYLDSEQRIICSKVIRRFIL-HNKKTAFIVEHD 526
           P+ +LD    +   K ++ ++L H   T+ IV HD
Sbjct: 700 PTNHLD----VANVKWLQDYLLEHTDITSLIVSHD 730

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 467  LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            LSGG+L +V I  ++  N  + ++DEP+ YLD +     +  IR +         I  ++
Sbjct: 1020 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMISHNN 1076

Query: 527  FIMATYLADKVIVFDGIPSKQAFARAPESLLT-GCNKFLKNLNVT 570
              +     ++ IV +G   ++  A   +S    G N     LNVT
Sbjct: 1077 EFVGALCPEQWIVENGTMVQKGIAEIDQSRFEDGGNTNAVGLNVT 1121

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPP 138
           + ++G NG GKST +K+L G+  P+ G+ E  P
Sbjct: 828 VAILGPNGAGKSTLIKLLNGELLPDSGKVEKHP 860

>AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH]
           complement(572196..574457) [2262 bp, 753 aa]
          Length = 753

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 102/228 (44%), Gaps = 50/228 (21%)

Query: 67  FDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGK 126
           +D  Q++    NLD Q+  R                   + LVG NG GK+T LK++  +
Sbjct: 542 YDESQLLLKDVNLDVQMDSR-------------------IALVGANGCGKTTLLKVMMEQ 582

Query: 127 QKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQK 186
            +P  G     P  +  I YF     Q++   M   D+ A      VD + +   G    
Sbjct: 583 LRPITGHVSRNPRLR--IGYF----TQHHIDSM---DLNA----SAVDWMSKTFPG---- 625

Query: 187 VGELLKLRLEKSKDDAKRYIDILQLKNVLN-REVSALSGGELQRFAIGMSCVQEADVYMF 245
                     K+ ++ +R++    +   L  +++  LSGG+  R A    C+    + + 
Sbjct: 626 ----------KTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILIL 675

Query: 246 DEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCI 293
           DEPS++LD    L+A  ++++L N +  V+ V HD+SV+D + D + +
Sbjct: 676 DEPSNHLDTAG-LDA--LVQALKNFSGGVLMVSHDISVIDSVCDEIWV 720

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 122/540 (22%), Positives = 209/540 (38%), Gaps = 134/540 (24%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFEDPPEW-- 140
           G+  GLVG NGIGKST L+ L+                    G     L    D   W  
Sbjct: 226 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDDTKVLQSVLDADVWRK 285

Query: 141 QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKD 200
           Q + +  + +E      K+  +  +  ++ + +DN    ++  +Q++ E L   +E  K 
Sbjct: 286 QLLSEELKINERLQDIDKLRAEFDEDSLEVKKLDNERDDLESHLQQIAEKLA-DMESDKA 344

Query: 201 DAKRYIDILQL---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV--- 254
           +A+    +  L        +  ++ SGG   R ++  +   + D+ + DEPS+ LDV   
Sbjct: 345 EARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSI 404

Query: 255 -------KQRLNAALII---RSLLNPTTYVICVEHDLSVLDYL--SDFVCIIYGVPSVYG 302
                  K      L++   RS LN     I  +H+   LDY    DF        S Y 
Sbjct: 405 AYLAEYLKTYPATVLVVSHDRSFLNEVATDIIYQHN-ERLDYYRGQDF-------DSFYA 456

Query: 303 V---------------VTLPSSVREGINIFLDGHIPSENLRFRTEALQ------------ 335
                           +     ++E I+ +      S+  + R + L+            
Sbjct: 457 TKEERRKNAQREYDNQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVLEPPEEEK 516

Query: 336 ---FRMADAGDELE------ADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGEN 386
              F+ AD  ++L        D S  F Y + +    D +L V+     DS+I  ++G N
Sbjct: 517 SITFKFADC-EKLSPPIIQLQDVS--FGYDESQLLLKDVNLDVQM----DSRI-ALVGAN 568

Query: 387 GTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFT-GTVRQLFFKRIRAQFLNPQ 445
           G GKTTL+K++   +    G      +VS  P+     FT   +  +        +++  
Sbjct: 569 GCGKTTLLKVMMEQLRPITG------HVSRNPRLRIGYFTQHHIDSMDLNASAVDWMSKT 622

Query: 446 FQTDVVKPLKIDD--------------IIDQEVQHLSGGELQRVAIVLSLGMNA-DIYLI 490
           F      P K D+              +  Q++Q LSGG+  RVA   +L +N+  I ++
Sbjct: 623 F------PGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFA-ALCLNSPHILIL 675

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV--------FDG 542
           DEPS +LD+       + ++ F         +V HD  +   + D++ V        FDG
Sbjct: 676 DEPSNHLDTAGLDALVQALKNF----SGGVLMVSHDISVIDSVCDEIWVSESGTVKRFDG 731

>Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement
          Length = 1179

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 124/326 (38%), Gaps = 74/326 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ E  P+   +   F   +LQ       E 
Sbjct: 578 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPDKDTLRTRFVEHKLQGE-----EG 626

Query: 163 DIKAI----IKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNRE 218
           D+  +    + P+        I   ++ VG           DD +R           ++ 
Sbjct: 627 DLDLVSFIALDPELQGVSREDIANALESVG----------FDDYRR-----------SQT 665

Query: 219 VSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYV-ICV 277
           V +LSGG   +  +  + +Q+ADV + DEP+++LDV    N   +   LL  T    + V
Sbjct: 666 VGSLSGGWKMKLELARAMLQKADVLLLDEPTNHLDVA---NVKWLEDYLLEHTEITSLIV 722

Query: 278 EHDLSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGH 321
            HD   LD                Y  +    +   P      TL  +            
Sbjct: 723 SHDSGFLDAVCTEIIHYENKKLAYYKGNLAAFVEQKPEAKAYYTLTDT------------ 770

Query: 322 IPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILV 381
             +  +RF    +   +      +      +FTYP   +     SLT  +   S S  + 
Sbjct: 771 --NAQMRFPPPGILTGVKSNTRAVAKVTGVSFTYPGASQP----SLTDVSCSLSLSSRVA 824

Query: 382 MMGENGTGKTTLIKLLAGAIPADDGQ 407
           ++G NG GK+TLIKLL G +   +G+
Sbjct: 825 VLGPNGAGKSTLIKLLTGELVPQEGK 850

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 74/155 (47%), Gaps = 22/155 (14%)

Query: 382 MMGENGTGKTTLIKLLA-GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQ 440
           + G NG GK+TL++ +A G +     +D      +++ + +  K  G    L      A 
Sbjct: 583 LCGRNGAGKSTLMRSIANGQLEGFPDKD------TLRTRFVEHKLQGEEGDLDLVSFIA- 635

Query: 441 FLNPQFQ-------TDVVKPLKIDDII-DQEVQHLSGGELQRVAIVLSLGMNADIYLIDE 492
            L+P+ Q        + ++ +  DD    Q V  LSGG   ++ +  ++   AD+ L+DE
Sbjct: 636 -LDPELQGVSREDIANALESVGFDDYRRSQTVGSLSGGWKMKLELARAMLQKADVLLLDE 694

Query: 493 PSAYLDSEQRIICSKVIRRFIL-HNKKTAFIVEHD 526
           P+ +LD    +   K +  ++L H + T+ IV HD
Sbjct: 695 PTNHLD----VANVKWLEDYLLEHTEITSLIVSHD 725

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 467  LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 518
            LSGG+L +V I  ++  N  + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1014 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWTGGVVMISHNNE 1071

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQN 154
           + ++G NG GKST +K+L G+  P  G+ E  P  +  I Y     LQ+
Sbjct: 823 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHPNLR--IGYIAQHALQH 869

>Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement
          Length = 752

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 87/189 (46%), Gaps = 31/189 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKVMMEQLRPTKGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLN-REVSALSG 224
             +    VD + +   G              K+ ++ +R++    +   L  +++  LSG
Sbjct: 610 --LNTSAVDWMSKTFPG--------------KTDEEYRRHLGAFGITGSLGLQKMQLLSG 653

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD    L+A  +I +L N T  V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LIDALKNFTGGVLMVSHDISVI 710

Query: 285 DYLSDFVCI 293
           D++   + +
Sbjct: 711 DHVCSEIWV 719

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 116/528 (21%), Positives = 200/528 (37%), Gaps = 110/528 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFEDPPEW-- 140
           G+  GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKD 200
           Q + +  + +E      K+ E+  +  ++ + +DN    +   ++++ E L + +E  K 
Sbjct: 285 QLLSEESKINERLQEIEKLREEFDEDSLEVKKLDNEREDLDNHLEQISEKL-VDMESDKA 343

Query: 201 DAKRYIDILQL---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           +A+    +  L        +  ++ SGG   R ++  +   + D+ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVP-- 401

Query: 258 LNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIY------------GVPSVYGVVT 305
            + A +   L      V+ V HD + L+ ++    IIY               + Y    
Sbjct: 402 -SIAYLSEYLKTYPATVLVVSHDRAFLNEVA--TDIIYQHNERLDYYRGQDFDTFYATKE 458

Query: 306 --LPSSVREGIN-IFLDGHIPSENLRFRTEALQFRMADAG----------DELEADASRA 352
               ++ RE  N +    H+     ++R  A + + A +           +  E + S  
Sbjct: 459 ERRKNAQREYENQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVLEPPEEEKSIN 518

Query: 353 FTYPDMKRTQ------GDFSLTVEAGE--FSDSQILVMM-------GENGTGKTTLIKLL 397
           F +PD ++         D S   E       D  + V M       G NG GKTTL+K++
Sbjct: 519 FKFPDCEKLSPPIIQLQDVSFGYEENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVM 578

Query: 398 AGAIPADDGQDIPKLNVSMKPQKIAPKFT-GTVRQLFFKRIRAQFLNPQFQTDVVKPLKI 456
              +    G       VS  P+     FT   V  +        +++  F      P K 
Sbjct: 579 MEQLRPTKGY------VSRNPRLRIGYFTQHHVDSMDLNTSAVDWMSKTF------PGKT 626

Query: 457 DD--------------IIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQR 502
           D+              +  Q++Q LSGG+  RVA       N  I ++DEPS +LD+   
Sbjct: 627 DEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGL 686

Query: 503 IICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV--------FDG 542
                 ++ F         +V HD  +  ++  ++ V        FDG
Sbjct: 687 DALIDALKNFT----GGVLMVSHDISVIDHVCSEIWVSEDGTVKRFDG 730

>AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH]
           complement(186656..190225) [3570 bp, 1189 aa]
          Length = 1189

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 83/328 (25%), Positives = 127/328 (38%), Gaps = 78/328 (23%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ ++       G+ E  P   E+   F    L+     +  D
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSISN------GQLEGFPSQDELKTCFVERALEGEDGSV--D 641

Query: 163 DIKAIIKPQYVDNIPR-AIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSA 221
            +  +     ++N PR  I   ++ VG            DA R            + V +
Sbjct: 642 IVSFLASAPSLENTPRKEIVAALESVGF-----------DADRRA----------QTVGS 680

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYV-ICVEHD 280
           LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LLN T    + V HD
Sbjct: 681 LSGGWKMKLELTRAILQKADILLLDEPTNHLDVA---NVRWLEEYLLNNTEITSLIVSHD 737

Query: 281 LSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPS 324
              LD                Y  +    +   P      TL  S  +        H P+
Sbjct: 738 TGFLDKVCTDIIHYENKKLAYYKGNLHDFVEQKPEAKSYYTLTDSNAQ-------MHFPA 790

Query: 325 ----ENLRFRTEALQFRMADAGDELEADASRAFTYPDM-KRTQGDFSLTVEAGEFSDSQI 379
                 ++  T A+  +M D            FTYP   K +  D S +      S S  
Sbjct: 791 PGILSGVKSNTRAVA-KMTDV----------TFTYPGAPKPSMADVSCS-----LSLSSR 834

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDGQ 407
           + ++G NG GK+TLIKLL G +    G+
Sbjct: 835 VAIIGPNGAGKSTLIKLLTGELVPTSGK 862

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 73/177 (41%), Gaps = 48/177 (27%)

Query: 382 MMGENGTGKTTLIKLLAG-------------------AIPADDGQ-DIPKLNVSMKPQKI 421
           + G NG GK+TL++ ++                    A+  +DG  DI     S      
Sbjct: 595 LCGRNGAGKSTLMRSISNGQLEGFPSQDELKTCFVERALEGEDGSVDIVSFLAS------ 648

Query: 422 APKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSL 481
           AP    T R    K I A   +  F  D            Q V  LSGG   ++ +  ++
Sbjct: 649 APSLENTPR----KEIVAALESVGFDADRRA---------QTVGSLSGGWKMKLELTRAI 695

Query: 482 GMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK-TAFIVEHDFIMATYLADKV 537
              ADI L+DEP+ +LD    +   + +  ++L+N + T+ IV HD    T   DKV
Sbjct: 696 LQKADILLLDEPTNHLD----VANVRWLEEYLLNNTEITSLIVSHD----TGFLDKV 744

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 467  LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRF----ILHNKKTAFI 522
            LSGG+L +V I  ++  N  + ++DEP+ YLD +     +  IR +    ++ +  T F+
Sbjct: 1027 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREWTGGVVMISHSTEFV 1086

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 4/92 (4%)

Query: 219  VSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVE 278
            + +LSGG+L +  I  +      + + DEP++YLD       A+ IR     T  V+ + 
Sbjct: 1024 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMIS 1080

Query: 279  HDLSVLDYLSDFVCIIY-GVPSVYGVVTLPSS 309
            H    +  L     I+  G     GVVT+  S
Sbjct: 1081 HSTEFVGALCPEQWIVENGTMVQKGVVTVDQS 1112

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQN 154
           + ++G NG GKST +K+L G+  P  G+ E  P  +  I Y     LQ+
Sbjct: 835 VAIIGPNGAGKSTLIKLLTGELVPTSGKVEKHPNLR--IGYIAQHALQH 881

>Scas_618.3
          Length = 793

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 89/190 (46%), Gaps = 33/190 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQ-NYFTKMLEDDI 164
           + LVG NG GK+T LK++  + +P  G               R   L+  YFT+   D +
Sbjct: 602 IALVGANGCGKTTLLKVMMEELRPTKGFVS------------RNGRLRIGYFTQHHVDSM 649

Query: 165 KAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLN-REVSALS 223
              +    VD + +A  G              K+ ++ + ++    +   L  +++  LS
Sbjct: 650 D--LTTSAVDWMSKAYPG--------------KTDEEYRHHLGSFGITGTLGLQKMELLS 693

Query: 224 GGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSV 283
           GG+  R A    C+    + + DEPS++LD    L+A  ++ SL N +  V+ V HD+S+
Sbjct: 694 GGQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVESLKNFSGGVLMVSHDISI 750

Query: 284 LDYLSDFVCI 293
           +D++ + + +
Sbjct: 751 IDHVCNEIWV 760

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 92/222 (41%), Gaps = 39/222 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFEDPPEW-- 140
           G   GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 266 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHVSILHVEQELRGDETLALQSVLDADVWRK 325

Query: 141 ----QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLE 196
               +E     R  E+    ++  ED ++     + +DN    +   + ++ E L   +E
Sbjct: 326 QLLSEEAKINERLKEMDKLRSEFEEDSLEV----KKLDNEREDLDKHLIQIDEKLA-DME 380

Query: 197 KSKDDAKRYIDILQL---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
             K +A+    +  L        +  ++ SGG   R ++  +   + D+ + DEPS+ LD
Sbjct: 381 SDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD 440

Query: 254 VKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIY 295
           V      A  +++   P+T V+ V HD + L+ ++    IIY
Sbjct: 441 VPSIAYLAEYLKTY--PST-VLTVSHDRAFLNEVA--TDIIY 477

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 50/195 (25%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFK 435
           DS+I  ++G NG GKTTL+K++                  ++P K      G +R  +F 
Sbjct: 599 DSRI-ALVGANGCGKTTLLKVMME---------------ELRPTKGFVSRNGRLRIGYFT 642

Query: 436 RIRAQFLNPQFQTDVVK------PLKIDD--------------IIDQEVQHLSGGELQRV 475
           +     ++    T  V       P K D+              +  Q+++ LSGG+  RV
Sbjct: 643 QHHVDSMD--LTTSAVDWMSKAYPGKTDEEYRHHLGSFGITGTLGLQKMELLSGGQKSRV 700

Query: 476 AIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLAD 535
           A       N  I ++DEPS +LD+       + ++ F         +V HD  +  ++ +
Sbjct: 701 AFAALCLNNPHILVLDEPSNHLDTTGLDALVESLKNF----SGGVLMVSHDISIIDHVCN 756

Query: 536 KVIV--------FDG 542
           ++ V        FDG
Sbjct: 757 EIWVSENGTVKRFDG 771

>CAGL0B03487g complement(345399..348536) highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 or sp|P53978
           Saccharomyces cerevisiae YNL014w HEF3, start by
           similarity
          Length = 1045

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 127/319 (39%), Gaps = 64/319 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A  Q   +  F  P E                 T  +E 
Sbjct: 456 GRRYGLCGPNGAGKSTLMRAIANGQ---VDGFPTPEE---------------CMTVYVEH 497

Query: 163 DIKAIIKPQYV-DNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSA 221
           DI        V D +  +  G  + +                + ++    + ++N  +S+
Sbjct: 498 DIDGTHADTSVLDFVVSSEVGTKEAI--------------TAKLVEFGFTEEMINMPISS 543

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDL 281
           LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       + V HD 
Sbjct: 544 LSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSVIVSHDS 600

Query: 282 SVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEA--LQFRMA 339
             LD +  ++    G+        L   V++          P+    +   A  L+F+  
Sbjct: 601 GFLDNVCQYIIHYEGLKLRKYKGNLSEFVKK---------CPTAQSYYELGASDLEFKFP 651

Query: 340 DAGDELEADASR----------AFTYPDMKRTQ-GDFSLTVEAGEFSDSQILVMMGENGT 388
           + G  LE   ++           F YP   + Q  D S      + S S  + ++G NG 
Sbjct: 652 EPG-YLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISF-----QCSLSSRIAVIGPNGA 705

Query: 389 GKTTLIKLLAGAIPADDGQ 407
           GK+TLI +L G +    G+
Sbjct: 706 GKSTLINVLTGELLPTSGE 724

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 73/162 (45%), Gaps = 6/162 (3%)

Query: 382 MMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQF 441
           + G NG GK+TL++ +A      DG   P+  +++  +            L F       
Sbjct: 461 LCGPNGAGKSTLMRAIANG--QVDGFPTPEECMTVYVEHDIDGTHADTSVLDFVVSSEVG 518

Query: 442 LNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQ 501
                   +V+    +++I+  +  LSGG   ++A+  ++  NADI L+DEP+ +LD+  
Sbjct: 519 TKEAITAKLVEFGFTEEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT-- 576

Query: 502 RIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGI 543
             +    +  ++     T+ IV HD      +   +I ++G+
Sbjct: 577 --VNVAWLVNYLNTCGITSVIVSHDSGFLDNVCQYIIHYEGL 616

>Kwal_33.15561
          Length = 1297

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 91/198 (45%), Gaps = 33/198 (16%)

Query: 353  FTYPDMKR--TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPAD------ 404
            F+Y ++       + SL V+ GE     I+ ++G +G+GK+TL  LL    P +      
Sbjct: 1066 FSYSNINNPMVYKNLSLKVDRGE-----IVGLIGTSGSGKSTLWSLLTRLYPVENGSISI 1120

Query: 405  DGQDIPKLN----------VSMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQT----DV 450
            DG DI + +          V  KP   +      +     +++  + +N    T    + 
Sbjct: 1121 DGTDINQWDRKALRSCIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEF 1180

Query: 451  VK--PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKV 508
            V   P ++  +ID   Q LSGG++QR+AIV +L     + ++DE ++ LD+    I S+ 
Sbjct: 1181 VNSTPKRLHSVID--TQLLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEF 1238

Query: 509  IRRFILHNKKTAFIVEHD 526
            ++  + H   T  +V H 
Sbjct: 1239 VKHHLYHT--TTLVVTHS 1254

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 85/188 (45%), Gaps = 29/188 (15%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
            G+++GL+GT+G GKST   +L        G                G+++  +  K L  
Sbjct: 1087 GEIVGLIGTSGSGKSTLWSLLTRLYPVENGSIS-----------IDGTDINQWDRKALRS 1135

Query: 163  DIKAI-IKPQY-----VDNIPRAIKGPV--QKVGELLKL--RLEKSKDDAKRYIDILQLK 212
             I  +  KP +     ++N+   +   V  ++V ELL     LE      KR      L 
Sbjct: 1136 CIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKR------LH 1189

Query: 213  NVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTT 272
            +V++ ++  LSGG++QR AI  + +++  + + DE +S LD +     +  ++  L  TT
Sbjct: 1190 SVIDTQL--LSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEFVKHHLYHTT 1247

Query: 273  YVICVEHD 280
             ++    +
Sbjct: 1248 TLVVTHSE 1255

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 91/202 (45%), Gaps = 35/202 (17%)

Query: 352 AFTYPDMKR--TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-------AGAIP 402
           +F YP   +     + +L V  G F+      ++G++G+GK+T+  LL       +G I 
Sbjct: 366 SFAYPSRSKHPVIKNLNLKVPGGRFT-----FIVGKSGSGKSTISNLLLKLYRPCSGLIK 420

Query: 403 ADDGQDIPKLN-------VSMKPQKIAPKFTGTVR---QLFFKRIR-----AQFLNPQFQ 447
            +D  DI ++N       +++  Q  +P F  +++   QL     R     +Q       
Sbjct: 421 VND-VDIREINQQDLFRSITLVEQN-SPLFEDSIKNNIQLTSDEHRDDGRLSQACQAAML 478

Query: 448 TDVVKPLK--IDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIIC 505
             V++ L   +D II      LSGGE QRVA+  +   ++ I ++DE  +  D   + + 
Sbjct: 479 EGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLL 538

Query: 506 SKVIRRFILHNKKTAFIVEHDF 527
            + IR +     +T  I+ H+ 
Sbjct: 539 MEAIRFW--RKGRTTIILTHEL 558

>Kwal_0.167
          Length = 1044

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 91/206 (44%), Gaps = 29/206 (14%)

Query: 214 VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTY 273
           ++N  +S+LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L      
Sbjct: 536 MINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGIT 592

Query: 274 VICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEA 333
            I V HD   LD ++ ++    G+        +   V++          P+    +   A
Sbjct: 593 SIIVSHDSGFLDNVTQYIIHYEGLKLRKYKGNMSEFVKK---------CPTAKSYYELGA 643

Query: 334 --LQFRMADAG---------DELEADASRAFTYPDMKRTQ-GDFSLTVEAGEFSDSQILV 381
             L+FR  + G           +   ++  F YP   + Q  D S      + S S  + 
Sbjct: 644 SELEFRFPEPGFLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISF-----QCSLSSRIA 698

Query: 382 MMGENGTGKTTLIKLLAGAIPADDGQ 407
           ++G NG GK+TLI +L G +    G+
Sbjct: 699 VIGPNGAGKSTLINVLTGELLPTSGE 724

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 28/173 (16%)

Query: 382 MMGENGTGKTTLIKLLA-GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQ 440
           + G NG GK+TL++ +A G +     QD        +   +     GT            
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQD------ECRTVYVEHDIDGT-------HSDTS 507

Query: 441 FLNPQFQTDVVKPLKI----------DDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLI 490
            L+  FQ DV     I          D++I+  +  LSGG   ++A+  ++  NADI L+
Sbjct: 508 VLDFVFQGDVGTKEAITDKLREFGFSDEMINMPISSLSGGWKMKLALARAVLKNADILLL 567

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGI 543
           DEP+ +LD+    +    +  ++     T+ IV HD      +   +I ++G+
Sbjct: 568 DEPTNHLDT----VNVAWLVNYLNTCGITSIIVSHDSGFLDNVTQYIIHYEGL 616

>YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the
           non-transporter group of the ATP-binding cassette (ABC)
           superfamily, also a prion responsible for the [NU+]
           determinant [3591 bp, 1196 aa]
          Length = 1196

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 124/323 (38%), Gaps = 68/323 (21%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ +  P+   +   F   +LQ     +  D
Sbjct: 597 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPDKDTLRTCFVEHKLQGEEGDL--D 648

Query: 163 DIKAIIKPQYVDNIPRA-IKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSA 221
            +  I   + + +  R  I   ++ VG           D+ +R            + V +
Sbjct: 649 LVSFIALDEELQSTSREEIAAALESVG----------FDEERRA-----------QTVGS 687

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYV-ICVEHD 280
           LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LL  T    + V HD
Sbjct: 688 LSGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLEEYLLEHTDITSLIVSHD 744

Query: 281 LSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPS 324
              LD                Y  +    +   P      TL  S              +
Sbjct: 745 SGFLDTVCTDIIHYENKKLAYYKGNLAAFVEQKPEAKSYYTLTDS--------------N 790

Query: 325 ENLRFRTEALQFRMADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMG 384
             +RF    +   +      +       F+YP  ++     SL+  +   S S  +  +G
Sbjct: 791 AQMRFPPPGILTGVKSNTRAVAKMTDVTFSYPGAQKP----SLSHVSCSLSLSSRVACLG 846

Query: 385 ENGTGKTTLIKLLAGAIPADDGQ 407
            NG GK+TLIKLL G +  ++G+
Sbjct: 847 PNGAGKSTLIKLLTGELVPNEGK 869

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 462 QEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 520
           Q V  LSGG   ++ +  ++   ADI L+DEP+ +LD    +   K +  ++L H   T+
Sbjct: 683 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLEEYLLEHTDITS 738

Query: 521 FIVEHD 526
            IV HD
Sbjct: 739 LIVSHD 744

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 467  LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 518
            LSGG+L +V I  ++  N  + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1033 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSGGVVMISHNNE 1090

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 109 VGTNGIGKSTALKILAGKQKPNLGRFEDPP 138
           +G NG GKST +K+L G+  PN G+ E  P
Sbjct: 845 LGPNGAGKSTLIKLLTGELVPNEGKVEKHP 874

>YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a protein
           complex required for activation of Gcn2p protein kinase
           in response to amino acid starvation, member of the
           non-transporter group within the ATP-binding cassette
           (ABC) superfamily [2259 bp, 752 aa]
          Length = 752

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 83/181 (45%), Gaps = 31/181 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LKI+  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLN-REVSALSG 224
             +    VD + ++  G              K+ ++ +R++    +   L  +++  LSG
Sbjct: 610 --LTTSAVDWMSKSFPG--------------KTDEEYRRHLGSFGITGTLGLQKMQLLSG 653

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD    L+A  ++ +L N    V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVEALKNFNGGVLMVSHDISVI 710

Query: 285 D 285
           D
Sbjct: 711 D 711

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 95/236 (40%), Gaps = 67/236 (28%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEII---KYFRGSELQNYFTKM 159
           G   GLVG NGIGKST L+ L+ ++        + P+   I+   +  RG          
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRREL-------NVPKHVSILHVEQELRG---------- 267

Query: 160 LEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLK----LRLE--------KSKDDAKRYID 207
             DD KA+      D   + +     K+ E LK    LR E        K  D+ +  +D
Sbjct: 268 --DDTKALQSVLDADVWRKQLLSEEAKINERLKEMDVLRQEFEEDSLEVKKLDNEREDLD 325

Query: 208 --ILQLKNVL--------------------------NREVSALSGGELQRFAIGMSCVQE 239
             ++Q+ + L                           +  ++ SGG   R ++  +   +
Sbjct: 326 NHLIQISDKLVDMESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQ 385

Query: 240 ADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIY 295
            D+ + DEPS+ LDV      A  +++   P T V+ V HD + L+ ++    IIY
Sbjct: 386 PDLLLLDEPSNMLDVPSIAYLAEYLKTY--PNT-VLTVSHDRAFLNEVA--TDIIY 436

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 67/156 (42%), Gaps = 18/156 (11%)

Query: 352 AFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDG--QDI 409
           +F Y +      D +L V+     DS+I  ++G NG GKTTL+K++   +    G     
Sbjct: 538 SFGYDENNLLLKDVNLDVQM----DSRI-ALVGANGCGKTTLLKIMMEQLRPLKGFVSRN 592

Query: 410 PKLNVSMKPQKIAPKFTGTVRQL------FFKRIRAQFLNPQFQTDVVKPLKIDDIIDQE 463
           P+L +    Q        T   +      F  +   ++        +   L +     Q+
Sbjct: 593 PRLRIGYFTQHHVDSMDLTTSAVDWMSKSFPGKTDEEYRRHLGSFGITGTLGL-----QK 647

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
           +Q LSGG+  RVA       N  I ++DEPS +LD+
Sbjct: 648 MQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDT 683

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 462 QEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  +L    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PNTVL 418

Query: 522 IVEHDFIMATYLADKVI 538
            V HD      +A  +I
Sbjct: 419 TVSHDRAFLNEVATDII 435

>Kwal_34.16240
          Length = 752

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 96/228 (42%), Gaps = 50/228 (21%)

Query: 67  FDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGK 126
           FD  Q++    NLD Q+  R                   + LVG NG GK+T LKIL  +
Sbjct: 541 FDPKQLLLKDVNLDVQMDSR-------------------IALVGANGCGKTTLLKILMEQ 581

Query: 127 QKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQK 186
            +P  G     P  +             YFT+   D +   +    VD +     G    
Sbjct: 582 LRPIQGYVSRNPRLRVA-----------YFTQHHVDSMD--LNTSAVDWMSTTFPG---- 624

Query: 187 VGELLKLRLEKSKDDAKRYIDILQLKNVLN-REVSALSGGELQRFAIGMSCVQEADVYMF 245
                     K+ ++ +R++    +   L  +++  LSGG+  R A    C+    + + 
Sbjct: 625 ----------KTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVL 674

Query: 246 DEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCI 293
           DEPS++LD    L+A  ++ +L   T  V+ V HD+SV+D + + + +
Sbjct: 675 DEPSNHLDTAG-LDA--LMDALKKFTGGVLMVSHDISVIDGVCNEIWV 719

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 94/222 (42%), Gaps = 39/222 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFEDPPEW-- 140
           G   G+VG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGIVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALNSVLDADVWRK 284

Query: 141 ----QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLE 196
               +E     R  E++   ++  ED +++    + +DN    ++  ++++ E L + +E
Sbjct: 285 QLLSEESKINERLQEIEKLRSEFEEDSLES----KKLDNEREDLESHLEQISEKL-IDME 339

Query: 197 KSKDDAKRYIDILQL---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
             K +A+    +  L        +  ++ SGG   R ++  +   + D+ + DEPS+ LD
Sbjct: 340 SDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD 399

Query: 254 VKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIY 295
           V    + A +   L      V+ V HD + L+ ++    IIY
Sbjct: 400 VP---SIAYLSEYLKTYPATVVVVSHDRAFLNEVA--TDIIY 436

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 76/180 (42%), Gaps = 34/180 (18%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDG--QDIPKLNVSMKPQK------------- 420
           DS+I  ++G NG GKTTL+K+L   +    G     P+L V+   Q              
Sbjct: 558 DSRI-ALVGANGCGKTTLLKILMEQLRPIQGYVSRNPRLRVAYFTQHHVDSMDLNTSAVD 616

Query: 421 -IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 479
            ++  F G   + + + + A          +   L +     Q++Q LSGG+  RVA   
Sbjct: 617 WMSTTFPGKTDEEYRRHLGA--------FGITGSLGL-----QKMQLLSGGQKSRVAFAA 663

Query: 480 SLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
               N  I ++DEPS +LD+         +++F         +V HD  +   + +++ V
Sbjct: 664 LCLNNPHILVLDEPSNHLDTAGLDALMDALKKFT----GGVLMVSHDISVIDGVCNEIWV 719

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 462 QEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  +L    D+ L+DEPS  LD       S+ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVV 418

Query: 522 IVEHDFIMATYLADKVI 538
           +V HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>Scas_566.1
          Length = 466

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 107/233 (45%), Gaps = 42/233 (18%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGR-------FEDPPEWQE 142
           NSF L  LP+   G V+ ++G +G GK+T L +LA K    L          E+ P+   
Sbjct: 68  NSFSLD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGLKTDGDIHYILEEKPQ--- 120

Query: 143 IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDA 202
                R SE +    + ++D +K    PQ   ++  A     + +     L+L++SK++ 
Sbjct: 121 -----RDSEQE----QEVQDHVKMAYLPQ--QDVLSARLTCRETLMYAADLKLDRSKEEK 169

Query: 203 KRYIDIL----QLKNVLNREVS-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           K  +D L     LK+     V       LSGGE +R ++G   +    +   DEP++ LD
Sbjct: 170 KLVVDQLIHELGLKDCAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLD 229

Query: 254 VKQRLNAALIIRSLL-----NPTTYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
                +A L++++L      +  T+++ +    S + +L D VCI+     VY
Sbjct: 230 A---YSAYLVVKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGKVVY 279

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 90/214 (42%), Gaps = 57/214 (26%)

Query: 365 FSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPA---DDGQDIPKLNVSMKPQKI 421
           FSL + +G      ++ +MG +G+GKTTL+ +LA  I      DG DI  + +  KPQ+ 
Sbjct: 70  FSLDLPSG-----SVMAVMGGSGSGKTTLLNVLASKISGGLKTDG-DIHYI-LEEKPQRD 122

Query: 422 APKFTGTVRQLFFKRIRAQFLNPQ--------------FQTDV-------VKPLKIDDII 460
           + +      Q     ++  +L  Q              +  D+        K L +D +I
Sbjct: 123 SEQ-----EQEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQLI 177

Query: 461 --------------DQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICS 506
                         D   + LSGGE +R+++   +  N  I  +DEP+  LD+    +  
Sbjct: 178 HELGLKDCAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVV 237

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           K +++    + +T       FIM+ +     I+F
Sbjct: 238 KTLKKLAKEDGRT-------FIMSIHQPRSDILF 264

>Kwal_0.327
          Length = 1019

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 95/208 (45%), Gaps = 34/208 (16%)

Query: 371 AGEFSDSQILVMMGENGTGKTTLIKLLA---------GAIPADDGQDIPKLNVSM----- 416
           +G     +I+ +MG +G GKTTL+ +LA         G+I  + G +I K N+S      
Sbjct: 389 SGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKASGSIKIN-GSEITKQNLSKIAGFV 447

Query: 417 -KPQKIAPKFT--GTVRQLFFKRI--RAQFLNPQFQT-DVVKPLKIDDIIDQEV-----Q 465
            +   + P  T   TV      R+  +  F+  Q +   V++ L+I DI D+ +     +
Sbjct: 448 DQENFLLPTLTVYETVLNSALLRLPRKLSFVQKQKRVYQVLEELRILDIKDRIIGDDLER 507

Query: 466 HLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
            +SGGE +RV+I   L  +  +  +DEP++ LDS       + + R  LH  +T  +  H
Sbjct: 508 GISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSNNANNVIECLVRLALHYNRTLILSIH 567

Query: 526 --------DFIMATYLADKVIVFDGIPS 545
                    F     L+   +VF G+ +
Sbjct: 568 QPRSNIFKSFDKLVLLSQGEMVFSGVAT 595

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 83/200 (41%), Gaps = 22/200 (11%)

Query: 74  NLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGR 133
           N+  N+ S+   R   N        + +PG+++ L+G +G GK+T L ILA K K     
Sbjct: 370 NIEYNIRSEKGERMILNGIS----GSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKAS 425

Query: 134 FEDPPEWQEIIKYFRGS-----ELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVG 188
                   EI K          + +N+    L   +   +    +  +PR +   VQK  
Sbjct: 426 GSIKINGSEITKQNLSKIAGFVDQENFLLPTL--TVYETVLNSALLRLPRKLSF-VQKQK 482

Query: 189 ELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEP 248
            + ++  E    D K  I    + + L R    +SGGE +R +I    V    V   DEP
Sbjct: 483 RVYQVLEELRILDIKDRI----IGDDLER---GISGGEKRRVSIACELVTSPSVLFLDEP 535

Query: 249 SSYLDVKQRLNAALIIRSLL 268
           +S LD     NA  +I  L+
Sbjct: 536 TSGLDSN---NANNVIECLV 552

>Scas_720.36
          Length = 1190

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 77/333 (23%), Positives = 129/333 (38%), Gaps = 88/333 (26%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKM--- 159
           G   GL G NG GKST ++ +A       G+ +  P+   +   F   +LQ     +   
Sbjct: 593 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPDKDTLRTCFVEHKLQGEEGDLDLV 646

Query: 160 ----LEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVL 215
               L+++++A  + +        I   ++ VG           D+ +R           
Sbjct: 647 SFIALDEELQATSREE--------ISNALEHVG----------FDEERRA---------- 678

Query: 216 NREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYV- 274
            + V +LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LL  T    
Sbjct: 679 -QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLQDYLLEHTDITS 734

Query: 275 ICVEHDLSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFL 318
           + V HD   LD                Y  +    +   P      TL  S  +      
Sbjct: 735 LIVSHDSGFLDTVCTDIIHYENKKLAYYKGNLADFVEQKPEAKSYYTLSDSNAQ------ 788

Query: 319 DGHIPS----ENLRFRTEALQFRMADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEF 374
             H P       ++  T A+  +M D            F+YP   +     SL+  +   
Sbjct: 789 -MHFPPPGILTGVKSNTRAVA-KMTDV----------TFSYPGADKP----SLSHVSCAL 832

Query: 375 SDSQILVMMGENGTGKTTLIKLLAGAIPADDGQ 407
           S S  + ++G NG GK+TLIKLL G +   +G+
Sbjct: 833 SLSSRVAVLGPNGAGKSTLIKLLTGELVPQEGK 865

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 462 QEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 520
           Q V  LSGG   ++ +  ++   ADI L+DEP+ +LD    +   K ++ ++L H   T+
Sbjct: 679 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLQDYLLEHTDITS 734

Query: 521 FIVEHD 526
            IV HD
Sbjct: 735 LIVSHD 740

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 467  LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRF 512
            LSGG+L +V I  ++  N  + ++DEP+ YLD +     +  IR +
Sbjct: 1029 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDW 1074

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPP 138
           + ++G NG GKST +K+L G+  P  G+ E  P
Sbjct: 838 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 870

>Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement
          Length = 1044

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 87/196 (44%), Gaps = 31/196 (15%)

Query: 219 VSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVE 278
           +++LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I V 
Sbjct: 541 IASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEA--LQF 336
           HD   LD +  ++    G+             R  ++ F+    P+    +   A  L+F
Sbjct: 598 HDSGFLDSVCQYIIHYEGLKL--------RKYRGNLSEFVK-KCPTAKSYYELGASELEF 648

Query: 337 RMADAGDELEADASR----------AFTYPDMKRTQ-GDFSLTVEAGEFSDSQILVMMGE 385
           R  + G  LE   ++           F YP   + Q  D S      + S S  + ++G 
Sbjct: 649 RFPEPG-YLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISF-----QCSLSSRIAVIGP 702

Query: 386 NGTGKTTLIKLLAGAI 401
           NG GK+TLI +L G +
Sbjct: 703 NGAGKSTLINVLTGEL 718

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 74/173 (42%), Gaps = 28/173 (16%)

Query: 382 MMGENGTGKTTLIKLLA-GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQ 440
           + G NG GK+TL++ +A G +     QD        +   +     GT            
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPSQD------ECRTVYVEHDIDGT-------HSDTS 507

Query: 441 FLNPQFQTDVVKPLKI----------DDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLI 490
            L   FQ DV     I          D++I+  +  LSGG   ++A+  ++  NADI L+
Sbjct: 508 VLEFVFQGDVGTKETISEKLREFGFSDEMIEMPIASLSGGWKMKLALARAVLKNADILLL 567

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGI 543
           DEP+ +LD+    +    +  ++     T+ IV HD      +   +I ++G+
Sbjct: 568 DEPTNHLDT----VNVAWLVNYLNTCGITSIIVSHDSGFLDSVCQYIIHYEGL 616

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLI--DEPSAYLDSEQRIICSKVIRRF 512
           ++ LSGG  Q+V +VL+ G     +LI  DEP+ YLD +     SK ++ F
Sbjct: 894 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF 942

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG 132
           + ++G NG GKST + +L G+  P +G
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTIG 723

>CAGL0D03674g 370066..373626 highly similar to tr|Q08972
           Saccharomyces cerevisiae YPL226w NEW1, start by
           similarity
          Length = 1186

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 123/311 (39%), Gaps = 44/311 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A  Q   L  F D                          
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSIANGQ---LDGFPD-------------------------- 620

Query: 163 DIKAIIKPQYVDNIPRAIKGPVQKVGEL-LKLRLEK-SKDDAKRYIDILQLKNVLNRE-V 219
             K  +K  +V++  +  +G +  V  + L  +L+  S+DD    +  +        + V
Sbjct: 621 --KDTLKTCFVEHKLQGEEGDLDLVSFIALDEQLQTTSRDDIANALASVGFDETRRAQTV 678

Query: 220 SALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYV-ICVE 278
            +LSGG   +  +  + +Q+AD+ + DEP+++LDV    N   +   LL  T    + V 
Sbjct: 679 GSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVA---NVKWLEEYLLEHTNITSLIVS 735

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREG--INIFLDGHIPSENLRFRTEALQF 336
           HD   LD +   +        +Y    L   V +      +      +  +RF    +  
Sbjct: 736 HDSGFLDAVCTDIIHYENKKLIYYKGNLAKFVEQKPEAKAYYTLSDTNAQMRFPPPGILT 795

Query: 337 RMADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKL 396
            +      +       FTYP         SL+  +   S S  + ++G NG GK+TLIKL
Sbjct: 796 GVKSNTRAVAKVTDVTFTYPGASTP----SLSHVSCALSLSSRVAVLGPNGAGKSTLIKL 851

Query: 397 LAGAIPADDGQ 407
           L G +   +G+
Sbjct: 852 LTGELVPQEGK 862

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 70/160 (43%), Gaps = 32/160 (20%)

Query: 382 MMGENGTGKTTLIKLLA-GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQ 440
           + G NG GK+TL++ +A G +     +D      ++K   +  K  G    L      A 
Sbjct: 595 LCGRNGAGKSTLMRSIANGQLDGFPDKD------TLKTCFVEHKLQGEEGDLDLVSFIA- 647

Query: 441 FLNPQFQTDVVKPLKIDDIID-------------QEVQHLSGGELQRVAIVLSLGMNADI 487
            L+ Q QT        DDI +             Q V  LSGG   ++ +  ++   ADI
Sbjct: 648 -LDEQLQT-----TSRDDIANALASVGFDETRRAQTVGSLSGGWKMKLELARAMLQKADI 701

Query: 488 YLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTAFIVEHD 526
            L+DEP+ +LD    +   K +  ++L H   T+ IV HD
Sbjct: 702 LLLDEPTNHLD----VANVKWLEEYLLEHTNITSLIVSHD 737

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 467  LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 518
            LSGG+L +V I  ++  N  + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1026 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDWSGGVVMISHNNE 1083

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPP 138
           + ++G NG GKST +K+L G+  P  G+ E  P
Sbjct: 835 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 867

>CAGL0M13739g complement(1346231..1348414) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1, hypothetical
           start
          Length = 727

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 99/215 (46%), Gaps = 35/215 (16%)

Query: 352 AFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQ---- 407
            F Y   ++   + S T+ AG  +      + G +G+GK+T++KL+      ++G+    
Sbjct: 471 TFGYDGQRKILKNASFTIPAGMKT-----AIAGPSGSGKSTVLKLVFRFYDPEEGRVLVN 525

Query: 408 -------DIPKLN--VSMKPQKIAPKFTGTVRQ-LFFKRIRAQFLNPQFQTDVVKPLKID 457
                  DI +L   + + PQ   P F  T+ + + F RI A   + +  T V+   ++ 
Sbjct: 526 GVDVREYDIDQLRKAIGVVPQD-TPLFNDTIWENVKFGRIEA---SDEEITRVIDKAQLS 581

Query: 458 DIIDQEVQ-----------HLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICS 506
           D+I +  Q            +SGGE QR+AI   L  +ADI   DE ++ LD+       
Sbjct: 582 DLIAKLPQGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLL 641

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFD 541
           + IRR     +KT+  + H  +     ADK+IV +
Sbjct: 642 RTIRRNFNSGEKTSVYIAHR-LRTIADADKIIVLE 675

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 77/181 (42%), Gaps = 34/181 (18%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLE 161
            G    + G +G GKST LK++         RF DP E + ++    G +++ Y    L 
Sbjct: 490 AGMKTAIAGPSGSGKSTVLKLVF--------RFYDPEEGRVLVN---GVDVREYDIDQLR 538

Query: 162 DDIKAIIK--PQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREV 219
             I  + +  P + D I   +K            R+E S ++  R ID  QL +++ +  
Sbjct: 539 KAIGVVPQDTPLFNDTIWENVKFG----------RIEASDEEITRVIDKAQLSDLIAKLP 588

Query: 220 SA-----------LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
                        +SGGE QR AI    +++AD+  FDE +S LD     +    IR   
Sbjct: 589 QGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNF 648

Query: 269 N 269
           N
Sbjct: 649 N 649

>CAGL0K10472g 1020016..1022274 highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 80/181 (44%), Gaps = 31/181 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKVMLEQLRPLSGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLN-REVSALSG 224
             +    VD + +   G              K+ ++ +R++    +   L  +++  LSG
Sbjct: 610 --LSTSAVDWMSKTFPG--------------KTDEEYRRHLGSFGITGTLGLQKMQLLSG 653

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD         ++ ++ N T  ++ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILILDEPSNHLDTT---GIDALVDAMKNFTGGILMVSHDISVI 710

Query: 285 D 285
           +
Sbjct: 711 N 711

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 95/218 (43%), Gaps = 31/218 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFEDPPEW-- 140
           G   GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKD 200
           Q + +  + +E      K+ E+  +  ++ + +DN    +   + ++ E L + +E  K 
Sbjct: 285 QLLTEENKINERLKEIEKLREEFDEDSLEVKKLDNEREDLDAHLIQISEKL-VDMESDKA 343

Query: 201 DAKRYIDILQL---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           +A+    +  L        +  ++ SGG   R ++  +   + D+ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSI 403

Query: 258 LNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIY 295
              A  ++S   P+T V+ V HD + L+ ++    IIY
Sbjct: 404 AYLAEYLKSY--PST-VLTVSHDRAFLNEVA--TDIIY 436

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 71/161 (44%), Gaps = 28/161 (17%)

Query: 352 AFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKL-------LAGAIPAD 404
           +F Y   K    D +L ++     DS+I  ++G NG GKTTL+K+       L+G +  +
Sbjct: 538 SFGYSPDKLLLKDVNLDIQM----DSRI-ALVGANGCGKTTLLKVMLEQLRPLSGYVSRN 592

Query: 405 DGQDIPKLNVSMKPQK------IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDD 458
                P+L +    Q       ++      + + F  +   ++        +   L +  
Sbjct: 593 -----PRLRIGYFTQHHVDSMDLSTSAVDWMSKTFPGKTDEEYRRHLGSFGITGTLGL-- 645

Query: 459 IIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
              Q++Q LSGG+  RVA       N  I ++DEPS +LD+
Sbjct: 646 ---QKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDT 683

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 462 QEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  +L    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKSY----PSTVL 418

Query: 522 IVEHDFIMATYLADKVI 538
            V HD      +A  +I
Sbjct: 419 TVSHDRAFLNEVATDII 435

>KLLA0A10857g complement(941784..944042) highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 86/192 (44%), Gaps = 31/192 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D + 
Sbjct: 561 ISLVGANGCGKTTLLKVMMEQLRPTKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLN-REVSALSG 224
             +    VD +  A  G              K+ ++ +R++    +   L  + +  LSG
Sbjct: 610 --LNQSAVDWMSTAFPG--------------KTDEEYRRHLGAFGISGSLGIQRMQLLSG 653

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVL 284
           G+  R A    C+    + + DEPS++LD    L+A  ++ +L +    V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LVDALKSFNGGVLMVSHDISVI 710

Query: 285 DYLSDFVCIIYG 296
           + + + + +  G
Sbjct: 711 NSVCNEIWVSEG 722

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 96/222 (43%), Gaps = 39/222 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFEDPPEW-- 140
           G+  GLVG NGIGKST LK L+                    G +   L    D   W  
Sbjct: 225 GRRYGLVGQNGIGKSTLLKALSRRELNVPKHISVLHVEQEIRGDETKALQSVLDADVWRK 284

Query: 141 ----QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLE 196
               +E     R  E++N   +  E+ ++     + +DN    ++  ++++ E L + +E
Sbjct: 285 QLLSEESKINERLQEIENLRKEFNEESLEV----KKLDNERTDLEEHLEQISEKL-IDME 339

Query: 197 KSKDDAKRYIDILQL---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
             K +A+    +  L        +  ++ SGG   R ++  +   + D+ + DEPS+ LD
Sbjct: 340 SDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD 399

Query: 254 VKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIY 295
           V      A  +++   P T V+ V HD + L+ ++    IIY
Sbjct: 400 VPSIAYLAEYLKTY--PAT-VLVVSHDRAFLNEVA--TDIIY 436

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 85/202 (42%), Gaps = 28/202 (13%)

Query: 352 AFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDG--QDI 409
           +F+Y +      D +L V+     DS+I  ++G NG GKTTL+K++   +    G     
Sbjct: 538 SFSYKESDPLLTDVNLDVQM----DSRI-SLVGANGCGKTTLLKVMMEQLRPTKGFVSRN 592

Query: 410 PKLNV---------SMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDII 460
           P+L +         SM   + A  +  T    F  +   ++        +   L I    
Sbjct: 593 PRLRIGYFTQHHVDSMDLNQSAVDWMSTA---FPGKTDEEYRRHLGAFGISGSLGI---- 645

Query: 461 DQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
            Q +Q LSGG+  RVA       N  I ++DEPS +LD+         ++ F        
Sbjct: 646 -QRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDALVDALKSF----NGGV 700

Query: 521 FIVEHDFIMATYLADKVIVFDG 542
            +V HD  +   + +++ V +G
Sbjct: 701 LMVSHDISVINSVCNEIWVSEG 722

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 462 QEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  +L    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PATVL 418

Query: 522 IVEHDFIMATYLADKVI 538
           +V HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>Scas_703.17
          Length = 1046

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 120/307 (39%), Gaps = 50/307 (16%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
           GL G NG GKST ++ +A +Q                ++ F   E           + K 
Sbjct: 461 GLCGPNGAGKSTLMRAIANEQ----------------VEGFPSQE-----------ECKT 493

Query: 167 IIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQ----LKNVLNREVSAL 222
           +     +DN              +L   +E         +D L+        +N  +SAL
Sbjct: 494 VYVEHDIDN--------THSETSVLNFVMESGVGKQDVIVDKLKEFGFSDETINMPISAL 545

Query: 223 SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLS 282
           SGG   + A+  + ++ AD+ + DEP+++LD    +N   ++  L       I V HD  
Sbjct: 546 SGGWKMKLALARAVLKNADILLLDEPTNHLDT---INVKWLVDYLNTCGITSIIVSHDSG 602

Query: 283 VLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQF--RMAD 340
            LD +  ++    G+        L   +++  +      + + +L F+  A  +   +  
Sbjct: 603 FLDNVCQYIIHYEGLKLRKYKGNLSEFIKKCPSAKSYSELGASDLEFQFPAPGYLEGVKT 662

Query: 341 AGDELEADASRAFTYPDMKRTQ-GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAG 399
               +   ++  F YP   + Q  D S      + S S  + ++G NG GK+TLI +L G
Sbjct: 663 KQKAIVKVSNMTFQYPRTSKPQISDVSF-----QCSLSSRIAVIGPNGAGKSTLINVLTG 717

Query: 400 AIPADDG 406
            +    G
Sbjct: 718 ELLPTSG 724

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D+ I+  +  LSGG   ++A+  ++  NADI L+DEP+ +LD+    I  K +  ++   
Sbjct: 535 DETINMPISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT----INVKWLVDYLNTC 590

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDGI 543
             T+ IV HD      +   +I ++G+
Sbjct: 591 GITSIIVSHDSGFLDNVCQYIIHYEGL 617

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 27/50 (54%)

Query: 463 EVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           +++ LSGG+  ++ +         + ++DEP+ YLD +     SK ++ F
Sbjct: 894 QIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF 943

>AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH]
            complement(1213217..1217071) [3855 bp, 1284 aa]
          Length = 1284

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 99/211 (46%), Gaps = 32/211 (15%)

Query: 353  FTYPDMKRTQ--GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPAD------ 404
            F YP  K  Q   +F+L +  G       + ++GE+G+GK+TL  L+ G  P        
Sbjct: 1053 FAYPAAKDVQIYKNFNLRINQG-----TKVAIVGESGSGKSTLFYLICGLYPVKPASLFI 1107

Query: 405  DGQDIPKLNVSMKPQKIA-----PKF-TGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDD 458
            DG DI    +S   + IA     P+F  GT+R+     +     + +   +V+  ++I +
Sbjct: 1108 DGTDICNWEMSALRKIIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIY-EVLAEVRIIN 1166

Query: 459  IIDQ---------EVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVI 509
             +           +   +SGG+LQR++IV +L     + ++DE ++ LD+      + V+
Sbjct: 1167 FVRSLPEGLETRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVV 1226

Query: 510  RRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
            R   LH+  T  ++ H   M   + D+++V 
Sbjct: 1227 RNS-LHD-ITVIVITHSKQMMK-MCDRIVVL 1254

 Score = 36.2 bits (82), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 82/192 (42%), Gaps = 38/192 (19%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQ--KPNLGRFEDPPEWQEIIKYFRGSELQNYFTKML 160
            G  + +VG +G GKST   ++ G    KP    F D            G+++ N+    L
Sbjct: 1074 GTKVAIVGESGSGKSTLFYLICGLYPVKPA-SLFID------------GTDICNWEMSAL 1120

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLN---- 216
               I        V+  PR   G ++   E L   LE +  D + Y ++L    ++N    
Sbjct: 1121 RKIIAV------VEQKPRFFNGTIR---ENLVYGLEGTITDNEIY-EVLAEVRIINFVRS 1170

Query: 217  --------REVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
                     + + +SGG+LQR +I  + ++   + + DE +S LD       A ++R+ L
Sbjct: 1171 LPEGLETRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL 1230

Query: 269  NPTTYVICVEHD 280
            +  T VI + H 
Sbjct: 1231 HDIT-VIVITHS 1241

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 228 QRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLS-VLD 285
           QR A+  + +++A V + DE  S LD+  R     +IRS     T +I + H+LS VLD
Sbjct: 506 QRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRSWRADKTTII-LTHELSHVLD 563

>CAGL0K00363g complement(37452..41135) similar to sp|P12866
           Saccharomyces cerevisiae YKL209c STE6, hypothetical
           start
          Length = 1227

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 78/173 (45%), Gaps = 32/173 (18%)

Query: 382 MMGENGTGKTTLIKLLA-------GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFF 434
           ++G +G+GK+TL  L+        G+I   D  DI  +N ++  + I          LF 
Sbjct: 385 VIGPSGSGKSTLFDLILLHYDNYHGSIMLGD-LDIRSINRNIILENIT--LVSQTPTLFN 441

Query: 435 KRIRAQFLNPQFQTDVVKPLKID----------------DIIDQEVQH----LSGGELQR 474
             IR   L     T++   L+++                D +D  +      LSGG+ Q+
Sbjct: 442 DTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQK 501

Query: 475 VAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDF 527
           VA+  +   N  I L+DEP + +D  QRI+  + I+R+   N KT  I+ HD 
Sbjct: 502 VALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRW--RNGKTTVIITHDL 552

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDL 281
           LSGG+ Q+ A+  +  +   + + DEP S +D++QR+     I+   N  T VI + HDL
Sbjct: 494 LSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGKTTVI-ITHDL 552

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 80/170 (47%), Gaps = 23/170 (13%)

Query: 349  ASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQ- 407
            ++ +FTY  +   +   +LT    +   +QI  ++G++G+GK+TLI L+ G     +G  
Sbjct: 995  SNLSFTYAQVHNKK---TLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSI 1051

Query: 408  DIPKLNVSMKPQKIAPKFTGTVRQ---LFFKRIRAQFLNPQFQT-------DVVKPLKID 457
            +I   +++    K   K    ++Q   L F  IR   L    +T       +V++ + + 
Sbjct: 1052 NICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLK 1111

Query: 458  DII-------DQEVQH--LSGGELQRVAIVLSLGMNADIYLIDEPSAYLD 498
              I       D ++    LSGG+ QR+ +   +  N  + ++DE ++ LD
Sbjct: 1112 SFIISLNNGLDSKLDDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALD 1161

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 82/184 (44%), Gaps = 32/184 (17%)

Query: 104  QVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDD 163
            Q+ G+VG +G GKST + ++ G    + G                  ++  + TK L   
Sbjct: 1021 QIYGIVGKSGSGKSTLINLICGLYSLSEGSIN-----------ICSCDINKWSTKELHKT 1069

Query: 164  IKAIIKPQYV---DNI-PRAIKGPVQKVGELLKLRLEKSKDDAKRYID----ILQLKNVL 215
            + A+++   V   D I    + G  + VG+       +   +   Y+     I+ L N L
Sbjct: 1070 V-ALLQQNPVLQFDTIRNNLLYGLTETVGD-------EHLLNVLEYVGLKSFIISLNNGL 1121

Query: 216  NREV--SALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK--QRLNAALIIRSLLNPT 271
            + ++  S LSGG+ QR  +    ++   V + DE +S LDV   +++N  +  RS L P 
Sbjct: 1122 DSKLDDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGSRS-LAPV 1180

Query: 272  TYVI 275
            T ++
Sbjct: 1181 TIIV 1184

>Kwal_27.12711
          Length = 1246

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 93/209 (44%), Gaps = 39/209 (18%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFEDPPEWQEIIKYFRGSELQNYFTK- 158
           G ++ ++G +G GK+T L +LA K    L   G F   PE         G    +Y T+ 
Sbjct: 46  GSIMAIIGGSGSGKTTLLNVLASKMSKTLKQRGSFRFVPE----TSSHSGEITTSYLTQQ 101

Query: 159 -MLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDA--KRYIDILQLKNVL 215
            +L  ++      QY  +               LKL+  KS+     +  I  L LK+  
Sbjct: 102 DILASNLTCRETLQYAAD---------------LKLQSSKSERQGLVEELIAELGLKDCA 146

Query: 216 NREVSA-----LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNP 270
           N  V +     LSGGE +R +IG+  +    +   DEP++ LD     +A L++R+L   
Sbjct: 147 NTLVGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDA---YSAYLVVRTLRKL 203

Query: 271 T-----TYVICVEHDLSVLDYLSDFVCII 294
           +     ++++ +    + + +L D VCI+
Sbjct: 204 SHKGGRSFIMSIHQPRADILFLLDQVCIM 232

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 78/163 (47%), Gaps = 20/163 (12%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN-LGRFEDPPEWQEIIKYFRGSELQNYFTKM 159
           +P  +  ++G +G GKST L  L+GK     L  FE          +F  S++    T+ 
Sbjct: 674 QPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGS-----IFFNNSQV----TQD 724

Query: 160 LEDDIKAIIKPQYVDNI-PRAIKGPVQKVGELLKLRLEKSKDDAKRYIDI---LQLKNVL 215
           +  D+ + + PQ  D++ P+            L+L   K+++   R  D+   L LK+  
Sbjct: 725 IFKDVCSFV-PQDDDHLLPQLTVRETLLFAADLRLHHMKARNRISRVDDLISELGLKHCE 783

Query: 216 NREVSA-----LSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           N  V +     +SGGE +R ++G   + ++ + + DEP+S LD
Sbjct: 784 NTLVGSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLD 826

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 69/160 (43%), Gaps = 39/160 (24%)

Query: 374 FSDSQILVMMGENGTGKTTLIKLLAGAIPA-----------------DDGQDIPKLNVSM 416
           F    I  +MG +G+GK+TL+  L+G   +                    QDI K   S 
Sbjct: 673 FQPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGSIFFNNSQVTQDIFKDVCSF 732

Query: 417 KPQ---KIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQE---------- 463
            PQ    + P+ T     LF   +R   +  + +       ++DD+I +           
Sbjct: 733 VPQDDDHLLPQLTVRETLLFAADLRLHHMKARNRIS-----RVDDLISELGLKHCENTLV 787

Query: 464 ----VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
               V+ +SGGE +R+++   L  ++ I L+DEP++ LDS
Sbjct: 788 GSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLDS 827

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 83/183 (45%), Gaps = 28/183 (15%)

Query: 364 DFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQD-----IPK------- 411
           D S+TV +G      I+ ++G +G+GKTTL+ +LA  +     Q      +P+       
Sbjct: 38  DISMTVPSGS-----IMAIIGGSGSGKTTLLNVLASKMSKTLKQRGSFRFVPETSSHSGE 92

Query: 412 LNVSMKPQK--IAPKFTGTVRQLFFKRIRAQFLNPQFQ---TDVVKPLKIDDIIDQEVQH 466
           +  S   Q+  +A   T      +   ++ Q    + Q    +++  L + D  +  V  
Sbjct: 93  ITTSYLTQQDILASNLTCRETLQYAADLKLQSSKSERQGLVEELIAELGLKDCANTLVGS 152

Query: 467 -----LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
                LSGGE +R++I + +  N  +  +DEP+  LD+    +  + +R+ + H    +F
Sbjct: 153 PNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDAYSAYLVVRTLRK-LSHKGGRSF 211

Query: 522 IVE 524
           I+ 
Sbjct: 212 IMS 214

>YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane
            transporter responsible for export of a factor mating
            pheromone, member of ATP-binding cassette (ABC)
            superfamily of membrane transporters [3873 bp, 1290 aa]
          Length = 1290

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 76/155 (49%), Gaps = 22/155 (14%)

Query: 378  QILVMMGENGTGKTTLIKLLAGAIPAD------DGQDIPKLNVSMKPQKIAPK------F 425
            Q L ++GE+GTGK+TL+ LL      +      DG D+   N++   ++I+        F
Sbjct: 1081 QTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLF 1140

Query: 426  TGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHL---------SGGELQRVA 476
             GT+R      ++ + L  +   D +K + I D +    Q L         SGG+ QR+ 
Sbjct: 1141 NGTIRDNLTYGLQDEILEIEMY-DALKYVGIHDFVISSPQGLDTRIDTTLLSGGQAQRLC 1199

Query: 477  IVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRR 511
            I  +L   + I ++DE ++ LDS    I ++++++
Sbjct: 1200 IARALLRKSKILILDECTSALDSVSSSIINEIVKK 1234

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 94/231 (40%), Gaps = 41/231 (17%)

Query: 330 RTEALQFRMADAGDELEADASRAFTYPD--MKRTQGDFSLTVEAGEFSDSQILVMMGENG 387
           +T A QF +  A  +L   A+ +F+YP    +    + SL   AG+F+      ++G++G
Sbjct: 342 KTVAHQFPLDYATSDLTF-ANVSFSYPSRPSEAVLKNVSLNFSAGQFT-----FIVGKSG 395

Query: 388 TGKTTLIKLLAGAIPADDGQ-DIPKLNVSMKPQKIAPKFTGTVRQ---LFFKRIRAQFL- 442
           +GK+TL  LL       +G   I   N+    QK+  +    V Q   LF   +R   L 
Sbjct: 396 SGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILL 455

Query: 443 ---------------NPQFQTDVVK-----------PLKIDDIIDQEVQHLSGGELQRVA 476
                          N     D  +           P  ++ +I      LSGG+ QRVA
Sbjct: 456 GSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVA 515

Query: 477 IVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDF 527
           I  +   +  I  +DE  + LD   R +  K IR +     KT  I+ H+ 
Sbjct: 516 IARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHW--RKGKTTIILTHEL 564

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 72/163 (44%), Gaps = 33/163 (20%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
            GQ LG++G +G GKST + +L       +G+ +             G+++ ++    L  
Sbjct: 1080 GQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIK-----------IDGTDVNDWNLTSLRK 1128

Query: 163  DIKAI-IKPQYV-----DNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQL----- 211
            +I  +  KP        DN+   ++  +          LE    DA +Y+ I        
Sbjct: 1129 EISVVEQKPLLFNGTIRDNLTYGLQDEI----------LEIEMYDALKYVGIHDFVISSP 1178

Query: 212  KNVLNR-EVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
            + +  R + + LSGG+ QR  I  + ++++ + + DE +S LD
Sbjct: 1179 QGLDTRIDTTLLSGGQAQRLCIARALLRKSKILILDECTSALD 1221

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHD 280
            LSGG+ QR AI  + +++  +   DE  S LD+  R      IR      T +I + H+
Sbjct: 505 TLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTII-LTHE 563

Query: 281 LSVL---DYL 287
           LS +   DYL
Sbjct: 564 LSQIESDDYL 573

>YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of
           the ATP-binding cassette (ABC) superfamily of membrane
           transporters, component of the mitochondrial inner
           membrane [2073 bp, 690 aa]
          Length = 690

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 97/215 (45%), Gaps = 35/215 (16%)

Query: 352 AFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-------AGAIPAD 404
            F Y   ++   + S T+ AG  +      ++G +G+GK+T++KL+       +G I  +
Sbjct: 442 TFGYHPDRKILKNASFTIPAGWKT-----AIVGSSGSGKSTILKLVFRFYDPESGRILIN 496

Query: 405 DGQDIPKLNV-------SMKPQKIAPKFTGTVRQ-LFFKRIRAQFLNPQFQTDVVK---- 452
            G+DI + ++        + PQ   P F  T+ + + F RI A   + +  T V K    
Sbjct: 497 -GRDIKEYDIDALRKVIGVVPQD-TPLFNDTIWENVKFGRIDAT--DEEVITVVEKAQLA 552

Query: 453 ------PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICS 506
                 P   D I+ +    +SGGE QR+AI   L  NA I   DE ++ LD+       
Sbjct: 553 PLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALL 612

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFD 541
           + IR       +T+  + H  +     ADK+IV D
Sbjct: 613 RTIRDNFTSGSRTSVYIAHR-LRTIADADKIIVLD 646

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 73/160 (45%), Gaps = 26/160 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG++G GKST LK++         RF DP   + +I    G +++ Y    L  
Sbjct: 462 GWKTAIVGSSGSGKSTILKLVF--------RFYDPESGRILIN---GRDIKEYDIDALRK 510

Query: 163 DIKAIIK--PQYVDNIPRAIK-GPVQKVGELLKLRLEKS------KDDAKRYIDILQLKN 213
            I  + +  P + D I   +K G +    E +   +EK+      K   + +  I+  + 
Sbjct: 511 VIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERG 570

Query: 214 VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           ++      +SGGE QR AI    ++ A +  FDE +S LD
Sbjct: 571 LM------ISGGEKQRLAIARVLLKNARIMFFDEATSALD 604

>Scas_716.81
          Length = 1565

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 91/198 (45%), Gaps = 24/198 (12%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGK--QKPNLGRFE---DPPEWQEII 144
           NS+ L      +PG+++ ++G  G G S+ LK++AG+  Q P   + E   D    +E++
Sbjct: 236 NSYAL-----AKPGEMILVLGRPGAGCSSFLKVIAGEIDQFPGGVKGEITYDGIPQKEMM 290

Query: 145 KYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKR 204
           K+++   + N     L+     +   Q +D    A K P ++V  +   R E  K   + 
Sbjct: 291 KHYKSDVIYN---GELDVHFPHLTVQQTLD-FALACKTPAKRVNNI--SRDEYIKSSREL 344

Query: 205 YIDILQLKNVLNREVS-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
           Y  I  L++  N +V       +SGGE +R +I  +      +Y +D  +  LD    L 
Sbjct: 345 YATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTALE 404

Query: 260 AALIIR---SLLNPTTYV 274
            A  IR   +LL  T +V
Sbjct: 405 YAKAIRIMTNLLGSTAFV 422

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  +L  N  IY  D  +  LD+   +  +K IR        TAF+ 
Sbjct: 364 VRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTALEYAKAIRIMTNLLGSTAFVT 423

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 80/191 (41%), Gaps = 32/191 (16%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLE 161
            PG +  L+G +G GK+T L  LA + +               I    G  L N   + ++
Sbjct: 940  PGTLTALMGESGAGKTTLLNTLAKRNE---------------IGVVTGDMLVN--GRPVD 982

Query: 162  DDIK---AIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAK-----RYIDILQLKN 213
               +     ++ Q +      ++  +Q    +   R E   D+ K     + I +L+++ 
Sbjct: 983  ASFERRTGYVQQQDIHIAELTVRESLQFSARMR--RSEHVSDEEKLAYVEKIIRVLEMEE 1040

Query: 214  VLNREVSALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLL 268
              +  V A+  G    + ++ +IG+  V + D+ +F DEP+S LD +       ++R L 
Sbjct: 1041 FADALVGAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLRKLA 1100

Query: 269  NPTTYVICVEH 279
                 ++C  H
Sbjct: 1101 QAGQSILCTIH 1111

>KLLA0F12210g 1125630..1128764 highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 translation
           elongation factor eEF3 P6.7.f5.1, start by similarity
          Length = 1044

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 85/196 (43%), Gaps = 31/196 (15%)

Query: 219 VSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVE 278
           +++LSGG   + A+  + ++ AD+ + DEP+++LD    +N   ++  L       I V 
Sbjct: 541 IASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVNWLVEYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEA--LQF 336
           HD   LD +  ++    G+        L   V++          P+    +   A  L+F
Sbjct: 598 HDSGFLDKVCQYIIHYEGLKLRKYKGNLSEFVKK---------CPTAKSYYELGASELEF 648

Query: 337 RMADAGDELEADASR----------AFTYPDMKRTQ-GDFSLTVEAGEFSDSQILVMMGE 385
           R  + G  LE   ++           F YP   + Q  D S      + S S  + ++G 
Sbjct: 649 RFPEPG-YLEGVKTKQKAIVKVSNMTFQYPGTAKPQISDISF-----QCSLSSRIAVIGP 702

Query: 386 NGTGKTTLIKLLAGAI 401
           NG GK+TLI +L G +
Sbjct: 703 NGAGKSTLINVLTGEL 718

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I   +  LSGG   ++A+  ++  NADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMIAMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT----VNVNWLVEYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDGI 543
             T+ IV HD      +   +I ++G+
Sbjct: 590 GITSIIVSHDSGFLDKVCQYIIHYEGL 616

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG 132
           + ++G NG GKST + +L G+  P +G
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTVG 723

>AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W
           (HEF3) - SH] complement(291808..294942) [3135 bp, 1044
           aa]
          Length = 1044

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 29/201 (14%)

Query: 219 VSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVE 278
           + +LSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I V 
Sbjct: 541 IMSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEA--LQF 336
           HD   LD +  ++    G+        L   V++          P+    +   A  L+F
Sbjct: 598 HDSGFLDNVCQYIIHYEGLKLRKYKGNLSEFVKK---------CPTAKSYYELGASDLEF 648

Query: 337 RMADAG---------DELEADASRAFTYPDMKRTQ-GDFSLTVEAGEFSDSQILVMMGEN 386
           +  + G           +   ++ +F YP   + Q  D +      + S S  + ++G N
Sbjct: 649 KFPEPGFLEGVKTKQKAIVKVSNMSFQYPGTSKPQIADINF-----QCSLSSRIAVIGPN 703

Query: 387 GTGKTTLIKLLAGAIPADDGQ 407
           G GK+TLI +L G +    G+
Sbjct: 704 GAGKSTLINVLTGELLPTTGE 724

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 28/173 (16%)

Query: 382 MMGENGTGKTTLIKLLA-GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQ 440
           + G NG GK+TL++ +A G +     QD        +   +     GT       +    
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQD------ECRTVYVEHDIDGT-------QADTS 507

Query: 441 FLNPQFQTDVVKPLKI----------DDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLI 490
            L+  FQ DV     I          D++I   +  LSGG   ++A+  ++  NADI L+
Sbjct: 508 VLDFVFQGDVGTREVITEKLREFGFSDEMIAMPIMSLSGGWKMKLALARAVLKNADILLL 567

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGI 543
           DEP+ +LD+    +    +  ++     T+ IV HD      +   +I ++G+
Sbjct: 568 DEPTNHLDT----VNVAWLVNYLNTCGITSIIVSHDSGFLDNVCQYIIHYEGL 616

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           ++ LSGG+  ++ +         + ++DEP+ YLD +     SK ++ F    +    I+
Sbjct: 894 IRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVIII 949

Query: 524 EHDFIMATYLADKVI-VFDGI 543
            H       L ++V  V DGI
Sbjct: 950 THSAEFTKDLTEEVWAVKDGI 970

>YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongation
           factor EF-3A, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 88/203 (43%), Gaps = 33/203 (16%)

Query: 219 VSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVE 278
           +SALSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I + 
Sbjct: 541 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 597

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLD--GHIPSENL--RFRTEAL 334
           HD   LD + +++    G+            +R+    F +     P+           L
Sbjct: 598 HDSVFLDNVCEYIINYEGL-----------KLRKYKGNFTEFVKKCPAAKAYEELSNTDL 646

Query: 335 QFRMADAGDELEADASR----------AFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMG 384
           +F+  + G  LE   ++           F YP   + Q    +T    + S S  + ++G
Sbjct: 647 EFKFPEPG-YLEGVKTKQKAIVKVTNMEFQYPGTSKPQ----ITDINFQCSLSSRIAVIG 701

Query: 385 ENGTGKTTLIKLLAGAIPADDGQ 407
            NG GK+TLI +L G +    G+
Sbjct: 702 PNGAGKSTLINVLTGELLPTSGE 724

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I   +  LSGG   ++A+  ++  NADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDGI 543
             T+  + HD +    + + +I ++G+
Sbjct: 590 GITSITISHDSVFLDNVCEYIINYEGL 616

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLI--DEPSAYLDSEQRIICSKVIRRF 512
           ++ LSGG  Q+V +VL+ G     +LI  DEP+ YLD +     SK ++ F
Sbjct: 894 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEF 942

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 95/203 (46%), Gaps = 46/203 (22%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG---------RFEDPPEWQEIIKYFRGSE 151
           +PG +  ++G +G GKS+ L +++G+ + +L          +  D P  Q++ K+     
Sbjct: 710 KPGMINAIMGPSGSGKSSFLNLISGRLESSLLVKFNTAGTIKLNDTPISQDMFKHLCSYV 769

Query: 152 LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEK-SKDDAKRYID--- 207
            Q+      +D + A++  +   +   A             LRL+  SKDD +   D   
Sbjct: 770 SQD------DDHLLAMLTVRETFDFAAA-------------LRLKHLSKDDKRSRTDSLI 810

Query: 208 -ILQLKN-----VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAA 261
            IL LK+     + N  +  +SGGE +R ++G+  + +  + + DEP+S LD      ++
Sbjct: 811 AILGLKHCENTIIGNEFIKGISGGEKRRVSMGIQLLSDRPILLLDEPTSGLD---SFTSS 867

Query: 262 LIIRSLLNPTTYVICVEHDLSVL 284
            I+  L N     +C EH+ +V+
Sbjct: 868 TILEILEN-----LCSEHNKTVI 885

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 101/232 (43%), Gaps = 39/232 (16%)

Query: 89  ANSFKLHRLPTPRP-GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYF 147
            +S  +H L    P G V+ ++G +G GK+T L +LA K    L    +       I Y 
Sbjct: 33  TDSVLVHPLSLDLPSGSVMAIMGGSGSGKTTLLNVLASKISSGLTHSGE-------ISYI 85

Query: 148 RGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKV-------GELL----KLRLE 196
             ++  N      E      +   Y +N+  A   P Q V        E L     L+L+
Sbjct: 86  LEADKNNVDDSSSEASFD--LNATYKENVTLAYV-PQQDVLCSRLTCRETLMYAADLKLD 142

Query: 197 KSKDD----AKRYIDILQLKNVLNREVS-----ALSGGELQRFAIGMSCVQEADVYMFDE 247
            SK +      + ID L LK+  +  V       LSGGE +R ++G   V    V   DE
Sbjct: 143 ASKVEKTLIVNQLIDELGLKDCADTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDE 202

Query: 248 PSSYLDVKQRLNAALIIRSLL-----NPTTYVICVEHDLSVLDYLSDFVCII 294
           P++ LD     +A L++++L      +  T+++ +    S + +L D+VCI+
Sbjct: 203 PTTGLDA---YSAYLVVKTLKKLAKEDGRTFILSIHQPRSDILFLFDYVCIL 251

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 88/216 (40%), Gaps = 35/216 (16%)

Query: 374 FSDSQILVMMGENGTGKTTLIKLLAGAIPAD-----DGQDIPKLNVSMKPQKIAPKFTGT 428
           F    I  +MG +G+GK++ + L++G + +      +     KLN +   Q +       
Sbjct: 709 FKPGMINAIMGPSGSGKSSFLNLISGRLESSLLVKFNTAGTIKLNDTPISQDMFKHLCSY 768

Query: 429 VRQ-----LFFKRIRAQFLNPQFQTDV-VKPLKIDD--------------------IIDQ 462
           V Q     L    +R  F    F   + +K L  DD                    II  
Sbjct: 769 VSQDDDHLLAMLTVRETF---DFAAALRLKHLSKDDKRSRTDSLIAILGLKHCENTIIGN 825

Query: 463 E-VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           E ++ +SGGE +RV++ + L  +  I L+DEP++ LDS       +++      + KT  
Sbjct: 826 EFIKGISGGEKRRVSMGIQLLSDRPILLLDEPTSGLDSFTSSTILEILENLCSEHNKTVI 885

Query: 522 IVEHDFIMATYLADKVIVFDGIPSKQAFARAPESLL 557
           +  H      ++    I+      + AF  +PE ++
Sbjct: 886 LTIHQPRSELFMKFGNILLLAKSGRTAFNGSPEEMI 921

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 74/187 (39%), Gaps = 39/187 (20%)

Query: 378 QILVMMGENGTGKTTLIKLLAGAIPA-------------------DDGQD--------IP 410
            ++ +MG +G+GKTTL+ +LA  I +                   DD             
Sbjct: 49  SVMAIMGGSGSGKTTLLNVLASKISSGLTHSGEISYILEADKNNVDDSSSEASFDLNATY 108

Query: 411 KLNVSMK--PQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDD---------- 458
           K NV++   PQ+       T R+        +    + +  ++    ID+          
Sbjct: 109 KENVTLAYVPQQDVLCSRLTCRETLMYAADLKLDASKVEKTLIVNQLIDELGLKDCADTL 168

Query: 459 IIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK 518
           + D   + LSGGE +R+++   +  N  +  +DEP+  LD+    +  K +++    + +
Sbjct: 169 VGDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDAYSAYLVVKTLKKLAKEDGR 228

Query: 519 TAFIVEH 525
           T  +  H
Sbjct: 229 TFILSIH 235

>KLLA0D04554g complement(385733..388801) similar to sp|P25371
           Saccharomyces cerevisiae YCR011c ADP1 ATP-dependent
           permease, start by similarity
          Length = 1022

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 109/254 (42%), Gaps = 50/254 (19%)

Query: 371 AGEFSDSQILVMMGENGTGKTTLIKLLA---------GAIPADDGQDIPKLNVSM----- 416
            G     ++L +MG +G GKTTL+ +LA         G+I  + G DI K   S      
Sbjct: 394 TGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVN-GVDIDKDKYSKIIGFV 452

Query: 417 -KPQKIAPKFT--GTVRQLFFKRIRAQFLNPQFQ---TDVVKPLKIDDIIDQEV-----Q 465
            +   + P  T   TV      R+  Q      Q    DV++ L+I DI D+ +     +
Sbjct: 453 DQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVYDVLEELRIFDIRDRVIGSEYER 512

Query: 466 HLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
            +SGGE +RV+I   L  +  +  +DEP++ LD+       + + R   H  KT  +  H
Sbjct: 513 GISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLANHYNKTLVLSIH 572

Query: 526 DFIMATY-LADKVIVFDGIPSKQAFARAPESLLTGCNKFLKN---------------LNV 569
               + + L DK+++      K  ++     +    N+FLKN               ++V
Sbjct: 573 QPRSSIFQLFDKLVLLSN--GKMVYSGDAHKV----NEFLKNEGYACPPDYNIADYLIDV 626

Query: 570 TFRRDPTSFRPRIN 583
           TF  +P+ F  R N
Sbjct: 627 TF--EPSKFVTRAN 638

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 79/181 (43%), Gaps = 29/181 (16%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN--LGRFE------DPPEWQEIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K K     G  +      D  ++ +II +    + 
Sbjct: 398 KPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVNGVDIDKDKYSKIIGFV---DQ 454

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPR--AIKGPVQKVGELLK-LRLEKSKDDAKRYIDIL 209
           ++Y    L   +   +    +  +PR  +     ++V ++L+ LR+   +D         
Sbjct: 455 EDYLLPTLT--VYETVLNSALLRLPRQLSFSAKQRRVYDVLEELRIFDIRD--------- 503

Query: 210 QLKNVLNREVS-ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
               V+  E    +SGGE +R +I    V    V   DEP+S LD     N    +  L 
Sbjct: 504 ---RVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLA 560

Query: 269 N 269
           N
Sbjct: 561 N 561

>KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces
           cerevisiae YDR011w SNQ2 multidrug resistance protein,
           start by similarity
          Length = 1483

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 93/216 (43%), Gaps = 25/216 (11%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFE--------DPPEWQEIIKYFRGSEL 152
           RPG++L ++G  G G ST LK +AG+    L  F+        D    ++++KYF+   +
Sbjct: 169 RPGEMLLVLGRPGSGCSTFLKTMAGE----LSHFKGVSGDISYDGVSQKDMLKYFKSDVI 224

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLK 212
            N     ++     +   Q +D    A K P +++ +  + +  +   D   Y  I  LK
Sbjct: 225 YN---GEMDVHFPHLTVQQTLD-FAVACKTPSKRINDFTRQQYIEFIRDL--YATIFGLK 278

Query: 213 NVLNREVS-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSL 267
           +  N +V       +SGGE +R +I  +      +Y +D  +  LD    L     IR +
Sbjct: 279 HTYNTKVGDDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCM 338

Query: 268 LN--PTTYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
            N   +T +I V      +    D V I+Y    +Y
Sbjct: 339 TNLLKSTALITVYQASENIYETFDKVTILYEGKQIY 374

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 99/228 (43%), Gaps = 49/228 (21%)

Query: 378 QILVMMGENGTGKTTLIKLLAGAIPADDG--QDIPKLNVSMKPQ----KIAPKFTG---- 427
           ++L+++G  G+G +T +K +AG +    G   DI    VS K      K    + G    
Sbjct: 172 EMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQKDMLKYFKSDVIYNGEMDV 231

Query: 428 -----TVRQLF---------FKRI----RAQFLNPQFQTDV------VKPLKIDDIIDQE 463
                TV+Q            KRI    R Q++  +F  D+      +K      + D  
Sbjct: 232 HFPHLTVQQTLDFAVACKTPSKRINDFTRQQYI--EFIRDLYATIFGLKHTYNTKVGDDF 289

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  +L     IY  D  +  LD+   +  ++ IR      K TA I 
Sbjct: 290 VRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNLLKSTALIT 349

Query: 524 EH---DFIMATYLADKV-IVFDGIPSKQAFARAPESLLTGCNKFLKNL 567
            +   + I  T+  DKV I+++G   +  F R  E+      K+ +NL
Sbjct: 350 VYQASENIYETF--DKVTILYEG--KQIYFGRIEEA-----KKYFENL 388

>AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH]
           complement(802685..807163) [4479 bp, 1492 aa]
          Length = 1492

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 87/184 (47%), Gaps = 31/184 (16%)

Query: 377 SQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQ--LFF 434
           S++  ++G+ G+GK+ LI+ + G +   +G  + + NV+   Q +A    GTVR   LF 
Sbjct: 638 SELTCIIGKVGSGKSALIQAMLGDLFRVNGSAVVRGNVAYVSQ-VAWIMNGTVRDNILFG 696

Query: 435 KRIRAQFLNPQFQTDVVKPLKID---------DIIDQEVQHLSGGELQRVAIVLSLGMNA 485
            +  A+F     QT     L +D           + ++   LSGG+  R+++  ++   A
Sbjct: 697 HKYDAKFYQ---QTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARA 753

Query: 486 DIYLIDEPSAYLDSEQRIICSKVIRRFILHN--------KKTAFIVEHDFIMATYLADKV 537
           D YL+D+P A +D          + + +L N        K  A ++  + I A  +AD +
Sbjct: 754 DTYLLDDPLAAVDEH--------VAKHLLQNVFGPNGLLKSKARVLTTNKITALEIADHI 805

Query: 538 IVFD 541
           ++ +
Sbjct: 806 VLLE 809

>YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongation
           factor EF-3B, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/310 (20%), Positives = 126/310 (40%), Gaps = 46/310 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A       G+ +  P   E    +   ++ N  + M   
Sbjct: 456 GRRYGLCGPNGAGKSTLMRSIAN------GQVDGFPTQDECRTVYVEHDIDNTHSDM--- 506

Query: 163 DIKAIIKPQYVDNIPR--AIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVS 220
              +++   Y  N+     I   +++ G                + D      ++   ++
Sbjct: 507 ---SVLDFVYSGNVGTKDVITSKLKEFG----------------FSD-----EMIEMPIA 542

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHD 280
           +LSGG   + A+  + +++AD+ + DEP+++LD    +N   ++  L       + V HD
Sbjct: 543 SLSGGWKMKLALARAVLKDADILLLDEPTNHLDT---VNVEWLVNYLNTCGITSVIVSHD 599

Query: 281 LSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFR--TEALQFRM 338
              LD +  ++    G+        L   V++         + + +L F+  T      +
Sbjct: 600 SGFLDKVCQYIIHYEGLKLRKYKGNLSEFVQKCPTAQSYYELGASDLEFQFPTPGYLEGV 659

Query: 339 ADAGDELEADASRAFTYPDMKRTQ-GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL 397
                 +   ++  F YP   + Q  D +      + S S  + ++G NG GK+TLI +L
Sbjct: 660 KTKQKAIVKVSNMTFQYPGTTKPQVSDVTF-----QCSLSSRIAVIGPNGAGKSTLINVL 714

Query: 398 AGAIPADDGQ 407
            G +    G+
Sbjct: 715 TGELLPTSGE 724

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 48/87 (55%), Gaps = 4/87 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I+  +  LSGG   ++A+  ++  +ADI L+DEP+ +LD+    +  + +  ++   
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDT----VNVEWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDGI 543
             T+ IV HD      +   +I ++G+
Sbjct: 590 GITSVIVSHDSGFLDKVCQYIIHYEGL 616

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           ++ LSGG+  ++ +         + ++DEP+ YLD +     SK ++ F    +    I+
Sbjct: 894 IRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVIII 949

Query: 524 EHDFIMATYLADKVI-VFDG 542
            H       L D+V  V DG
Sbjct: 950 THSAEFTKNLTDEVWAVKDG 969

>KLLA0A01452g 130078..131901 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 607

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 86/179 (48%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGQDIPKLNVSMKPQKI-APKFTGTVRQLFFKR--- 436
           ++GENG GK+T +K +A    P  +  DI  L+   +P +  A ++     Q   KR   
Sbjct: 109 LLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGELKRLED 168

Query: 437 -IRAQFLNPQFQTDVVKPL--KIDDI----------------------IDQEVQHLSGGE 471
            +    L    ++D+++PL  ++DD+                      I+++ + +SGG 
Sbjct: 169 LVEKILLEDGPESDLLEPLYERMDDMDPSTFESRAAIILIGLGFNSKTINKKTKDMSGGW 228

Query: 472 LQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 80/167 (47%), Gaps = 27/167 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRF-----EDPPEWQEIIKYFRGSELQN 154
           G+  GL+G NG GKST LK +A ++ P   N+  +      +P E+  +    R ++ + 
Sbjct: 104 GRRYGLLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGE- 162

Query: 155 YFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEK---SKDDAKRYIDILQL 211
              K LED ++ I+             GP   + E L  R++    S  +++  I ++ L
Sbjct: 163 --LKRLEDLVEKILLED----------GPESDLLEPLYERMDDMDPSTFESRAAIILIGL 210

Query: 212 ---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
                 +N++   +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 211 GFNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 83/197 (42%), Gaps = 14/197 (7%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDGQ--DIPKLNVSMKPQKIAPKFTGTVRQLF 433
           DS+I  ++G NG GK+TL+K++ G +    G+      + + +  Q    +   T   L 
Sbjct: 418 DSRI-ALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVKLGVYSQHSQDQLDLTKSALE 476

Query: 434 FKRIRAQFLNPQFQTDVVKPLKIDDIID-QEVQH--LSGGELQRVAIVLSLGMNADIYLI 490
           F R +   ++  FQ    +  +     + Q VQ   LS G+  RV   L      ++ L+
Sbjct: 477 FVRDKYPHVSQDFQYWRGQLGRYGLTGEGQTVQMGTLSEGQRSRVVFALLALEQPNVLLL 536

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGIPSKQAFA 550
           DEP+  LD       +  I  F         +V HDF +   +A  + V +     +   
Sbjct: 537 DEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFVVE----HKTAT 588

Query: 551 RAPESLLTGCNKFLKNL 567
           R   S+L   NK  KN+
Sbjct: 589 RWDGSILDYKNKLAKNV 605

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 80/189 (42%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG+GKST LKI+ G+     GR       +  + Y + S+ Q   TK   + ++
Sbjct: 421 IALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVKLGV-YSQHSQDQLDLTKSALEFVR 479

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGG 225
                   D  P   +      G+L             RY    + + V   ++  LS G
Sbjct: 480 --------DKYPHVSQDFQYWRGQL------------GRYGLTGEGQTV---QMGTLSEG 516

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLD 285
           +  R    +  +++ +V + DEP++ LD+    + A  I         V+ V HD  +LD
Sbjct: 517 QRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFRLLD 573

Query: 286 YLSDFVCII 294
            ++  + ++
Sbjct: 574 KIAKDIFVV 582

>Kwal_33.15623
          Length = 562

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 91/198 (45%), Gaps = 23/198 (11%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G  + +VG NGIGK+T LK+L+G         +D P    I    R   L  +F ++  +
Sbjct: 61  GDKVTIVGENGIGKTTFLKLLSG--------VDDYPFSGSIEIEGRIGFLPQHFEEVDGN 112

Query: 163 --DIKAIIKPQYVDNIPRAIKGPV-----QKVGELLKLRLEKSKDDAKRYIDILQLKN-V 214
              ++ ++K  Y D I   ++ P+     + + EL  L       +  R +  + L+  +
Sbjct: 113 LLAVEVLLKSLYDDEINEFLELPLTPFSHEWIQELNSL----GGHEIFRQVSHIGLRQEI 168

Query: 215 LNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYV 274
           L R    LSGGE  +  +    +   D  + DEP+++LD K        +R   N T  V
Sbjct: 169 LRRPFRLLSGGEKTKTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRK-FNGT--V 225

Query: 275 ICVEHDLSVLDYLSDFVC 292
           + V HD ++++ +S F+ 
Sbjct: 226 VMVTHDRALINAVSSFIS 243

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 70/173 (40%), Gaps = 31/173 (17%)

Query: 380 LVMMGENGTGKTTLIKLLAGA--IPADDGQDIPKLNVSMKPQK--------------IAP 423
           + ++GENG GKTT +KLL+G    P     +I    +   PQ               +  
Sbjct: 64  VTIVGENGIGKTTFLKLLSGVDDYPFSGSIEIEG-RIGFLPQHFEEVDGNLLAVEVLLKS 122

Query: 424 KFTGTVRQLF------FKRIRAQFLNPQFQTDVVKPLKI----DDIIDQEVQHLSGGELQ 473
            +   + +        F     Q LN     ++ + +       +I+ +  + LSGGE  
Sbjct: 123 LYDDEINEFLELPLTPFSHEWIQELNSLGGHEIFRQVSHIGLRQEILRRPFRLLSGGEKT 182

Query: 474 RVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           +  +     +N D  L+DEP+ +LD++        +R+F      T  +V HD
Sbjct: 183 KTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRKF----NGTVVMVTHD 231

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 60/150 (40%), Gaps = 21/150 (14%)

Query: 359 KRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKP 418
           K+   + S T+  GE      LV+ G NG GKTTL ++L   I  D G       VSM  
Sbjct: 380 KQIFANISFTLTKGER-----LVIQGPNGCGKTTLNRILMAHIKPDHG------TVSMSG 428

Query: 419 QKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIID----------QEVQHLS 468
             +          L  ++   Q L    + D  +   I ++ D            ++ LS
Sbjct: 429 NAVVGYLDQEQENLPLEKSPIQLLEEDPKIDASRQTAIRNLRDFGIYKWHDLKSPLRDLS 488

Query: 469 GGELQRVAIVLSLGMNADIYLIDEPSAYLD 498
            G  ++  +   +     I ++DEP+ ++D
Sbjct: 489 VGCRRKTQLCQIIMRKCSILVLDEPTNHID 518

>YER036C (YER036C) [1461] chr5 complement(223366..225198) Member of
           the non-transporter group of the ATP-binding cassette
           (ABC) superfamily [1833 bp, 610 aa]
          Length = 610

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 82/179 (45%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGQDIPKLNVSMKPQKI-APKFTGTVRQLFFKRIR- 438
           ++GENG GK+T +K LA    P  +  DI  L+   +P ++ A  +  T  Q   KRI  
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHELKRIED 171

Query: 439 ------------AQFLNPQFQ-TDVVKPLKIDD--------------IIDQEVQHLSGGE 471
                       ++ L P ++  D + P   +                I ++ + +SGG 
Sbjct: 172 LVEKTILEDGPESELLEPLYERMDSLDPDTFESRAAIILIGLGFNKKTILKKTKDMSGGW 231

Query: 472 LQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 286

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 29/190 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTK-MLEDDI 164
           + LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK  LE   
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALE--- 479

Query: 165 KAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSG 224
              ++ +Y  NI +  +    ++G               RY    + + V   +++ LS 
Sbjct: 480 --FVRDKY-SNISQDFQFWRGQLG---------------RYGLTGEGQTV---QMATLSE 518

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVL 284
           G+  R    +  +++ +V + DEP++ LD+    + A  I         V+ V HD  +L
Sbjct: 519 GQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFRLL 575

Query: 285 DYLSDFVCII 294
           D ++  + ++
Sbjct: 576 DKIAQDIFVV 585

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 80/165 (48%), Gaps = 23/165 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFEDPPEWQEIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK LA ++ P     ++   ++P E  E+    +  +E Q+  
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHEL 166

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDD---AKRYIDILQL-- 211
            K +ED ++  I             GP  ++ E L  R++    D   ++  I ++ L  
Sbjct: 167 -KRIEDLVEKTILED----------GPESELLEPLYERMDSLDPDTFESRAAIILIGLGF 215

Query: 212 -KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
            K  + ++   +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 216 NKKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 85/197 (43%), Gaps = 14/197 (7%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMK--PQKIAPKFTGTVRQLF 433
           DS+I  ++G NG GK+TL+K++ G +    G+     +V +    Q    +   T   L 
Sbjct: 421 DSRI-ALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALE 479

Query: 434 FKRIRAQFLNPQFQTDVVKPLKIDDIID-QEVQH--LSGGELQRVAIVLSLGMNADIYLI 490
           F R +   ++  FQ    +  +     + Q VQ   LS G+  RV   L      ++ L+
Sbjct: 480 FVRDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQPNVLLL 539

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGIPSKQAFA 550
           DEP+  LD       +  I  F         +V HDF +   +A  + V   + +K A  
Sbjct: 540 DEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAQDIFV---VENKTA-T 591

Query: 551 RAPESLLTGCNKFLKNL 567
           R   S+L   NK  KN+
Sbjct: 592 RWDGSILQYKNKLAKNV 608

>Scas_288.1
          Length = 494

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 94/213 (44%), Gaps = 22/213 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFEDPPEWQEIIKYFRGSELQNYF 156
           G+++ ++G  G G S+ LK+ AG+     G       ++  P+  E++K +R   + N  
Sbjct: 73  GEMVLVLGRPGAGCSSFLKVTAGETDQFAGGVTGEIAYDGIPQ-DEMMKKYRADVIYN-- 129

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLN 216
              L+     +   Q +D    A K P ++V ++ K    KS  +   Y  I  L++  N
Sbjct: 130 -GELDVHFPYLTVQQTLD-FAIACKTPAKRVNDVSKEEYIKSTREL--YATIFGLRHTYN 185

Query: 217 REVS-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIR---SLL 268
            +V       +SGGE +R +I  +      +Y +D  +  LD    L  A  IR   +LL
Sbjct: 186 TKVGNDFVRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIRIMTNLL 245

Query: 269 NPTTYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
             T +V   +   ++ +   D V ++Y    +Y
Sbjct: 246 KSTAFVTIYQASENIYETF-DKVTVLYSGRQIY 277

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 4/62 (6%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 521
           V+ +SGGE +RV+I  +L  N  IY  D  +  LD+   +  +K IR  I+ N  K TAF
Sbjct: 193 VRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIR--IMTNLLKSTAF 250

Query: 522 IV 523
           + 
Sbjct: 251 VT 252

>Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement
          Length = 608

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 82/179 (45%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGQDIPKLNVSMKPQKI-APKFTGTVRQLFFKRIR- 438
           ++GENG GK+T +K +A    P  +  D+  L+   +P ++ A  +  T  Q   KR+  
Sbjct: 110 LLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNELKRLED 169

Query: 439 ------------AQFLNPQFQ-TDVVKPLKIDD--------------IIDQEVQHLSGGE 471
                       ++ L P ++  D + P   +                I ++ + +SGG 
Sbjct: 170 LVEKIILEDGPESELLEPLYEKMDSMDPNTFESRAAVILIGLGFNSKTITKKTKDMSGGW 229

Query: 472 LQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 230 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 284

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 81/192 (42%), Gaps = 33/192 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQ-NYFTKMLEDDI 164
           + LVG NG+GKST LKI+ G+  P  GR              R + ++   +++  +D +
Sbjct: 422 IALVGPNGVGKSTLLKIMTGQLMPQSGRVS------------RHTHVKLGVYSQHSQDQL 469

Query: 165 KAIIKP-QYV-DNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSAL 222
                P ++V D  P   +      G+L +  L      +               ++  L
Sbjct: 470 DLTKSPLEFVRDKYPNISQDFQYWRGQLGRYGLTGEAQTS---------------QMGTL 514

Query: 223 SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLS 282
           S G+  R    +  +++ +V + DEP++ LD+    + A  I         V+ V HD  
Sbjct: 515 SEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFR 571

Query: 283 VLDYLSDFVCII 294
           +LD ++  + ++
Sbjct: 572 LLDKIAQDIFVV 583

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 84/168 (50%), Gaps = 29/168 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFEDPPEWQEIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK +A ++ P     ++   ++P E  E+    +  +E QN  
Sbjct: 105 GRHYGLLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNEL 164

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEK--SKD----DAKRYIDILQ 210
            K LED ++ II    +++ P +         ELL+   EK  S D    +++  + ++ 
Sbjct: 165 -KRLEDLVEKII----LEDGPES---------ELLEPLYEKMDSMDPNTFESRAAVILIG 210

Query: 211 L---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
           L      + ++   +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 211 LGFNSKTITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 258

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 82/197 (41%), Gaps = 14/197 (7%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMK--PQKIAPKFTGTVRQLF 433
           DS+I  ++G NG GK+TL+K++ G +    G+     +V +    Q    +   T   L 
Sbjct: 419 DSRI-ALVGPNGVGKSTLLKIMTGQLMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSPLE 477

Query: 434 FKRIRAQFLNPQFQ---TDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLI 490
           F R +   ++  FQ     + +     +    ++  LS G+  RV   L      ++ L+
Sbjct: 478 FVRDKYPNISQDFQYWRGQLGRYGLTGEAQTSQMGTLSEGQRSRVVFALLALEQPNVLLL 537

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGIPSKQAFA 550
           DEP+  LD       +  I  F         +V HDF +   +A  + V +     +   
Sbjct: 538 DEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAQDIFVVE----HKTAT 589

Query: 551 RAPESLLTGCNKFLKNL 567
           R   S+L   NK  KN+
Sbjct: 590 RWNGSILDYKNKLAKNV 606

>AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH]
           (859615..861438) [1824 bp, 607 aa]
          Length = 607

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 83/179 (46%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGQDIPKLNVSMKPQKI-APKFTGTVRQLFFKRIR- 438
           ++GENG GK+T +K +A    P  +  D+  L+   +P +  A ++     Q   KR+  
Sbjct: 109 LLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVVREAQNELKRLED 168

Query: 439 ------------AQFLNPQFQ-TDVVKPLKIDD--------------IIDQEVQHLSGGE 471
                       ++ L+P ++  D + P   +                I+++ + +SGG 
Sbjct: 169 LVEKILLEDGPESELLDPLYEKMDSMDPSTFESRAAIILIGLGFNAKTINRKTKDMSGGW 228

Query: 472 LQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 82/170 (48%), Gaps = 33/170 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRF-----EDPPEWQEIIKYFRGSELQN 154
           G+  GL+G NG GKST LK +A ++ P   N+  +      +P E+  +    R  E QN
Sbjct: 104 GRRYGLLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVVR--EAQN 161

Query: 155 YFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEK------SKDDAKRYIDI 208
              K LED ++ I+    +++ P +         ELL    EK      S  +++  I +
Sbjct: 162 EL-KRLEDLVEKIL----LEDGPES---------ELLDPLYEKMDSMDPSTFESRAAIIL 207

Query: 209 LQL---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
           + L      +NR+   +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 208 IGLGFNAKTINRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 83/188 (44%), Gaps = 27/188 (14%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
            LVG NG+GKST LKI+ G+  P+ GR       +  + Y + S+ Q   TK   + ++ 
Sbjct: 422 ALVGPNGVGKSTLLKIMTGELTPHGGRVSRHTHVKLGV-YSQHSQDQLDLTKSALEFVRD 480

Query: 167 IIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGE 226
             K  ++    +  +G + + G      L      A               +++ LS G+
Sbjct: 481 --KYAHISEDFQFWRGQLGRYG------LTGEAQTA---------------QMATLSEGQ 517

Query: 227 LQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDY 286
             R    +  +++ +V + DEP++ LD+    + A  I +       V+ V HD  +LD 
Sbjct: 518 RSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAIDAF---NGGVVVVSHDFRLLDR 574

Query: 287 LSDFVCII 294
           ++  + ++
Sbjct: 575 IAKDIYVV 582

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 80/192 (41%), Gaps = 13/192 (6%)

Query: 381 VMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMK--PQKIAPKFTGTVRQLFFKRIR 438
            ++G NG GK+TL+K++ G +    G+     +V +    Q    +   T   L F R +
Sbjct: 422 ALVGPNGVGKSTLLKIMTGELTPHGGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK 481

Query: 439 AQFLNPQFQ---TDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSA 495
              ++  FQ     + +     +    ++  LS G+  RV   L      ++ L+DEP+ 
Sbjct: 482 YAHISEDFQFWRGQLGRYGLTGEAQTAQMATLSEGQRSRVVFALLALEQPNVLLLDEPTN 541

Query: 496 YLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGIPSKQAFARAPES 555
            LD       +  I  F         +V HDF +   +A  + V   + +K A  R   S
Sbjct: 542 GLDIPTIDSLADAIDAF----NGGVVVVSHDFRLLDRIAKDIYV---VENKTA-TRWDGS 593

Query: 556 LLTGCNKFLKNL 567
           +L   NK  KN+
Sbjct: 594 ILDYKNKLAKNV 605

>Scas_574.8
          Length = 702

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 102/246 (41%), Gaps = 38/246 (15%)

Query: 353 FTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQ----- 407
           F Y   ++   + S T+  G  +      ++G +G+GK+T++KL+      + G+     
Sbjct: 443 FGYDSKRKILNNASFTIPGGLKT-----AVVGPSGSGKSTILKLVFRFYDPEQGRILING 497

Query: 408 -DIPKLNV-------SMKPQKIAPKFTGTVRQ-LFFKRIRAQFLNPQFQTDVVK------ 452
            D+ + +V        + PQ   P F  T+ + + F RI A   + +  T + K      
Sbjct: 498 VDVKEYDVDSLRRVMGVVPQD-TPLFNDTIWENVKFGRIDAT--DEEVHTVIEKAQLAPL 554

Query: 453 ----PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKV 508
               P   + I+ +    +SGGE QR+AI   L  NA I   DE ++ LD+         
Sbjct: 555 IKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTT 614

Query: 509 IRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGIPSKQ-----AFARAPESLLTGCNKF 563
           IR       +T+  + H  +     ADK+IV +    K+          P SL       
Sbjct: 615 IRANFESGSRTSVYIAHR-LRTIADADKIIVLEDGAVKEEGTHSGLLATPGSLYANLWNI 673

Query: 564 LKNLNV 569
            +NL+V
Sbjct: 674 QENLDV 679

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 27/194 (13%)

Query: 83  VTHRYSANSFKLHRLPTPRPGQV-LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQ 141
           VT  Y +    L+      PG +   +VG +G GKST LK++         RF DP + +
Sbjct: 441 VTFGYDSKRKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVF--------RFYDPEQGR 492

Query: 142 EIIKYFRGSELQNYFTKMLEDDIKAIIK--PQYVDNIPRAIK-GPVQKVGELLKLRLEKS 198
            +I    G +++ Y    L   +  + +  P + D I   +K G +    E +   +EK+
Sbjct: 493 ILIN---GVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFGRIDATDEEVHTVIEKA 549

Query: 199 ------KDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYL 252
                 K   + Y  I+  + ++      +SGGE QR AI    ++ A +  FDE +S L
Sbjct: 550 QLAPLIKKLPQGYETIVGERGMM------ISGGEKQRLAIARVLLKNAKIMFFDEATSAL 603

Query: 253 DVKQRLNAALIIRS 266
           D          IR+
Sbjct: 604 DTHTEQALLTTIRA 617

>KLLA0D00748g complement(69839..72208) similar to sp|P33311
           Saccharomyces cerevisiae YPL270w MDL2 ATP-binding
           cassette (ABC) transporter family member, hypothetical
           start
          Length = 789

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 88/199 (44%), Gaps = 31/199 (15%)

Query: 352 AFTYPDMKRTQ--GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-------AGAIP 402
           +F+YP  K  Q   D + T+E G       + ++G +G GK+T+  LL       +G I 
Sbjct: 478 SFSYPTRKTNQIFKDLNFTIEPGSN-----VCIVGPSGRGKSTIASLLLRYYNPTSGKIL 532

Query: 403 ADDGQDIPKLNV-SMKPQKIAPK-----FTGTVRQLFFKRIRAQFLNPQFQTDVVK---- 452
            D GQDI KL+  S++ Q    +      +GT+R+     +  Q    + ++   K    
Sbjct: 533 VD-GQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591

Query: 453 ------PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICS 506
                 P   + II      LSGG+ QR+AI  +L     I ++DE ++ LD E     +
Sbjct: 592 AFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAIN 651

Query: 507 KVIRRFILHNKKTAFIVEH 525
             + R +   + T   + H
Sbjct: 652 YTLGRLMKSKELTIISIAH 670

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR--LNAALIIRSLLNPTTYVICVEH 279
           LSGG+ QR AI  + + +  + + DE +S LDV+    +N  L  R + +    +I + H
Sbjct: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL-GRLMKSKELTIISIAH 670

Query: 280 DLSVL 284
            LS +
Sbjct: 671 RLSTI 675

>Kwal_26.9480
          Length = 719

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 97/223 (43%), Gaps = 32/223 (14%)

Query: 382 MMGENGTGKTTLIKL-------LAGAIPADDGQDIPKLNVSMKPQKIA------PKFTGT 428
           ++G +G+GK+T++KL       + G I  D G+D+ +L++    + I       P F  +
Sbjct: 494 IVGPSGSGKSTILKLVFRFYDPIEGRILLD-GKDVRELDIESLRRSIGVVPQDTPLFNES 552

Query: 429 VR-QLFFKRIRAQFLNPQFQTDVVK--------PLKIDDIIDQEVQHLSGGELQRVAIVL 479
           +   + F RI A     +   D  +        P   D I+ +    +SGGE QR+AI  
Sbjct: 553 IWDNVKFGRIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIAR 612

Query: 480 SLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
            L  +A I   DE ++ LD+       + I+       KT+  + H  +     ADK+IV
Sbjct: 613 VLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHR-LRTIADADKIIV 671

Query: 540 FDGIPSKQAFARA-----PESL---LTGCNKFLKNLNVTFRRD 574
            +    K+    A     P+SL   L    + L +LN    RD
Sbjct: 672 LEHGRVKEEGKHAELLATPKSLYAELWNVQENLDDLNKELERD 714

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 86/199 (43%), Gaps = 42/199 (21%)

Query: 75  LPTNLDSQVTHRYSANSFKLHRL---------PTPRPGQVLGLVGTNGIGKSTALKILAG 125
           LP N+ S++  +  +  +   RL         PT   G    +VG +G GKST LK++  
Sbjct: 455 LPPNVPSEIVFKNVSFGYDPDRLILKNASFTIPT---GSKTAIVGPSGSGKSTILKLVF- 510

Query: 126 KQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQ 185
                  RF DP E + ++    G +++    + L   I  +  PQ       +I   V 
Sbjct: 511 -------RFYDPIEGRILLD---GKDVRELDIESLRRSIGVV--PQDTPLFNESIWDNV- 557

Query: 186 KVGELLKLRLEKSKDDAKRYIDILQLK-----------NVLNREVSALSGGELQRFAIGM 234
           K G     R++ +  + +R ID  QL+            ++      +SGGE QR AI  
Sbjct: 558 KFG-----RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIAR 612

Query: 235 SCVQEADVYMFDEPSSYLD 253
             +++A +  FDE +S LD
Sbjct: 613 VLLKDAPIMFFDEATSALD 631

>CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces
           cerevisiae YCR011c ADP1 ATP-dependent permease, start by
           similarity
          Length = 1055

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 101/233 (43%), Gaps = 36/233 (15%)

Query: 359 KRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKP 418
           +R   D S  V+ GE     IL +MG +G GKTTL+ +LA      D     ++N  +  
Sbjct: 390 QRVLNDISGLVKPGE-----ILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVS 444

Query: 419 QKIAPKFTGTVRQ----LFFKRIRAQFLNP---------QFQT------DVVKPLKIDDI 459
           +K   K  G V Q    L    +    LN           F+        V++ L+I DI
Sbjct: 445 RKDYTKLIGFVDQDDYLLPTLTVYETVLNSALLRLPRTMSFEAKQARVFHVLEELRIMDI 504

Query: 460 IDQEVQH-----LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFIL 514
            D+ V +     +SGGE +RV+I   L  +  +  +DEP++ LD+       + + R   
Sbjct: 505 KDRIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDANNANNVIECLVRLAR 564

Query: 515 HNKKTAFIVEHD-FIMATYLADKVIVFDGIPSKQAFARAPESLLTGCNKFLKN 566
           +  +T  +  H       Y  DK+++     S+     + E+L    N+FLKN
Sbjct: 565 NYDRTLVMSIHQPRSNIFYRFDKLVLL----SRGELVYSGEALRV--NEFLKN 611

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 30/179 (16%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN--------LGRFEDPPEWQEIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K+K           G+     ++ ++I +    + 
Sbjct: 401 KPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTKLIGFV---DQ 457

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKV---GELLKLRLEKSKDDAKRYIDIL 209
            +Y    L   +   +    +  +PR +    ++      L +LR+   KD         
Sbjct: 458 DDYLLPTLT--VYETVLNSALLRLPRTMSFEAKQARVFHVLEELRIMDIKD--------- 506

Query: 210 QLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
             + V N     +SGGE +R +I    V    V   DEP+S LD     NA  +I  L+
Sbjct: 507 --RIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDAN---NANNVIECLV 560

>YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump
           involved in resistance to multiple drugs, member of the
           ATP-binding cassette (ABC) superfamily [4506 bp, 1501
           aa]
          Length = 1501

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 94/213 (44%), Gaps = 22/213 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFEDPPEWQEIIKYFRGSELQNYF 156
           G+++ ++G  G G S+ LK+ AG+     G       ++  P+ +E++K ++   + N  
Sbjct: 186 GEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGEVAYDGIPQ-EEMMKRYKADVIYN-- 242

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLN 216
              L+     +   Q +D    A K P  +V  + K     S+ D   Y  I  L++  N
Sbjct: 243 -GELDVHFPYLTVKQTLD-FAIACKTPALRVNNVSKKEYIASRRDL--YATIFGLRHTYN 298

Query: 217 REVS-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIR---SLL 268
            +V       +SGGE +R +I  +   +  +Y +D  +  LD    L  A  IR   +LL
Sbjct: 299 TKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLL 358

Query: 269 NPTTYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
             T +V   +   ++ +   D V ++Y    +Y
Sbjct: 359 KSTAFVTIYQASENIYETF-DKVTVLYSGKQIY 390

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  +L     IY  D  +  LD+   +  +K IR      K TAF+ 
Sbjct: 306 VRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLLKSTAFVT 365

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 72/161 (44%), Gaps = 34/161 (21%)

Query: 379  ILVMMGENGTGKTTLIKLLA----GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFF 434
            +  +MGE+G GKTTL+  LA    G I  D   +   ++ S + +      TG V+Q   
Sbjct: 884  MTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGRPIDASFERR------TGYVQQQDI 937

Query: 435  K----------RIRAQFLNPQFQTD---------VVKPLKIDDIIDQEVQHLSGG----E 471
                       +  A+   PQ   D         +++ L +++  +  V  +  G    +
Sbjct: 938  HIAELTVRESLQFSARMRRPQHLPDSEKMDYVEKIIRVLGMEEYAEALVGEVGCGLNVEQ 997

Query: 472  LQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRR 511
             ++++I + L    D+ L +DEP++ LDS+      +++R+
Sbjct: 998  RKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRK 1038

>Scas_573.11
          Length = 689

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 219 VSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVE 278
           +SALSGG   + A+  + ++ AD+ + DEP+++LD    +N A ++  L       I + 
Sbjct: 581 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 637

Query: 279 HDLSVLDYLSDFV 291
           HD   LD + +++
Sbjct: 638 HDSVFLDSVCEYI 650

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I   +  LSGG   ++A+  ++  NADI L+DEP+ +LD+    +    +  ++   
Sbjct: 574 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT----VNVAWLVNYLNTC 629

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDGI 543
             T+  + HD +    + + +I ++G+
Sbjct: 630 GITSITISHDSVFLDSVCEYIINYEGL 656

>CAGL0C02343g 236840..238672 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 610

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 81/179 (45%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGQDIPKLNVSMKPQKI-APKFTGTVRQLFFKRIR- 438
           ++GENG GK+T +K LA    P  D  D+  L+    P +  A ++     Q   KR+  
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPDHIDVYLLDEPAAPTEYSALEYVVREAQNELKRVED 171

Query: 439 ------------AQFLNPQFQ-TDVVKPLKIDD--------------IIDQEVQHLSGGE 471
                       ++ L+P ++  D + P   +                I ++ + +SGG 
Sbjct: 172 LVEKIILEDGPESELLDPLYERMDGMDPSTFESRAAVILIGLGFNSQTILKKTKDMSGGW 231

Query: 472 LQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 286

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 84/189 (44%), Gaps = 29/189 (15%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTK-MLEDDIK 165
            LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK  LE    
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALE---- 479

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGG 225
             ++ +Y  NI +  +      G+L +  L     DA++             ++  LS G
Sbjct: 480 -FVRDKY-SNISQDFQ---YWRGQLGRYGL---TGDAQKV------------QMGTLSEG 519

Query: 226 ELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLD 285
           +  R    +  ++  +V + DEP++ LD+    + A  I         V+ V HD  +LD
Sbjct: 520 QRSRVVFALLALENPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFRLLD 576

Query: 286 YLSDFVCII 294
            ++  + ++
Sbjct: 577 KIAKDIFVV 585

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 81/192 (42%), Gaps = 13/192 (6%)

Query: 381 VMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMK--PQKIAPKFTGTVRQLFFKRIR 438
            ++G NG GK+TL+K++ G +    G+     +V +    Q    +   T   L F R +
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK 484

Query: 439 AQFLNPQFQTDVVKPLKIDDIID-QEVQH--LSGGELQRVAIVLSLGMNADIYLIDEPSA 495
              ++  FQ    +  +     D Q+VQ   LS G+  RV   L    N ++ L+DEP+ 
Sbjct: 485 YSNISQDFQYWRGQLGRYGLTGDAQKVQMGTLSEGQRSRVVFALLALENPNVLLLDEPTN 544

Query: 496 YLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGIPSKQAFARAPES 555
            LD       +  I  F         +V HDF +   +A  + V   +  K A  R   S
Sbjct: 545 GLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFV---VEDKTA-TRWDGS 596

Query: 556 LLTGCNKFLKNL 567
           +L    K  KN+
Sbjct: 597 ILDYKKKLAKNV 608

 Score = 36.2 bits (82), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 77/167 (46%), Gaps = 27/167 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP--------NLGRFEDPPEWQEIIKYFRGSELQN 154
           G+  GL+G NG GKST LK LA ++ P         L     P E+  +    R  E QN
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPDHIDVYLLDEPAAPTEYSALEYVVR--EAQN 164

Query: 155 YFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEK---SKDDAKRYIDILQL 211
              K +ED ++ II             GP  ++ + L  R++    S  +++  + ++ L
Sbjct: 165 EL-KRVEDLVEKIILED----------GPESELLDPLYERMDGMDPSTFESRAAVILIGL 213

Query: 212 ---KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
                 + ++   +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 214 GFNSQTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

>CAGL0E03355g complement(307242..311849) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 91/183 (49%), Gaps = 28/183 (15%)

Query: 368 TVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQD--------IPKLNVSMKPQ 419
           +++  E   S ++ ++G  G GK+T++K + G +P   G +        I    V+  PQ
Sbjct: 636 SIDNFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISGNNDHLSPQFQINATTVAYCPQ 695

Query: 420 KIAPKFTGTVR----------QLFFK-RIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLS 468
           + A     +V+          + F+K  I+A  L P  +   V P   + ++ ++   LS
Sbjct: 696 E-AWIMNASVKDNILFGHKYDEAFYKATIKACQLLPDIK---VLPDGDETMVGEKGIVLS 751

Query: 469 GGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFI 528
           GG+  R+++  ++   AD+YL+D+  + +D+E   +C  +I+  +  ++KT  + +   +
Sbjct: 752 GGQKTRLSLARAVYSRADLYLLDDILSAVDTE---VCKTIIKEVL--DEKTGLLKDKSIV 806

Query: 529 MAT 531
           +AT
Sbjct: 807 LAT 809

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 93/214 (43%), Gaps = 45/214 (21%)

Query: 382  MMGENGTGKTTL----IKLL---AGAIPADD------GQDIPKLNVSMKPQKIAPKFTGT 428
            ++G  G GK+TL     +LL   AG I  D+      G    + ++++ PQ  A  F GT
Sbjct: 1308 VVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQD-AQAFEGT 1366

Query: 429  VRQLF-----------FKRIRAQFLNPQFQTDVVKPLKID-------------DIIDQEV 464
            +R              +  I    L    +T + K +  D             DI  +E 
Sbjct: 1367 IRSNLDPFEKFSDDDLWHAIELSHLKFHLET-IAKEINDDSEYSDRSRLESPLDIPVREA 1425

Query: 465  -QHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
              +LS G+ Q + +  +L   + I ++DE +A +D E   I  + IR+      +T   +
Sbjct: 1426 GSNLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEF--ADRTILTI 1483

Query: 524  EHDFIMATYLADKVIVFDGIPSKQAFARAPESLL 557
             H  +   + +D++IV DG   K+ F + PE+LL
Sbjct: 1484 AHR-LDTVFDSDRIIVLDGGEVKE-FDK-PETLL 1514

>Kwal_56.22329
          Length = 776

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 110/273 (40%), Gaps = 46/273 (16%)

Query: 352 AFTYPDMKRTQ--GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-------AGAIP 402
           +F+YP     Q     + T+E G       + ++G +G GK+T+  LL       +G I 
Sbjct: 494 SFSYPTRPGNQIFNKLNFTIEPGSN-----VCIVGPSGRGKSTITSLLLRYYNPSSGQIT 548

Query: 403 ADDGQDIPKLNVSMKPQKIAPKFTGTVRQ---LFFKRIRAQF---LNPQFQTDVVK---- 452
            DD QDI +L+      K   +  G V+Q   L    I+      L  +   D ++    
Sbjct: 549 IDD-QDISRLSC-----KSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAK 602

Query: 453 -----------PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQ 501
                      P   D II      LSGG+ QR+AI  +L     I ++DE ++ LD E 
Sbjct: 603 KCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVES 662

Query: 502 RIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGIPSKQAFARAPESLLTGCN 561
               +  + + +   + T   + H  +     ++ VIV     S     +  +      +
Sbjct: 663 EGAINYTLGKLMKSKELTIISIAHR-LSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQS 721

Query: 562 KFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQK 594
           +  K LN   R  PT   PR+   D + D+EQ+
Sbjct: 722 ELYKLLNDKKRDKPT---PRVQS-DPEKDREQE 750

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 220 SALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTY-VICVE 278
           ++LSGG+ QR AI  + +++  + + DE +S LDV+        +  L+      +I + 
Sbjct: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIA 685

Query: 279 HDLSVL 284
           H LS +
Sbjct: 686 HRLSTI 691

>KLLA0A10131g complement(889688..891850) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1 ATP-binding
           cassette transporter protein, mitochondrial,
           hypothetical start
          Length = 720

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 97/218 (44%), Gaps = 35/218 (16%)

Query: 382 MMGENGTGKTTLIKLL-------AGAIPADDGQDIPKLN-------VSMKPQKIAPKFTG 427
           ++G +G+GK+T+++L+        G I  D G+DI +L+       V + PQ   P F  
Sbjct: 487 IVGPSGSGKSTILRLVFRFYDPQQGRILLD-GKDIRELDLDELRRIVGVVPQD-TPLFND 544

Query: 428 TVRQ-LFFKRIRAQFLNPQFQTDVVK----------PLKIDDIIDQEVQHLSGGELQRVA 476
           T+ + + F RI A   + +  T + K          P   + I+ +    +SGGE QR+A
Sbjct: 545 TIWENVKFGRINAT--DNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLA 602

Query: 477 IVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADK 536
           I   L  +  I   DE ++ LD+       K I+       KT+  + H  +     ADK
Sbjct: 603 IARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHR-LRTIADADK 661

Query: 537 VIVFDGIPSKQ-----AFARAPESLLTGCNKFLKNLNV 569
           +IV +    ++     A    P SL +      +NL++
Sbjct: 662 IIVLENGAVREEGTHNALLANPNSLYSELWNIQENLDM 699

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 75/162 (46%), Gaps = 22/162 (13%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTK 158
           T  PG+   +VG +G GKST L+++         RF DP + + ++    G +++    +
Sbjct: 478 TIAPGKKTAIVGPSGSGKSTILRLVF--------RFYDPQQGRILLD---GKDIR----E 522

Query: 159 MLEDDIKAII------KPQYVDNIPRAIK-GPVQKVGELLKLRLEKSKDDAKRYIDILQL 211
           +  D+++ I+       P + D I   +K G +      +   +EK++     +      
Sbjct: 523 LDLDELRRIVGVVPQDTPLFNDTIWENVKFGRINATDNEIVTAIEKAQLSDLIHKLPKGT 582

Query: 212 KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           + ++      +SGGE QR AI    +++  +  FDE +S LD
Sbjct: 583 ETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALD 624

>Scas_40.1
          Length = 203

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 87/201 (43%), Gaps = 43/201 (21%)

Query: 69  AIQIINL---PTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAG 125
           A+Q+ NL    T  +  + H  S +      LP+   G ++ +VG +G GK+T L +LA 
Sbjct: 19  AVQVRNLSIIATKSNKTIVHDVSMD------LPS---GSIMAIVGGSGSGKTTLLNVLAS 69

Query: 126 KQKPNL---GRFEDPPEWQEIIKYFRGSELQNYFTKML-EDDI---KAIIKPQYVDNIPR 178
           K    L   G +E   +         GS  Q+  T  L + D+   K  ++         
Sbjct: 70  KISRGLKMEGSYEFVADG--------GSRQQDITTAYLAQQDVSSPKLTVRETLSYAADL 121

Query: 179 AIKGPVQK----VGELL-KLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIG 233
            +K P Q+    V EL+ +L L++  D             V + E   LSGGE +R +IG
Sbjct: 122 KLKAPRQERRRLVEELIAELGLKECSD-----------TRVGDSEHRGLSGGEKRRLSIG 170

Query: 234 MSCVQEADVYMFDEPSSYLDV 254
           +  +    +   DEP++ LD 
Sbjct: 171 VQMISNPSLLFLDEPTTGLDA 191

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 70/146 (47%), Gaps = 28/146 (19%)

Query: 379 ILVMMGENGTGKTTLIKLLAGAIP------------ADDG---QDIPKLNVSMKPQKIAP 423
           I+ ++G +G+GKTTL+ +LA  I             AD G   QDI    ++ +    +P
Sbjct: 49  IMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADGGSRQQDITTAYLAQQDVS-SP 107

Query: 424 KFTGTVRQLFFKRIRAQFLNPQFQ-----TDVVKPLKIDD-----IIDQEVQHLSGGELQ 473
           K   TVR+        +   P+ +      +++  L + +     + D E + LSGGE +
Sbjct: 108 KL--TVRETLSYAADLKLKAPRQERRRLVEELIAELGLKECSDTRVGDSEHRGLSGGEKR 165

Query: 474 RVAIVLSLGMNADIYLIDEPSAYLDS 499
           R++I + +  N  +  +DEP+  LD+
Sbjct: 166 RLSIGVQMISNPSLLFLDEPTTGLDA 191

>Scas_695.24
          Length = 1288

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 77/173 (44%), Gaps = 32/173 (18%)

Query: 352  AFTYPDMKRTQ--GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGA--------- 400
             F YP         D +L + A E    + + ++GE+G+GK+TL+ LL            
Sbjct: 1055 TFAYPSETNVNVYEDLNLEMHASE----KTIGLVGESGSGKSTLMYLLTKLYQVAPHSIY 1110

Query: 401  IPADDGQDIPKLNVSMKPQKIAPK---FTGTVRQLFFKRIRAQFLNPQFQTDVVK----- 452
            +   D  D   +N+  +   +  K   F GTVR+     I    L+ +   D++K     
Sbjct: 1111 LDGTDVNDWGLMNLRTQISVVEQKPTLFDGTVRENLSYGISTDILDMEL-FDMLKYVGIY 1169

Query: 453  ------PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
                  P  +D  ID ++  LSGG+ QR+ I  +L     I ++DE ++ LD+
Sbjct: 1170 EFVESLPFGLDTRIDTKL--LSGGQAQRICIARALLRKPKILILDECTSALDA 1220

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 77/190 (40%), Gaps = 38/190 (20%)

Query: 104  QVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDD 163
            + +GLVG +G GKST + +L          ++  P       Y  G+++ ++    L   
Sbjct: 1079 KTIGLVGESGSGKSTLMYLLTK-------LYQVAPH----SIYLDGTDVNDWGLMNLRTQ 1127

Query: 164  IKAI-IKPQYVD-----NIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVL-- 215
            I  +  KP   D     N+   I   +          L+    D  +Y+ I +    L  
Sbjct: 1128 ISVVEQKPTLFDGTVRENLSYGISTDI----------LDMELFDMLKYVGIYEFVESLPF 1177

Query: 216  ----NREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLN-- 269
                  +   LSGG+ QR  I  + +++  + + DE +S LD    L+A +II  + N  
Sbjct: 1178 GLDTRIDTKLLSGGQAQRICIARALLRKPKILILDECTSALDA---LSANIIIDIVKNGP 1234

Query: 270  PTTYVICVEH 279
            P    I + H
Sbjct: 1235 PALLTIVITH 1244

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
           complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 93/211 (44%), Gaps = 29/211 (13%)

Query: 353 FTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQ----- 407
           F Y   +R   + S T+ AG  +      ++G +G+GK+T++KL+      + G+     
Sbjct: 442 FGYDPERRILNNVSFTIPAGMKT-----AIVGPSGSGKSTILKLVFRFYEPEQGRILVGG 496

Query: 408 -DIPKLN-------VSMKPQKIAPKFTGTVRQ-LFFKRIRA---QFLNPQFQTDVVK--- 452
            DI  L+       + + PQ   P F  T+ + + F  I +   + L    +  + K   
Sbjct: 497 TDIRDLDLLSLRKAIGVVPQD-TPLFNDTIWENVKFGNISSSDDEILRAIEKAQLTKLLQ 555

Query: 453 --PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIR 510
             P     ++ +    +SGGE QR+AI   L  +A +   DE ++ LD+         I+
Sbjct: 556 NLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQ 615

Query: 511 RFILHNKKTAFIVEHDFIMATYLADKVIVFD 541
           +    N KT+  V H  +     ADK+IV +
Sbjct: 616 QNFSSNSKTSVYVAHR-LRTIADADKIIVLE 645

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 71/164 (43%), Gaps = 34/164 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG +G GKST LK++         RF +P + + ++    G+++++     L  
Sbjct: 461 GMKTAIVGPSGSGKSTILKLVF--------RFYEPEQGRILVG---GTDIRDLDLLSLRK 509

Query: 163 DIKAIIK--PQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQL--------- 211
            I  + +  P + D I   +K      G +       S D+  R I+  QL         
Sbjct: 510 AIGVVPQDTPLFNDTIWENVK-----FGNI-----SSSDDEILRAIEKAQLTKLLQNLPK 559

Query: 212 --KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
               V+      +SGGE QR AI    +++A +  FDE +S LD
Sbjct: 560 GASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALD 603

>AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH]
            (434247..438740) [4494 bp, 1497 aa]
          Length = 1497

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 87/193 (45%), Gaps = 24/193 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFEDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L +LA + +  +        G   D   +Q    Y +  +L
Sbjct: 869  KPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGHLRD-TSFQRKTGYCQQQDL 927

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLK 212
                T+ + D +K     +   +I RA K     V +++KL   ++  DA          
Sbjct: 928  HGR-TQTVRDALKFSAYLRQPQSISRAEKNAY--VEDIIKLLGMEAYADA---------- 974

Query: 213  NVLNREVSALSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLLNPT 271
             V+      L+  + +R  IG+  V + ++ +F DEP+S LD +   +   +I+ L+N  
Sbjct: 975  -VVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHG 1033

Query: 272  TYVICVEHDLSVL 284
              ++C  H  S +
Sbjct: 1034 QAILCTIHQPSAI 1046

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 76/176 (43%), Gaps = 27/176 (15%)

Query: 367  LTVEAGEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPADDGQDIPKLNVSMK---- 417
            LT   G      +  +MG +G GKTTL+ +LA     G +  +   D    + S +    
Sbjct: 861  LTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGHLRDTSFQRKTG 920

Query: 418  --PQKIAPKFTGTVRQLFFKRIRAQFLNPQ---------FQTDVVKPLKIDDIIDQEV-- 464
               Q+     T TVR     +  A    PQ         +  D++K L ++   D  V  
Sbjct: 921  YCQQQDLHGRTQTVRDAL--KFSAYLRQPQSISRAEKNAYVEDIIKLLGMEAYADAVVGV 978

Query: 465  --QHLSGGELQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRRFILHNK 517
              + L+  + +R+ I + L    ++ L +DEP++ LDS+      ++I++ + H +
Sbjct: 979  TGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHGQ 1034

>Kwal_47.19116
          Length = 607

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 84/179 (46%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGQDIPKLNVSMKPQKI-APKFTGTVRQLFFKR--- 436
           ++GENG GK+T +K LA    P  +  D+  L+   +P +  A ++     Q   KR   
Sbjct: 109 LLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVVNEAQNELKRLED 168

Query: 437 -IRAQFLNPQFQTDVVKPL--KIDDI----------------------IDQEVQHLSGGE 471
            +    L    ++DV++ +  ++D +                      I+++ + +SGG 
Sbjct: 169 LVEKTILEDGPESDVLEGIYERMDSLDPSTFESRAAVILIGLGFNSKTINKKTKDMSGGW 228

Query: 472 LQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFEDPPEWQEI--IKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA K+ P     ++   ++P E  E   ++Y   +E QN 
Sbjct: 104 GRRYGLLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVV-NEAQNE 162

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLR---LEKSKDDAKRYIDILQL- 211
             K LED ++  I             GP   V E +  R   L+ S  +++  + ++ L 
Sbjct: 163 L-KRLEDLVEKTILED----------GPESDVLEGIYERMDSLDPSTFESRAAVILIGLG 211

Query: 212 --KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
                +N++   +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 212 FNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 84/197 (42%), Gaps = 14/197 (7%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMK--PQKIAPKFTGTVRQLF 433
           DS++  ++G NG GK+TL+K++ G +    G+     +V +    Q    +   T   L 
Sbjct: 418 DSRV-ALVGPNGVGKSTLLKIMTGELATQSGRVSRHTHVKLGVYSQHSQDQLDLTKSPLE 476

Query: 434 FKRIRAQFLNPQFQ---TDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLI 490
           F R +   ++  FQ     + +     +    ++  LS G+  RV   L      ++ L+
Sbjct: 477 FVRDKYSHISHDFQYWRGQLGRYGLTGEGQTSQMATLSEGQRSRVVFALLALQAPNVLLL 536

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGIPSKQAFA 550
           DEP+  LD       +  I  F         +V HDF +   +A  + V   + +K A  
Sbjct: 537 DEPTNGLDIATIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFV---VENKTA-T 588

Query: 551 RAPESLLTGCNKFLKNL 567
           R   S+L   NK  KN+
Sbjct: 589 RWDGSILDYKNKLAKNV 605

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 80/192 (41%), Gaps = 33/192 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQ-NYFTKMLEDDI 164
           + LVG NG+GKST LKI+ G+     GR              R + ++   +++  +D +
Sbjct: 421 VALVGPNGVGKSTLLKIMTGELATQSGRVS------------RHTHVKLGVYSQHSQDQL 468

Query: 165 KAIIKP-QYVDNIPRAIKGPVQKV-GELLKLRLEKSKDDAKRYIDILQLKNVLNREVSAL 222
                P ++V +    I    Q   G+L +  L      +               +++ L
Sbjct: 469 DLTKSPLEFVRDKYSHISHDFQYWRGQLGRYGLTGEGQTS---------------QMATL 513

Query: 223 SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLS 282
           S G+  R    +  +Q  +V + DEP++ LD+    + A  I         V+ V HD  
Sbjct: 514 SEGQRSRVVFALLALQAPNVLLLDEPTNGLDIATIDSLADAINEF---NGGVVVVSHDFR 570

Query: 283 VLDYLSDFVCII 294
           +LD ++  + ++
Sbjct: 571 LLDKIAKDIFVV 582

>YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member of
           the ATP-binding cassette (ABC) superfamily, has
           similarity to Drosophila white protein [3885 bp, 1294
           aa]
          Length = 1294

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 102/235 (43%), Gaps = 36/235 (15%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGR-------FED----PP 138
           N+F +  LP+   G V+ ++G +G GK+T L +LA K    L          ED    P 
Sbjct: 46  NTFSMD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEPN 101

Query: 139 EWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRL-EK 197
           E +    +  G +        ++  +     PQ     PR       K    LKL   E+
Sbjct: 102 ETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSER 155

Query: 198 SKD-DAKRYIDILQLKNVLNREVS-----ALSGGELQRFAIGMSCVQEADVYMFDEPSSY 251
           +K    ++ I+ L LK+  +  V       LSGGE +R +IG   +    +   DEP++ 
Sbjct: 156 TKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTG 215

Query: 252 LDVKQRLNAALIIRSLL-----NPTTYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
           LD     +A L+I++L      +  T+++ +    S + +L D VCI+     VY
Sbjct: 216 LDA---YSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVY 267

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 87/205 (42%), Gaps = 52/205 (25%)

Query: 365 FSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPAD-------------------- 404
           FS+ + +G      ++ +MG +G+GKTTL+ +LA  I                       
Sbjct: 48  FSMDLPSG-----SVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEPNE 102

Query: 405 --------DGQDIP---KLNVSMKPQK--IAPKFTGTVRQLFFKRIRAQFLNPQFQT--- 448
                   DGQD P    + ++  PQ+  ++P+ T      F   ++   LN   +T   
Sbjct: 103 TEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLK---LNSSERTKKL 159

Query: 449 ---DVVKPLKIDDIIDQEV-----QHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSE 500
               +++ L + D  D  V     + LSGGE +R++I   +  N  I  +DEP+  LD+ 
Sbjct: 160 MVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAY 219

Query: 501 QRIICSKVIRRFILHNKKTAFIVEH 525
              +  K +++    + +T  +  H
Sbjct: 220 SAFLVIKTLKKLAKEDGRTFIMSIH 244

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 80/158 (50%), Gaps = 10/158 (6%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL-GRFEDPPEWQEIIKYFRGSEL--QNYFT 157
           +PG +  ++G +G GKS+ L +++G+ K ++  +F+       +    + SEL  +N  +
Sbjct: 718 KPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSG--SIMFNDIQVSELMFKNVCS 775

Query: 158 KMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKN--VL 215
            + +DD   +      + +  A    +  + E    R+E++ D+  R + +   +N  + 
Sbjct: 776 YVSQDDDHLLAALTVKETLKYAAALRLHHLTE--AERMERT-DNLIRSLGLKHCENNIIG 832

Query: 216 NREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           N  V  +SGGE +R  +G+  + +  + + DEP+S LD
Sbjct: 833 NEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLD 870

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 457 DDIIDQE-VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILH 515
           ++II  E V+ +SGGE +RV + + L  +  I L+DEP++ LDS       +++ +    
Sbjct: 828 NNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCRE 887

Query: 516 NKKTAFIVEH 525
             KT  I  H
Sbjct: 888 QGKTIIITIH 897

>KLLA0D02156g complement(184520..186085) similar to sgd|S0002468
           Saccharomyces cerevisiae YDR061w, start by similarity
          Length = 521

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 440 QFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
           ++++P+  T ++K LK+ DI D+    LS G+++R  +  SL    D+ +ID+P   LD 
Sbjct: 132 RYVDPELLTYLLKELKLIDIKDRWAMGLSNGQMRRTRLARSLLKEPDLTIIDDPFLGLDP 191

Query: 500 EQRIICSKVIRRFILHNKKTAFIV 523
               I SK + ++   +K T+ I+
Sbjct: 192 SACSIISKFLSKY---DKGTSVII 212

>Scas_712.29
          Length = 610

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 86/199 (43%), Gaps = 42/199 (21%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGQDIPKLNVSMKPQKI-APKFTGTVRQLFFKRIR- 438
           ++GENG GK+T +K LA    P  +  DI  L+   +P +  A ++     Q   KR+  
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQNELKRLED 171

Query: 439 ------------AQFLNPQFQ-TDVVKPLKIDD--------------IIDQEVQHLSGGE 471
                        + L P ++  D + P   +                I ++ + +SGG 
Sbjct: 172 LVEKYIVEEGPECELLEPLYERMDSLDPDTFESRAAVILIGLGFNSKTILKKTKDMSGGW 231

Query: 472 LQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI- 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+ 
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFLN 287

Query: 529 -----MATYLADKVIVFDG 542
                M    A K+  + G
Sbjct: 288 GVCTNMLDMRAQKLTAYGG 306

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 85/190 (44%), Gaps = 29/190 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTK-MLEDDI 164
           + LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK  LE   
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALE--- 479

Query: 165 KAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSG 224
              ++ +Y  NI +  +    ++G               RY    + + V   ++  LS 
Sbjct: 480 --FVRDKY-PNISQDFQYWRGQLG---------------RYGLTGEGQTV---QMGTLSE 518

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVL 284
           G+  R    +  +++ +V + DEP++ LD+    + A  I         V+ V HD  +L
Sbjct: 519 GQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLAEAINEF---NGGVVVVSHDFRLL 575

Query: 285 DYLSDFVCII 294
           D ++  + ++
Sbjct: 576 DKIAKDIFVV 585

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 81/168 (48%), Gaps = 29/168 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRF-----EDPPEWQEIIKYFRGSELQN 154
           G+  GL+G NG GKST LK LA ++ P   N+  +      +P E+  +    R  E QN
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSALEYVVR--EAQN 164

Query: 155 YFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDD---AKRYIDILQL 211
              K LED ++  I  +          GP  ++ E L  R++    D   ++  + ++ L
Sbjct: 165 EL-KRLEDLVEKYIVEE----------GPECELLEPLYERMDSLDPDTFESRAAVILIGL 213

Query: 212 ----KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
               K +L ++   +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 214 GFNSKTIL-KKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 85/197 (43%), Gaps = 14/197 (7%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMK--PQKIAPKFTGTVRQLF 433
           DS+I  ++G NG GK+TL+K++ G +    G+     +V +    Q    +   T   L 
Sbjct: 421 DSRI-ALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALE 479

Query: 434 FKRIRAQFLNPQFQTDVVKPLKIDDIID-QEVQH--LSGGELQRVAIVLSLGMNADIYLI 490
           F R +   ++  FQ    +  +     + Q VQ   LS G+  RV   L      ++ L+
Sbjct: 480 FVRDKYPNISQDFQYWRGQLGRYGLTGEGQTVQMGTLSEGQRSRVVFALLALEQPNVLLL 539

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGIPSKQAFA 550
           DEP+  LD       ++ I  F         +V HDF +   +A  + V   + +K A  
Sbjct: 540 DEPTNGLDIPTIDSLAEAINEF----NGGVVVVSHDFRLLDKIAKDIFV---VENKTA-T 591

Query: 551 RAPESLLTGCNKFLKNL 567
           R   S+L    K  KN+
Sbjct: 592 RWNGSILEYKTKLAKNV 608

>CAGL0I04862g complement(438338..442861) highly similar to sp|P32568
           Saccharomyces cerevisiae YDR011w SNQ2 multidrug
           resistance protein, hypothetical start
          Length = 1507

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 95/215 (44%), Gaps = 22/215 (10%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFE-----DPPEWQEIIKYFRGSELQNY 155
           R G+++ ++G  G G S+ LK+ AG+     G  E     D    +E++K ++   + N 
Sbjct: 186 RAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQKEMMKRYKPDVIYN- 244

Query: 156 FTKMLEDDIK-AIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKN- 213
                E D+    +  Q   +   A K P ++V ++ +     S  D   +  I  L++ 
Sbjct: 245 ----GEQDVHFPHLTVQQTLDFAIACKTPSKRVNDVSREEYIASTRDL--HATIFGLRHT 298

Query: 214 ----VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIR---S 266
               V N  V  +SGGE +R +I  + V +  +Y +D  +  LD    L  A  IR   +
Sbjct: 299 YHTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITTN 358

Query: 267 LLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
           LL  T +V   +   ++ +   D V ++Y    +Y
Sbjct: 359 LLGSTAFVTIYQASENIYETF-DKVTVLYTGRQIY 392

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 78/162 (48%), Gaps = 36/162 (22%)

Query: 379  ILVMMGENGTGKTTLIKLLA----GAIPADDGQDIPKLNVSMKPQKIA-PKFTGTVRQ-- 431
            +  +MGE+G GKTTL+  LA    G I  D       + V+ KP  I+  + TG V+Q  
Sbjct: 888  LTALMGESGAGKTTLLNTLAQRNVGIITGD-------MLVNGKPIDISFERRTGYVQQQD 940

Query: 432  ------------LFFKRI-RAQFLNPQFQTD----VVKPLKIDDIIDQEVQHLSGG---- 470
                         F  R+ RAQ +  + + +    ++K L +++  D  V  +  G    
Sbjct: 941  IHISELTVRESLQFSARMRRAQNVPEEEKMEHVERIIKVLDMEEYADALVGDVGRGLNVE 1000

Query: 471  ELQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRR 511
            + ++++I + L    D+ L +DEP++ LDS+      +++++
Sbjct: 1001 QRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKK 1042

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 80/196 (40%), Gaps = 41/196 (20%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQ------------KPNLGRFEDPPEWQEIIKYFR 148
            +PG +  L+G +G GK+T L  LA +             KP    FE            R
Sbjct: 884  KPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGKPIDISFER-----------R 932

Query: 149  GSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDI 208
               +Q     + E  ++  +  Q+   + RA     Q V E      E+  +  +R I +
Sbjct: 933  TGYVQQQDIHISELTVRESL--QFSARMRRA-----QNVPE------EEKMEHVERIIKV 979

Query: 209  LQLKNVLNREVSALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALI 263
            L ++   +  V  +  G    + ++ +IG+  V + D+ +F DEP+S LD +       +
Sbjct: 980  LDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQL 1039

Query: 264  IRSLLNPTTYVICVEH 279
            ++ L      ++C  H
Sbjct: 1040 LKKLAKAGQSILCTIH 1055

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  +L     IY  D  +  LD+   +  +K IR        TAF+ 
Sbjct: 308 VRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITTNLLGSTAFVT 367

>AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -
           SH] complement(994534..997569) [3036 bp, 1011 aa]
          Length = 1011

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 78/179 (43%), Gaps = 24/179 (13%)

Query: 371 AGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVR 430
           +G  S  +IL +MG +G GKT L+ +L     A +     K+N     +    K  G V 
Sbjct: 388 SGYVSPGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVSKVVGFVD 447

Query: 431 Q---------LFFKRIRAQFLN-PQFQT---------DVVKPLKIDDIIDQEVQH----- 466
           Q         ++   + +  L  P+  +          V++ L+I DI D+ + +     
Sbjct: 448 QDNHLLPTLTVYETVLNSALLRLPRSMSFAAKQKRVYQVLEELRIFDIRDRLIGNDFERG 507

Query: 467 LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
           +SGGE +RV+I   L  +  I  +DEP++ LDS       + + R     ++T  +  H
Sbjct: 508 ISGGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNVIECLVRLASQYRRTLVLSIH 566

>KLLA0C04477g complement(409543..413304) similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, start by similarity
          Length = 1253

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 93/215 (43%), Gaps = 26/215 (12%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           GQ++ ++G +G GK+T L +LAGK   ++        +   I+Y R +  +       ++
Sbjct: 41  GQLMAIIGGSGSGKTTMLNVLAGKTNSSI-------NYDGEIQYSRDAAKEG---SKADE 90

Query: 163 DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDA--KRYIDILQLKNVLNREVS 220
            +      Q+     R       ++   LKL L K +  +  +  I  L L++     V 
Sbjct: 91  KVTTAYLTQHDALAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVG 150

Query: 221 -----ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSL-----LNP 270
                 LSGGE +R +I +  +    V   DEP++ LD     +A L+I++L        
Sbjct: 151 DSINKGLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLDA---YSAFLLIKTLKKLCEHGG 207

Query: 271 TTYVICVEHDLSVLDYLSDFVCIIY-GVPSVYGVV 304
            T ++ +    S + +  D VC++  G P   G V
Sbjct: 208 RTIIMSIHQPRSDILFALDQVCLLSKGFPMYCGAV 242

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 79/178 (44%), Gaps = 30/178 (16%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPAD---DGQDIPKLNVSMKPQKIAPKFTG----- 427
           + Q++ ++G +G+GKTT++ +LAG   +    DG+     + + +  K   K T      
Sbjct: 40  NGQLMAIIGGSGSGKTTMLNVLAGKTNSSINYDGEIQYSRDAAKEGSKADEKVTTAYLTQ 99

Query: 428 --------TVRQLFFKRIRAQF---LNPQFQTDVVKPLKID---------DIIDQEVQHL 467
                   T R+    RI A     L  Q +  +V+ L  +          + D   + L
Sbjct: 100 HDALAARLTCRETL--RIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVGDSINKGL 157

Query: 468 SGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
           SGGE +R++I + +  N  +  +DEP+  LD+    +  K +++   H  +T  +  H
Sbjct: 158 SGGEKRRLSIAVQMIANPSVLFLDEPTTGLDAYSAFLLIKTLKKLCEHGGRTIIMSIH 215

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 57/261 (21%), Positives = 104/261 (39%), Gaps = 50/261 (19%)

Query: 372 GEFSDSQILVMMGENGTGKTTLIKLLAGAIPAD-------------DGQDIPK------- 411
             F  + I  +MG +G+GKT+L+ L++  + ++             + Q + K       
Sbjct: 680 ASFRPNAINAIMGPSGSGKTSLLNLISDRVCSNFFTKFNESGRIIFNQQPVMKSMFKSVC 739

Query: 412 LNVSMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDD---------IIDQ 462
             VS     + P  T      +  R+R    N       V+ L  D          + + 
Sbjct: 740 CYVSQDDNHLLPNLTVYETLKYAARLRLSHHNESRIETRVRTLISDLGLKNCANTLVGND 799

Query: 463 EVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI 522
            ++ +SGGE +RV+I + L  +  + L+DEP++ LDS       +++++     K     
Sbjct: 800 LIKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDSFTSSTIIELLKKLCQQGKTIILT 859

Query: 523 VEH-------DFIMATYLA-DKVIVFDGIPS-------KQAFARAPESLLTGCNKFLKN- 566
           +         DF     LA    + F+G PS       K+ F   P+  LT    +L + 
Sbjct: 860 IHQPRAEVFADFGNVLLLAKGGRVAFNGYPSAMIEYFNKEGFT-CPQ--LTNIADYLLDV 916

Query: 567 --LNVTFRRDPTSFRPRINKL 585
             +N+    +  S + R+N L
Sbjct: 917 ISVNIQNYENEVSSKERVNAL 937

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 192 KLRLEKSKDD-----AKRYIDILQLKNVLNREVS-----ALSGGELQRFAIGMSCVQEAD 241
           +LRL    +       +  I  L LKN  N  V       +SGGE +R +IG+  + +  
Sbjct: 764 RLRLSHHNESRIETRVRTLISDLGLKNCANTLVGNDLIKGISGGEKRRVSIGIQLLTDPS 823

Query: 242 VYMFDEPSSYLD 253
           V + DEP+S LD
Sbjct: 824 VLLLDEPTSGLD 835

>Kwal_56.22747
          Length = 1538

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 97/219 (44%), Gaps = 41/219 (18%)

Query: 382  MMGENGTGKTTL-IKLLAGAIPAD-----DGQDIPKL-------NVSMKPQKIAPKFTGT 428
            ++G  G GK+TL + L     P++     DG DI K+       N+S+ PQ  A  F GT
Sbjct: 1321 IVGRTGAGKSTLSLALFRILEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQD-AQAFEGT 1379

Query: 429  VR-----------QLFFKRIRAQFLNPQ---FQTDVVKPLKIDDIIDQEVQ----HLSGG 470
            VR           +  +K +    L P       D   P K +D++  ++     +LS G
Sbjct: 1380 VRTNLDPFEQYSDEEIWKALELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVG 1439

Query: 471  ELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
            + Q + +  +L   + I ++DE +A +DSE   +  + IR       +T   + H  D +
Sbjct: 1440 QRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEF--KDRTILTIAHRIDTV 1497

Query: 529  MATYLADKVIVFDGIPSKQAFARAPESLLTGCNKFLKNL 567
            M +   DK++V D    K+    +P +LL   +    NL
Sbjct: 1498 MDS---DKIMVLDKGEVKE--FDSPSNLLAQKDSIFYNL 1531

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/179 (18%), Positives = 77/179 (43%), Gaps = 40/179 (22%)

Query: 378 QILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRI 437
           Q++ ++G  G GK+T ++ L G +P           +S  P   +P        +     
Sbjct: 655 QLVCVVGRVGAGKSTFLQALLGQLPC----------ISNSPSHASPTVHFRANSVALCSQ 704

Query: 438 RAQFLNPQFQTDVVKPLKIDD-------------------------IIDQEVQHLSGGEL 472
           ++  +N   + +V+   + D+                         ++ ++   LSGG+ 
Sbjct: 705 QSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPDLEILADGDETLVGEKGISLSGGQK 764

Query: 473 QRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMAT 531
            R+++  ++   +D+YL+D+  + +D+E   +C ++I + +  +KKT  +     I+ T
Sbjct: 765 ARLSLARAVYSRSDVYLLDDILSAVDAE---VCKRIIEQVL--SKKTGLLKNKTVILTT 818

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 77/163 (47%), Gaps = 19/163 (11%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFE-DPPEWQEI-IKYFRGS-ELQNYFT 157
            +P + +G+VG  G GKST    L    +P+ G  + D  +  +I +K  R +  +     
Sbjct: 1314 KPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDA 1373

Query: 158  KMLEDDIKAIIKP--QYVDNIPRAIKGPVQKVGELLKLR---LEKSKDDA--KRYIDILQ 210
            +  E  ++  + P  QY D         + K  EL  L+   L+ +KDDA  ++  D+LQ
Sbjct: 1374 QAFEGTVRTNLDPFEQYSDE-------EIWKALELSHLKPHILKMAKDDADPEKKEDLLQ 1426

Query: 211  LKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
             K  ++   S LS G+ Q   +  + +  + + + DE ++ +D
Sbjct: 1427 TK--ISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVD 1467

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 81/192 (42%), Gaps = 27/192 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLED 162
           GQ++ +VG  G GKST L+ L G Q P +    + P       +FR + +       L  
Sbjct: 654 GQLVCVVGRVGAGKSTFLQALLG-QLPCIS---NSPSHASPTVHFRANSVA------LCS 703

Query: 163 DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQL-----KNVLNR 217
               I+     DN+           G        K+  +A + +  L++     + ++  
Sbjct: 704 QQSWIMNASVKDNV---------LFGHRFDEATYKATLEACQLVPDLEILADGDETLVGE 754

Query: 218 EVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV---KQRLNAALIIRSLLNPTTYV 274
           +  +LSGG+  R ++  +    +DVY+ D+  S +D    K+ +   L  ++ L     V
Sbjct: 755 KGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTGLLKNKTV 814

Query: 275 ICVEHDLSVLDY 286
           I   + +SVL +
Sbjct: 815 ILTTNSISVLKH 826

>YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the
           ATP-binding cassette (ABC) superfamily, equivalent to a
           "half-sized" ABC protein with one ATP-binding domain and
           one transmembrane domain, involved in release of
           peptides from mitochondria [2088 bp, 695 aa]
          Length = 695

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 88/192 (45%), Gaps = 43/192 (22%)

Query: 352 AFTYPDMKRTQ--GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-------AGAIP 402
           +FTYP   + Q   D ++T++ GE      +  +G +G+GK+T+  LL       +G+I 
Sbjct: 438 SFTYPTRPKHQIFKDLNITIKPGEH-----VCAVGPSGSGKSTIASLLLRYYDVNSGSIE 492

Query: 403 ADDGQDIPKLNVSMKPQKIAPKFTGTVRQ---LFFKRIRAQFLN---PQF--QTDVVK-- 452
             D +DI   N+     +   +  G V+Q   LF   I    L    P+   Q D ++  
Sbjct: 493 FGD-EDIRNFNL-----RKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRA 546

Query: 453 -------------PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
                        P  +  ++      LSGG+ QR+A+  +  ++  + ++DE ++ LDS
Sbjct: 547 IGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDS 606

Query: 500 EQRIICSKVIRR 511
           +   I +K ++R
Sbjct: 607 QSEEIVAKNLQR 618

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 93/232 (40%), Gaps = 38/232 (16%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPE---------WQEIIKYFRG 149
           T +PG+ +  VG +G GKST   +L      N G  E   E         ++ +I Y + 
Sbjct: 456 TIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQ 515

Query: 150 SELQNYFTKMLEDDIKAIIKPQYV---DNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYI 206
             L   F   + D+I   I P+     D I RAI                  K +  +++
Sbjct: 516 EPL--LFNGTILDNILYCIPPEIAEQDDRIRRAI-----------------GKANCTKFL 556

Query: 207 DIL--QLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALII 264
                 L+ ++    + LSGG+ QR A+  + + +  V + DE +S LD +     A  +
Sbjct: 557 ANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNL 616

Query: 265 RSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINI 316
           +  +      I + H LS + + +  + +       +G V    S R+ I I
Sbjct: 617 QRRVERGFTTISIAHRLSTIKHSTRVIVL-----GKHGSVVETGSFRDLIAI 663

>Scas_628.13
          Length = 1060

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 68/148 (45%), Gaps = 24/148 (16%)

Query: 378 QILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKR- 436
           QI  +MG +G GKTTL+ +LA            K+N ++  +K   K  G V Q  +   
Sbjct: 428 QIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGFVDQNDYLHP 487

Query: 437 ---IRAQFLNP---------QFQT------DVVKPLKIDDIIDQEVQH-----LSGGELQ 473
              +    LN           F++       +++ L+I DI D+ + +     +SGGE +
Sbjct: 488 TLTVYETVLNSALLRLPRTMSFESKQSRVFQILEELRIFDIKDRIIGNDFERGISGGEKR 547

Query: 474 RVAIVLSLGMNADIYLIDEPSAYLDSEQ 501
           RV+I   L  +  I  +DEP++ LD+  
Sbjct: 548 RVSIACELVTSPLILFLDEPTSGLDANN 575

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 79/179 (44%), Gaps = 30/179 (16%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFEDPPEWQEIIKYFRGSEL 152
           +PGQ+  ++G +G GK+T L ILA K+K           G       + ++I +   ++ 
Sbjct: 425 KPGQIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGFVDQNDY 484

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPR--AIKGPVQKVGELL-KLRLEKSKDDAKRYIDIL 209
            +    + E  + + +       +PR  + +    +V ++L +LR+   KD         
Sbjct: 485 LHPTLTVYETVLNSALL-----RLPRTMSFESKQSRVFQILEELRIFDIKD--------- 530

Query: 210 QLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
             + + N     +SGGE +R +I    V    +   DEP+S LD     NA  +I SL+
Sbjct: 531 --RIIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDAN---NANNVITSLV 584

>ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W
            (PDR15) - NSH] complement(628623..633161) [4539 bp, 1512
            aa]
          Length = 1512

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 85/213 (39%), Gaps = 64/213 (30%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L +LA + +                                
Sbjct: 881  KPGTLTALMGSSGAGKTTLLDVLANRVR-------------------------------- 908

Query: 161  EDDIKAIIKPQYVDNIPRA--------------IKGPVQKVGELLK----LRLEKSKDDA 202
               +  +    +VD +PR               + G  Q V + LK    LR  +S  +A
Sbjct: 909  ---VGVVTGDMFVDGLPRGASFQRNTGYCQQQDLHGCTQTVRDALKFSAYLRQPQSVSEA 965

Query: 203  K--RYID----ILQLKNVLNREVSALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSY 251
            +   Y++    +L+++   +  V     G    + +R  IG+  V + ++ +F DEP+S 
Sbjct: 966  EIDAYVEDIIRLLEMEAYADAIVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSG 1025

Query: 252  LDVKQRLNAALIIRSLLNPTTYVICVEHDLSVL 284
            LD +   +   ++R L N    V+C  H  S +
Sbjct: 1026 LDSQTAWSVCQLMRKLANHGQAVLCTIHQPSAI 1058

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 87/211 (41%), Gaps = 36/211 (17%)

Query: 367  LTVEAGEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPADDGQD-IPK-----LNVS 415
            LT   G      +  +MG +G GKTTL+ +LA     G +  D   D +P+      N  
Sbjct: 873  LTNVDGWVKPGTLTALMGSSGAGKTTLLDVLANRVRVGVVTGDMFVDGLPRGASFQRNTG 932

Query: 416  MKPQKIAPKFTGTVRQLFFKRIRAQFLNPQ---------FQTDVVKPLKI----DDIIDQ 462
               Q+     T TVR     +  A    PQ         +  D+++ L++    D I+  
Sbjct: 933  YCQQQDLHGCTQTVRDAL--KFSAYLRQPQSVSEAEIDAYVEDIIRLLEMEAYADAIVGV 990

Query: 463  EVQHLSGGELQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRRF--------- 512
              + L+  + +R+ I + L    ++ L +DEP++ LDS+      +++R+          
Sbjct: 991  TGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSVCQLMRKLANHGQAVLC 1050

Query: 513  ILHNKKTAFIVEHDFIMATYLADKVIVFDGI 543
             +H      + E D ++      + + F G+
Sbjct: 1051 TIHQPSAILMQEFDRLLLLASGGRTVYFGGL 1081

>Scas_108.1
          Length = 335

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 58/131 (44%), Gaps = 11/131 (8%)

Query: 179 AIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVS-----ALSGGELQRFAIG 233
           A K P ++V  + K   E  K   + Y  I  L++  + +V       +SGGE +R +I 
Sbjct: 1   ACKTPAKRVNNISKA--EYVKTTRELYATIFGLRHTYHTKVGNDFVRGVSGGERKRVSIA 58

Query: 234 MSCVQEADVYMFDEPSSYLDVKQRLNAALIIR---SLLNPTTYVICVEHDLSVLDYLSDF 290
            + V    VY +D  +  LD    L  A  IR   +LL  T +V   +   ++ +   D 
Sbjct: 59  EALVANGSVYCWDNATRGLDASTALEYAKAIRIMTNLLESTAFVTIYQASENIYETF-DK 117

Query: 291 VCIIYGVPSVY 301
           V ++Y    +Y
Sbjct: 118 VTVLYDGRQIY 128

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 10/85 (11%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 521
           V+ +SGGE +RV+I  +L  N  +Y  D  +  LD+   +  +K IR  I+ N  + TAF
Sbjct: 44  VRGVSGGERKRVSIAEALVANGSVYCWDNATRGLDASTALEYAKAIR--IMTNLLESTAF 101

Query: 522 IVEH---DFIMATYLADKV-IVFDG 542
           +  +   + I  T+  DKV +++DG
Sbjct: 102 VTIYQASENIYETF--DKVTVLYDG 124

>Scas_710.50
          Length = 602

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 77/166 (46%), Gaps = 22/166 (13%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG---------RFEDPPEWQEIIKYFRG 149
           T +PG +  ++G +G GKST L +++G+ + +            F D    +E+ K    
Sbjct: 25  TFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQISEEMFK---- 80

Query: 150 SELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDIL 209
               N  + + +DD   + K    +    A    +  + E  + R+ KS D+  R + + 
Sbjct: 81  ----NVCSYVSQDDDHLLAKLTVRETFKFAADLRLHNLTE--EQRVIKS-DELIRALGLK 133

Query: 210 QLKN--VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
             +N  + N  +  +SGGE +R  +G+  + +  + + DEP+S LD
Sbjct: 134 HCENNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLD 179

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 82/183 (44%), Gaps = 33/183 (18%)

Query: 374 FSDSQILVMMGENGTGKTTLIKLLAGAIPA--------------DDGQDIPKL------N 413
           F    I  +MG +G+GK+TL+ L++G I +              +D Q   ++       
Sbjct: 26  FKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQISEEMFKNVCSY 85

Query: 414 VSMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKI----------DDIIDQE 463
           VS     +  K T  VR+ F      +  N   +  V+K  ++          ++II  E
Sbjct: 86  VSQDDDHLLAKLT--VRETFKFAADLRLHNLTEEQRVIKSDELIRALGLKHCENNIIGNE 143

Query: 464 -VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI 522
            ++ +SGGE +RV + + L  +  I L+DEP++ LDS       +++++  +   KT  I
Sbjct: 144 FIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILEILKKLSVEYGKTIII 203

Query: 523 VEH 525
             H
Sbjct: 204 TIH 206

>CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 or sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 608

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 26/181 (14%)

Query: 352 AFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQ-DIP 410
           +F Y + K    + +  +  GE      +  +G +G GK+T+  LL        G   I 
Sbjct: 372 SFAYSNGKSVLSEMNFQIHPGEH-----VCFVGGSGCGKSTISSLLLRYYRTGSGNISIG 426

Query: 411 KLNVSMKPQKIAPKFTGTVRQ---LFFKRIRAQF---LNPQFQTDVVKPLK--------- 455
             ++S    +   +  G V+Q   LF   I       L+ +  TD+   LK         
Sbjct: 427 NYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDKSLTDLNMALKAANCDQFIK 486

Query: 456 -----IDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIR 510
                +D ++      LSGG+ QR+A+      N DI ++DE ++ LD++   I +K ++
Sbjct: 487 ESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKELQ 546

Query: 511 R 511
           R
Sbjct: 547 R 547

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR--LNAALIIRSLLNPTTYVICVEH 279
           LSGG+ QR A+    +Q  D+ + DE +S LD K    +N  L  R     TT  I + H
Sbjct: 503 LSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKELQRRQEAGMTT--ISIAH 560

Query: 280 DLSVLDYLSDFVCI 293
            LS + + S  + I
Sbjct: 561 RLSTIRHSSRVIVI 574

>Scas_455.1
          Length = 925

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 98/231 (42%), Gaps = 33/231 (14%)

Query: 335 QFRMADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLI 394
           Q  +A  GD+LE       T      +  DF L     +F   ++ V++G  G+GKT+L+
Sbjct: 702 QLTVAPQGDQLEFKN----TTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLL 757

Query: 395 KLLAGAIPADDGQDIPKLNVSMKPQK-IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVV-- 451
             L G +   +G+ I     S+ P++ +     GT   + +    A  LN   + +++  
Sbjct: 758 MALLGEMKIMEGEIIVP---SLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFN 814

Query: 452 ---------------------KPLKIDDI--IDQEVQHLSGGELQRVAIVLSLGMNADIY 488
                                + LK  D+  I ++   LSGG+ QRV++  ++  N+   
Sbjct: 815 SPYNEARYTSVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHI 874

Query: 489 LIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
           L+D+  + +DS   +          L + +T  +V H+  +    AD V++
Sbjct: 875 LLDDCLSAVDSHTALWIYDNCITGPLMDGRTCILVSHNIALTLKNADLVVI 925

>YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters, represents a half-sized ABC protein [2322
           bp, 773 aa]
          Length = 773

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 133/325 (40%), Gaps = 52/325 (16%)

Query: 210 QLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALI----IR 265
           QL  +   +     G EL R+ + +      D++   + +++ + K     +L+      
Sbjct: 313 QLSGIKTVQSFVAEGNELSRYNVAIR-----DIFQVGKTAAFTNAKFFTTTSLLGDLSFL 367

Query: 266 SLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGIN----IF-LDG 320
           ++L   +Y++ ++  LS+ D  +  +   Y   +V+G+ T  S + +G      +F L  
Sbjct: 368 TVLAYGSYLV-LQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426

Query: 321 HIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQIL 380
             PS +    T   +++  D G     D S  F+YP     Q   +L  +    S    +
Sbjct: 427 RKPSIS---PTVGHKYK-PDRGVIEFKDVS--FSYPTRPSVQIFKNLNFKIAPGSS---V 477

Query: 381 VMMGENGTGKTTLIKLL-------AGAIPADDGQDIPKLNVSMKPQKIA------PKFTG 427
            ++G +G GK+T+  LL        G I  D+ QDI KLN     + I          +G
Sbjct: 478 CIVGPSGRGKSTIALLLLRYYNPTTGTITIDN-QDISKLNCKSLRRHIGIVQQEPVLMSG 536

Query: 428 TVRQLF------------FKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRV 475
           T+R                + +  Q     F T    P   D +I      LSGG+ QR+
Sbjct: 537 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--PNTYDTVIGPHGTLLSGGQKQRI 594

Query: 476 AIVLSLGMNADIYLIDEPSAYLDSE 500
           AI  +L     I ++DE ++ LD E
Sbjct: 595 AIARALIKKPTILILDEATSALDVE 619

>ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH]
           complement(395427..397691) [2265 bp, 754 aa]
          Length = 754

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 83/198 (41%), Gaps = 29/198 (14%)

Query: 352 AFTYPDMKRTQ--GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPAD----- 404
           +F+YP    +Q      LT+  G       + ++G +G GK+T+  LL     A+     
Sbjct: 463 SFSYPTRPTSQIFKKLRLTITPGSN-----VCIVGPSGRGKSTIASLLLRFYDANSGTIL 517

Query: 405 -DGQDIPKLNV-SMKP-----QKIAPKFTGTVRQLF---------FKRIRAQFLNPQFQT 448
            DGQDI K++  S++      Q+     +GT+R               IRA         
Sbjct: 518 IDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHN 577

Query: 449 DVVK-PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSK 507
            + K P   D +I      LSGG+ QR+AI  +L     I ++DE ++ LD E     + 
Sbjct: 578 FITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINY 637

Query: 508 VIRRFILHNKKTAFIVEH 525
            + R +   + T   + H
Sbjct: 638 TLGRLMRSKEITIVSIAH 655

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR--LNAALIIRSLLNPTTYVICVEH 279
           LSGG+ QR AI  + +++  + + DE +S LDV+    +N  L  R + +    ++ + H
Sbjct: 597 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL-GRLMRSKEITIVSIAH 655

Query: 280 DLSVLDYLSDFVCI 293
            LS +    + V +
Sbjct: 656 RLSTIRRSENIVVL 669

>Sklu_2343.3 YPL270W, Contig c2343 2058-4382
          Length = 774

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 83/366 (22%), Positives = 147/366 (40%), Gaps = 65/366 (17%)

Query: 275 ICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGIN----IF-LDGHIPSENLRF 329
           + ++  LS+ D  +  +   Y   +V+G+    S + +G      +F L  H PS    +
Sbjct: 403 LVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSI---Y 459

Query: 330 RTEALQFRMADAGDELEADASRAFTYPDMKRTQ--GDFSLTVEAGEFSDSQILVMMGENG 387
            T+ + +       + E   + +F+YP     Q   + + T+++G    S + V+ G +G
Sbjct: 460 ATKGVPYVPGKGEIKFE---NVSFSYPTRSANQIFNNLNFTIDSG----SNVCVV-GPSG 511

Query: 388 TGKTTLIKLL-------AGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQ---LFFKRI 437
            GK+T+  LL       +G I  D GQDI K++      K   +  G V+Q   L    I
Sbjct: 512 RGKSTIASLLLKYYNPTSGRITID-GQDISKISA-----KSLRRHLGVVQQEPILMSGSI 565

Query: 438 RAQFLNPQFQTDVVKPLK------------------IDDIIDQEVQHLSGGELQRVAIVL 479
           R         T  +  ++                   + +I  +   LSGG+ QR+AI  
Sbjct: 566 RDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIAR 625

Query: 480 SLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
           +L    +I ++DE ++ LD E     +  + + +     T   + H  +     ++ VIV
Sbjct: 626 ALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR-LSTIRRSENVIV 684

Query: 540 FDGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFR-----------PRINKLDSQ 588
                S     +  E   +  +K  K LN    RD TS R           P+  KL  +
Sbjct: 685 LGDDGSVVEMGKFKELYASKESKLYKLLNEK-ARDTTSKRNAEAVEKNDPSPKAEKLSDE 743

Query: 589 MDKEQK 594
             +EQ+
Sbjct: 744 EKEEQR 749

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 212 KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPT 271
           + V+  + + LSGG+ QR AI  + +++ ++ + DE +S LDV+        +  L+   
Sbjct: 603 ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662

Query: 272 -TYVICVEHDLSVL 284
              +I + H LS +
Sbjct: 663 DITIISIAHRLSTI 676

>Scas_622.9
          Length = 1657

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 91/209 (43%), Gaps = 33/209 (15%)

Query: 362 QGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDI-PKLNVSMKPQK 420
           + DF L     EF    + V++G  G+GKT+L+  L G +  + G+ I P LN    P++
Sbjct: 724 EEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEIIVPALN----PRQ 779

Query: 421 --IAPKFTGTVRQLFFKRIRAQFLNPQFQTDV-----------------------VKPLK 455
             +  KF G    + +    A  LN   + ++                       +K LK
Sbjct: 780 DLVIDKF-GLTNSIAYCSQAAWLLNETVRNNILFNSPYNEERYNAVIDACGLRRDLKILK 838

Query: 456 IDDI--IDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFI 513
             D+  I ++   LSGG+ QRV++  +L  N+   L+D+  + +DS   +          
Sbjct: 839 ASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTALWIYDNCITGP 898

Query: 514 LHNKKTAFIVEHDFIMATYLADKVIVFDG 542
           L + +T  +V H+  +    A+ V++ + 
Sbjct: 899 LMSGRTCILVSHNIALTLKNAELVVILEN 927

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 93/215 (43%), Gaps = 41/215 (19%)

Query: 382  MMGENGTGKTTLIKLL-------AGAIPADDGQDIPKLNVS--MKPQKIAPK----FTGT 428
            ++G  G GK+T+I  +       +G I  DD  +I  +N++   +   I P+    FTGT
Sbjct: 1418 IVGRTGAGKSTIITAMFRFLNPESGYIKIDD-VNIASINLTKLRRSITIIPQDPTLFTGT 1476

Query: 429  VR------------QLF--FKRI----RAQFLNPQFQT----DVVKPLKIDDIIDQEVQH 466
            ++             +F   KR+      +  N   QT    +  K L +++ I +   +
Sbjct: 1477 IKLNLDPYNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLNLENEITEGGSN 1536

Query: 467  LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            LS G+ Q V +  SL  N  I L+DE +A +D        + IR+    ++ T   + H 
Sbjct: 1537 LSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRK--EFSQSTILTIAHR 1594

Query: 527  FIMATYLADKVIVFDGIPSKQAFARAPESLLTGCN 561
             + +    DK+IV D    K+     P SLL   N
Sbjct: 1595 -LRSVIDYDKIIVMDAGEVKE--YDHPYSLLLDKN 1626

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 87/200 (43%), Gaps = 25/200 (12%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RFEDPPEWQEIIKYFRGSELQNYFTKM 159
            P   +G+VG  G GKST +  +     P  G  + +D       I     ++L+   T +
Sbjct: 1412 PKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVN-----IASINLTKLRRSITII 1466

Query: 160  LED------DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEK------SKDDAKRYID 207
             +D       IK  + P Y +    AI   +++V  + +  L+       + ++A ++  
Sbjct: 1467 PQDPTLFTGTIKLNLDP-YNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKF-- 1523

Query: 208  ILQLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSL 267
             L L+N +    S LS G+ Q   +  S ++   + + DE ++ +D          IR  
Sbjct: 1524 -LNLENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRKE 1582

Query: 268  LNPTTYVICVEHDL-SVLDY 286
             + +T ++ + H L SV+DY
Sbjct: 1583 FSQST-ILTIAHRLRSVIDY 1601

>Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement
          Length = 1310

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 98/241 (40%), Gaps = 59/241 (24%)

Query: 318  LDGHIPSENLRFRTEALQFRMAD-----AGDELEADASRAFT-------------YPDMK 359
            L G IP  +   R     FR+ D     A DE +  AS  FT             YP   
Sbjct: 1028 LIGQIPDISRGQRAATYIFRIIDNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAP 1087

Query: 360  RTQ--GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLA-------GAIPADDGQDIP 410
             T       L V +GE      + ++GE+G+GK+TL  L++       G+I  D G DI 
Sbjct: 1088 STAIYKGLKLDVFSGE-----TIAVVGESGSGKSTLTLLISALYEVPNGSIEID-GIDIN 1141

Query: 411  KLN----------VSMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQ--------TDVV- 451
            + +          V  KPQ     F GTV +     I  +    Q +         D V 
Sbjct: 1142 RWDTNKLRTIISVVEQKPQF----FDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVF 1197

Query: 452  -KPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIR 510
              P  +D  ID  +  +SGG+ QR++I  ++     I  +DE ++ LD+      + +I+
Sbjct: 1198 SLPEGLDTRIDTSL--ISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIK 1255

Query: 511  R 511
            +
Sbjct: 1256 K 1256

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 78/184 (42%), Gaps = 28/184 (15%)

Query: 102  PGQVLGLVGTNGIGKST-ALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKML 160
             G+ + +VG +G GKST  L I A  + PN G  E             G ++  + T  L
Sbjct: 1101 SGETIAVVGESGSGKSTLTLLISALYEVPN-GSIE-----------IDGIDINRWDTNKL 1148

Query: 161  EDDIKAI-IKPQYVD-----NIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNV 214
               I  +  KPQ+ D     N+   I G V ++     L L   +D       +  L   
Sbjct: 1149 RTIISVVEQKPQFFDGTVGENLLYGISGRVTQIQVKEALCLAGVQDF------VFSLPEG 1202

Query: 215  LNREV--SALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQ-RLNAALIIRSLLNPT 271
            L+  +  S +SGG+ QR +I  + +++  +   DE +S LD       A LI +     T
Sbjct: 1203 LDTRIDTSLISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIKKHFCGIT 1262

Query: 272  TYVI 275
            T VI
Sbjct: 1263 TIVI 1266

>CAGL0M07293g complement(733072..737619) similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 or sp|P32568
            Saccharomyces cerevisiae YDR011w, hypothetical start
          Length = 1515

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 82/193 (42%), Gaps = 34/193 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFED---------PPEWQEIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ N+G             P  +     Y   ++
Sbjct: 872  KPGKMTALMGESGAGKTTLLNVLA--QRINMGVITGDMLVNSQSLPASFNRSCGYVAQAD 929

Query: 152  LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQL 211
                   M E  ++  ++       PR++              LE+  +  ++ I +L +
Sbjct: 930  -----NHMAELSVRESLRFAAELRQPRSVP-------------LEEKYEYVEKIIALLGM 971

Query: 212  KNVLNREVSALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRS 266
            +N     V     G    + ++ +IG+  V +  + +F DEP+S LD +   +    +R+
Sbjct: 972  QNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRA 1031

Query: 267  LLNPTTYVICVEH 279
            L +    ++C  H
Sbjct: 1032 LADSGQSILCTIH 1044

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 79/190 (41%), Gaps = 43/190 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFE-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G F  D  + +E++K ++G      EL 
Sbjct: 177 GEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMMKNYKGYVIYCPELD 236

Query: 154 NYFTKMLEDD--------------IKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSK 199
            +F K+   +              I  + + QYVDNI R +   V        LR   + 
Sbjct: 237 FHFPKITVKETIDFALKCKTPRVRIDRMTRKQYVDNI-RDMWCTV------FGLRHTYA- 288

Query: 200 DDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLN 259
                         V N  V  +SGGE +R ++  +    A +Y +D  +  LD    L 
Sbjct: 289 ------------TKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALE 336

Query: 260 AALIIRSLLN 269
            A  IR+  N
Sbjct: 337 FAQAIRTATN 346

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV++V +  MNA IY  D  +  LD+   +  ++ IR
Sbjct: 296 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 342

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 8/47 (17%)

Query: 372 GEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPAD---DGQDIP 410
           G     ++  +MGE+G GKTTL+ +LA     G I  D   + Q +P
Sbjct: 869 GYVKPGKMTALMGESGAGKTTLLNVLAQRINMGVITGDMLVNSQSLP 915

>Scas_587.8
          Length = 715

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 84/185 (45%), Gaps = 35/185 (18%)

Query: 352 AFTYPD--MKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-------AGAIP 402
           +F YP         + S++++ GE      + ++G +G+GK+T+  LL        G+I 
Sbjct: 449 SFAYPTRPTHSILNNLSISIQPGEH-----VCIVGPSGSGKSTVSSLLLRYYDVSTGSIK 503

Query: 403 ADDGQDIPKLNVSMK------PQKIAPKFTGTVR-QLFFKRIRAQFLNPQF--------Q 447
            D GQ+I + N+          Q+    F GT+   + +  +  + L            Q
Sbjct: 504 ID-GQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQ 562

Query: 448 TDVVKPLK-----IDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQR 502
            +  K LK     ++ ++      LSGG+ QR+A+  +  ++  + ++DE ++ LDS+  
Sbjct: 563 ANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSE 622

Query: 503 IICSK 507
            I +K
Sbjct: 623 EIVAK 627

>YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [3150 bp, 1049 aa]
          Length = 1049

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 92/219 (42%), Gaps = 39/219 (17%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFEDPPEWQEIIKYFRGSEL 152
           +PGQ+L ++G +G GK+T L ILA K+K           G   D   + +II +    + 
Sbjct: 414 KPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDF 473

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAI-----KGPVQKVGELLKLRLEKSKDDAKRYID 207
                 + E  + + +       +P+A+     K  V KV E L++   K +        
Sbjct: 474 LLPTLTVFETVLNSALL-----RLPKALSFEAKKARVYKVLEELRIIDIKDRIIG----- 523

Query: 208 ILQLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSL 267
                N  +R    +SGGE +R +I    V    V   DEP+S LD     NA  +I  L
Sbjct: 524 -----NEFDR---GISGGEKRRVSIACELVTSPLVLFLDEPTSGLDAS---NANNVIECL 572

Query: 268 LNPT-----TYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
           +  +     T V+ +    S + YL D + ++     VY
Sbjct: 573 VRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVY 611

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 98/242 (40%), Gaps = 34/242 (14%)

Query: 378 QILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQ------ 431
           QIL +MG +G GKTTL+ +LA            K+N     +K   K  G V Q      
Sbjct: 417 QILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDFLLP 476

Query: 432 ---LFFKRIRAQFLN-PQFQTDVVKPLKIDDIIDQEV--------------QHLSGGELQ 473
              +F   + +  L  P+  +   K  ++  ++++                + +SGGE +
Sbjct: 477 TLTVFETVLNSALLRLPKALSFEAKKARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKR 536

Query: 474 RVAIVLSLGMNADIYLIDEPSAYLD-SEQRIICSKVIRRFILHNKKTAFIVEHDFIMATY 532
           RV+I   L  +  +  +DEP++ LD S    +   ++R    +N+     +        Y
Sbjct: 537 RVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFY 596

Query: 533 LADKVI-------VFDGIPSKQAFARAPESLLTGCNKFLKN--LNVTFRRDPTSFRPRIN 583
           L DK++       V+ G   K +     E  +   N  + +  +++TF   P   R RI 
Sbjct: 597 LFDKLVLLSKGEMVYSGNAKKVSEFLRNEGYICPDNYNIADYLIDITFEAGPQGKRRRIR 656

Query: 584 KL 585
            +
Sbjct: 657 NI 658

>Scas_707.8
          Length = 294

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 72/167 (43%), Gaps = 16/167 (9%)

Query: 96  RLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRF----EDPPEWQEIIKYFRGSE 151
           +L  P   + L +VG NG GKST LK+LAGK     G+      DP        +   S 
Sbjct: 27  KLQVPWHTRTL-VVGANGAGKSTLLKLLAGKHLCLNGKILVNGLDP--------FSPLSM 77

Query: 152 LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLK-LRLEKSKDDAKRYIDILQ 210
            Q+      ED    +      +    +I      V ELL+ + L   +D   + I+IL 
Sbjct: 78  YQDNDKTTAEDKDWQVTTYLGTEWCHMSIINRDIGVLELLESIGLAHYRDRGNKLIEILD 137

Query: 211 LKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           +   +N  +  LS G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 138 IN--INWRMHRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDVIAR 182

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 77/188 (40%), Gaps = 27/188 (14%)

Query: 381 VMMGENGTGKTTLIKLLAGAIPADDG----------------QDIPKLNVSMKPQKIAPK 424
           +++G NG GK+TL+KLLAG     +G                QD  K     K  ++   
Sbjct: 37  LVVGANGAGKSTLLKLLAGKHLCLNGKILVNGLDPFSPLSMYQDNDKTTAEDKDWQVTT- 95

Query: 425 FTGTV--------RQLFFKRIRAQFLNPQFQTDVVKPLKIDDI-IDQEVQHLSGGELQRV 475
           + GT         R +    +        ++    K ++I DI I+  +  LS G+ +RV
Sbjct: 96  YLGTEWCHMSIINRDIGVLELLESIGLAHYRDRGNKLIEILDININWRMHRLSDGQKRRV 155

Query: 476 AIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFI-MATYLA 534
            + + L     + L+DE +  LD   R    + +R      K +     H F  +AT+  
Sbjct: 156 QLAMGLLKPWRVLLLDEVTVDLDVIARSRLLEFLRWETNTRKCSVIYATHIFDGLATWPD 215

Query: 535 DKVIVFDG 542
           + V + DG
Sbjct: 216 NVVHLKDG 223

>KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces
           cerevisiae YKL209c STE6 ATP-binding cassette transporter
           protein, hypothetical start
          Length = 1271

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query: 453 PLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P  ID ++ +    LSGG+ QRVA+  +   N  + ++DE  + LD   R +  + IR +
Sbjct: 482 PNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIRHW 541

Query: 513 ILHNKKTAFIVEHDF 527
                KT  I+ H++
Sbjct: 542 --RKGKTTIILTHEY 554

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 111/242 (45%), Gaps = 41/242 (16%)

Query: 323  PSENLRFRTEALQFRMADAGDELE-ADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILV 381
            PS+N  F      F  A   + ++ ++ S AF+   M +     S      E   ++ + 
Sbjct: 1017 PSQNQSF------FSTAGNRETIKISNLSFAFSSAPMNKIFNSLSC-----EICLNETVG 1065

Query: 382  MMGENGTGKTTLIKLLAGAIPADDGQ------DIPKLN-------VSMKPQKIAPKF-TG 427
            ++GE+G+GK+TL  LL    P   G+      DI K +       +S+  QK  PKF  G
Sbjct: 1066 IVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQK--PKFFDG 1123

Query: 428  TVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDII-------DQEVQH--LSGGELQRVAIV 478
            TVR+     ++    N + ++ V+K + +   +       +  V    +SGG+ QR++I 
Sbjct: 1124 TVRENLVYGLKRNVSNSELRS-VLKSVDLLSFVQTLPNDLNTRVHDGLMSGGQAQRLSIA 1182

Query: 479  LSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 538
             +L     I ++DE ++ LD+      +++IR  +L N     I   + +M   + D+V+
Sbjct: 1183 RTLLRQPKIIILDECTSALDAANSFAIAELIRT-VLKNVTVIVITHSEQLMQ--ICDRVL 1239

Query: 539  VF 540
            V 
Sbjct: 1240 VL 1241

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 211  LKNVLNREV--SALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
            L N LN  V    +SGG+ QR +I  + +++  + + DE +S LD       A +IR++L
Sbjct: 1158 LPNDLNTRVHDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVL 1217

Query: 269  NPTTYVICVEHD 280
               T VI + H 
Sbjct: 1218 KNVT-VIVITHS 1228

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 211 LKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           +  +L R    LSGG+ QR A+  + ++   V + DE  S LD+  R
Sbjct: 485 IDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSR 531

>KLLA0B09702g complement(842245..846801) highly similar to sp|Q02785
           Saccharomyces cerevisiae YPL058c PDR12 multidrug
           resistance transporter, start by similarity
          Length = 1518

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 96/224 (42%), Gaps = 29/224 (12%)

Query: 95  HRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFE-DPPEWQEIIKYFRGS 150
           H +     G++L +VG  G G ST LK ++G+    +   G F  D     E+++ F+G 
Sbjct: 167 HCVGVVESGEMLFVVGRPGAGCSTLLKCVSGETSELVEVTGDFSYDGLSQAEMMEKFKGY 226

Query: 151 -----ELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRY 205
                EL  +F K+    +K  I      +     K P  ++  L + +   +  D   +
Sbjct: 227 VIYCPELDFHFPKI---TVKETI------DFALKCKTPRVRIDHLSRNQYVDNMRDL--W 275

Query: 206 IDILQLK-----NVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNA 260
             +  L+     NV N  V  +SGGE +R ++  +    A +Y +D  +  LD    L  
Sbjct: 276 CTVFGLRHTYATNVGNDVVRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEF 335

Query: 261 ALIIRS---LLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSVY 301
           A  IR+   L+N +  V   +   ++ + L D   ++Y    VY
Sbjct: 336 AQAIRTATNLMNNSAIVAIYQAGENIYE-LFDKTTVLYNGKQVY 378

 Score = 36.2 bits (82), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV++V +L M+A IY  D  +  LD+   +  ++ IR
Sbjct: 294 VRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEFAQAIR 340

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 84/193 (43%), Gaps = 34/193 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFED---------PPEWQEIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ ++G             P  +     Y   S+
Sbjct: 870  KPGKMTALMGESGAGKTTLLNVLA--QRISVGVITGDMLVNAKDLPLSFNRSCGYVAQSD 927

Query: 152  LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQL 211
                   M E  ++  ++       P+++              L++  D  ++ I +L +
Sbjct: 928  -----NHMGELSVRESLRFAAELRQPKSVP-------------LQEKYDYVEKIISLLGM 969

Query: 212  KN----VLNREVSALSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRS 266
            +     ++ +    L+  + ++ +IG+  V +  + +F DEP+S LD +   +    +R+
Sbjct: 970  EKYAEAIIGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRA 1029

Query: 267  LLNPTTYVICVEH 279
            L +    ++C  H
Sbjct: 1030 LADSGQSILCTIH 1042

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 8/47 (17%)

Query: 372 GEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPAD---DGQDIP 410
           G     ++  +MGE+G GKTTL+ +LA     G I  D   + +D+P
Sbjct: 867 GYVKPGKMTALMGESGAGKTTLLNVLAQRISVGVITGDMLVNAKDLP 913

>Scas_468.1
          Length = 691

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 75/176 (42%), Gaps = 35/176 (19%)

Query: 352 AFTYPDMKRTQ--GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-------AGAIP 402
           +F+YP   + Q   + +  +E G       + ++G +G GK+T+  LL       +G I 
Sbjct: 396 SFSYPTRPQNQIFKNLNFKIEPGSN-----VCIVGPSGKGKSTIALLLLHYYNPTSGQIL 450

Query: 403 ADDGQDIPKLN----------VSMKP--------QKIAPKFTGTVRQLFFKRIRAQFLNP 444
            D GQDI K+N          V  +P          I    T T  +   +++  Q    
Sbjct: 451 ID-GQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH 509

Query: 445 QFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSE 500
            F T    P   D  I      LSGG+ QR+AI  +L    +I ++DE ++ LD E
Sbjct: 510 NFITKF--PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 563

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLL-NPTTYVICVEHD 280
           LSGG+ QR AI  + +++ ++ + DE +S LDV+           L+   +  ++ + H 
Sbjct: 530 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR 589

Query: 281 LSVL 284
           LS +
Sbjct: 590 LSTI 593

>CAGL0L06402g 718726..723333 highly similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 or sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 70/156 (44%), Gaps = 20/156 (12%)

Query: 356 PDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVS 415
           P+ K    + +   + GE S      ++G+ G+GK+  ++ L G +    G      +V+
Sbjct: 659 PEYKVALKNINYQAKKGELS-----CIVGKVGSGKSAFLQSLLGDLFRVKGFATIHGSVA 713

Query: 416 MKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKP--LKID---------DIIDQEV 464
              Q +A    GTVR      +     +P+F    +K   L ID          ++ ++ 
Sbjct: 714 YVSQ-VAWIMNGTVRD---NVLFGHKYDPEFYEKTIKACALTIDLATLVDGDQTLVGEKG 769

Query: 465 QHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSE 500
             LSGG+  R+++  ++   AD YL+D+P A +D  
Sbjct: 770 ISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEH 805

>ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
           NSH] (623887..628353) [4467 bp, 1488 aa]
          Length = 1488

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 17/179 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQK-----PNLGRFEDPPEWQEIIKYFRGSELQNY 155
           RPG+++ ++G  G G ++ LK +AG+            ++  P+ +E+++ +R   + N 
Sbjct: 186 RPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVEGAISYDGIPQ-REMMRRYRAEVVYN- 243

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKN-- 213
               ++     +   Q +D    A K P  +V  +   R E      + Y  +  L++  
Sbjct: 244 --SEIDVHFPHLTVKQTLD-FALACKTPHMRVNNV--SRAEYITLMRELYATVFGLRHTY 298

Query: 214 ---VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLN 269
              V N  +  +SGGE +R +I  +    A VY +D  +  LD    L  A  +R + N
Sbjct: 299 DTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIMTN 357

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIR 510
           ++ +SGGE +RV+I  +L  NA +Y  D  +  LD+   +  ++ +R
Sbjct: 307 IRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMR 353

>YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar
           glutathione S-conjugate transporter, member of the
           ATP-binding cassette (ABC) superfamily [4548 bp, 1515
           aa]
          Length = 1515

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 81/173 (46%), Gaps = 19/173 (10%)

Query: 382 MMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQ--LFFKRIRA 439
           ++G+ G+GKT L+  + G +    G      +V+   Q +     GTV++  LF  R  A
Sbjct: 661 IVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQ-VPWIMNGTVKENILFGHRYDA 719

Query: 440 QFLNPQFQTDVVKPLKID---------DIIDQEVQHLSGGELQRVAIVLSLGMNADIYLI 490
           +F     +T     L ID          ++ ++   LSGG+  R+++  ++   AD YL+
Sbjct: 720 EFYE---KTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLL 776

Query: 491 DEPSAYLDSE-QRIICSKVIR-RFILHNKKTAFIVEHDFIMATYLADKVIVFD 541
           D+P A +D    R +   V+    +LH K    ++  + + A  +AD + + D
Sbjct: 777 DDPLAAVDEHVARHLIEHVLGPNGLLHTKTK--VLATNKVSALSIADSIALLD 827

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 172 YVDNIPRAIKGPVQK---VGELLKLRL-EKSKDDAKRYIDILQL----KNVLNREVSALS 223
           YV  +P  + G V++    G        EK+       ID+  L    K ++  +  +LS
Sbjct: 695 YVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLS 754

Query: 224 GGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           GG+  R ++  +    AD Y+ D+P + +D
Sbjct: 755 GGQKARLSLARAVYARADTYLLDDPLAAVD 784

>Kwal_23.5161
          Length = 1489

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 79/166 (47%), Gaps = 28/166 (16%)

Query: 371  AGEFSDSQILVMMGENGTGKTTLIKLLA----GAIPAD---DGQDI----PKLNVSMKPQ 419
            +G  +   +  +MGE+G GKTTL+  LA    G I  D   +G+ I     +    ++ Q
Sbjct: 868  SGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGKPIDASFERRTGYVQQQ 927

Query: 420  KIAPKFTGTVRQLFFKRIRAQFLNPQ---------FQTDVVKPLKIDDIIDQEVQHLSGG 470
             +  K   TVR+ F  +  A+   PQ         +   +++ L ++D  +  +  +  G
Sbjct: 928  DVHVK-EMTVRESF--QFAARMRRPQSIPESEKLAYVEKIIEILDMEDYAEALIGDVGYG 984

Query: 471  ----ELQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRR 511
                + ++V+I + L    D+ L +DEP++ LDS+      +++RR
Sbjct: 985  LNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSSWAIVQLMRR 1030

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  +L     IY  D  +  LD+   +  ++ IR      K  A + 
Sbjct: 296 VRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAIRTMTNLQKSIALVT 355

Query: 524 EHDFIMATY-LADKV-IVFDGIPSKQAFARAPE 554
            +      Y   DKV +++DG   +Q F  A E
Sbjct: 356 IYQASENIYECFDKVTVLYDG---RQIFFGAIE 385

>YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein
            required for weak organic acid resistance, member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters [4536 bp, 1511 aa]
          Length = 1511

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 85/194 (43%), Gaps = 36/194 (18%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFED---------PPEWQEIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ N+G             P  +     Y   ++
Sbjct: 869  KPGKMTALMGESGAGKTTLLNVLA--QRINMGVITGDMLVNAKPLPASFNRSCGYV--AQ 924

Query: 152  LQNYFTKM-LEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQ 210
              N+  ++ + + ++   + +   ++P                 LE+  +  ++ I +L 
Sbjct: 925  ADNHMAELSVRESLRFAAELRQQSSVP-----------------LEEKYEYVEKIITLLG 967

Query: 211  LKNVLNREVSALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIR 265
            ++N     V     G    + ++ +IG+  V +  + +F DEP+S LD +   +    +R
Sbjct: 968  MQNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMR 1027

Query: 266  SLLNPTTYVICVEH 279
            +L +    ++C  H
Sbjct: 1028 ALADSGQSILCTIH 1041

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV++V +  MNA IY  D  +  LD+   +  ++ IR
Sbjct: 293 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 339

>KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces
           cerevisiae YGR281w YOR1 ATP-binding cassette transporter
           protein, start by similarity
          Length = 1454

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 89/196 (45%), Gaps = 27/196 (13%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFK 435
           +++ +++ G  GTGK++L+  LAG +    G    K ++ +         T     LF  
Sbjct: 601 ENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKGDLLLCGYPWVQNATVKDNILF-- 658

Query: 436 RIRAQFLNPQFQTDV-VKPLKID-DI--------IDQEVQHLSGGELQRVAIVLSLGMNA 485
              + F  P++Q  + +  L+ D DI        I +    LSGG+  R+A+  S+  + 
Sbjct: 659 --GSPFDKPKYQKVIEICSLQADLDILPAGDRTEIGERGITLSGGQKARIALARSVYKDM 716

Query: 486 DIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATY---LADKV--IVF 540
           DIYL D+  + +DS    +C  ++   ++      ++ +   I+AT+   L DK   ++F
Sbjct: 717 DIYLFDDVLSAVDSR---VCKHIVDECMM-----GYLKQKTRILATHQLSLIDKASRVIF 768

Query: 541 DGIPSKQAFARAPESL 556
            G+         PE L
Sbjct: 769 LGLDGSFDIGTVPELL 784

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 61/133 (45%), Gaps = 20/133 (15%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLD--VKQRLNAALIIRSLLNPTTYVICVEH 279
           LSGG+  R A+  S  ++ D+Y+FD+  S +D  V + +    ++  L   T   I   H
Sbjct: 698 LSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTR--ILATH 755

Query: 280 DLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMA 339
            LS++D  S    I  G+   + + T+P  ++                   ++ +QF+ +
Sbjct: 756 QLSLIDKASR--VIFLGLDGSFDIGTVPELLKRNTGF--------------SDLMQFQNS 799

Query: 340 DAGDELEADASRA 352
              +ELE D ++A
Sbjct: 800 APAEELEDDDTKA 812

>KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member singleton, start by similarity
          Length = 273

 Score = 37.4 bits (85), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 76/174 (43%), Gaps = 36/174 (20%)

Query: 352 AFTYPDMKRTQ-GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGA---------- 400
            + +P  KR+   D SL+VE     + ++LV+ G NG GK+TL+KLL+G           
Sbjct: 14  TYAFPGSKRSAIHDLSLSVEW----NKKVLVV-GNNGAGKSTLLKLLSGKHLCLGGNIKV 68

Query: 401 ------IPADDGQDI---PKLNVSMKPQKIAPKFTGTVRQL---FFKRIRAQFLNPQFQT 448
                  P +D + +     L        I  +  G +  L        RA+        
Sbjct: 69  GNKNPFAPNNDQESVILTTYLGTEWASMAIVHRDIGVLELLESIGLSHYRAR------GE 122

Query: 449 DVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQR 502
           ++V+ L++D  I+  +  LS G+ +RV + + L     + L+DE +  LD   R
Sbjct: 123 ELVRILEVD--INWRMFKLSDGQKRRVQLCMGLLKPFKVLLLDEVTVDLDVVAR 174

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 69/153 (45%), Gaps = 21/153 (13%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAI 167
           +VG NG GKST LK+L+GK     G  +                 +N F     +D +++
Sbjct: 40  VVGNNGAGKSTLLKLLSGKHLCLGGNIKVGN--------------KNPFAP--NNDQESV 83

Query: 168 IKPQYVDNIPRAIKGPVQKVG--ELLK-LRLEKSKDDAKRYIDILQLKNVLNREVSALSG 224
           I   Y+     ++    + +G  ELL+ + L   +   +  + IL++   +N  +  LS 
Sbjct: 84  ILTTYLGTEWASMAIVHRDIGVLELLESIGLSHYRARGEELVRILEVD--INWRMFKLSD 141

Query: 225 GELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 142 GQKRRVQLCMGLLKPFKVLLLDEVTVDLDVVAR 174

>YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein with
           similarity to mammalian ATP-dependent bile acid
           transporter, member of the ATP-binding cassette (ABC)
           superfamily [4986 bp, 1661 aa]
          Length = 1661

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 91/207 (43%), Gaps = 35/207 (16%)

Query: 364 DFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKP-QKIA 422
           DF L     EF   ++ V++G  G+GKT+L+  L G +   +G+ +     +++P Q++ 
Sbjct: 709 DFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVP---ALEPRQELI 765

Query: 423 PKFTGTVRQLFFKRIRAQFLNPQFQTDVV-----------------------KPLKIDDI 459
               GT   + +    A  LN   + +++                       + LK  D+
Sbjct: 766 VDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFEILKAGDL 825

Query: 460 --IDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFI---L 514
             I ++   LSGG+ QRV++  +L  NA   L+D+  + +DS      S +    I   L
Sbjct: 826 TEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHT---ASWIYDNCITGPL 882

Query: 515 HNKKTAFIVEHDFIMATYLADKVIVFD 541
              +T  +V H+  +    A+ V++ +
Sbjct: 883 MEDRTCILVSHNIALTLRNAELVVLLE 909

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 48/198 (24%)

Query: 356  PDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-------AGAIPADD--- 405
            P++ R   + S +V+A     S+I ++ G  G GK+T+I  L        G I  D+   
Sbjct: 1392 PNLPRVIKNVSFSVDA----QSKIGIV-GRTGAGKSTIITALFRFLEPETGHIKIDNIDI 1446

Query: 406  -GQDIPKL--NVSMKPQKIAPKFTGTV------------RQLFFKRIRAQFLNP-QFQT- 448
             G D+ +L  ++++ PQ     F+GT+            RQ+F    R   ++  Q Q  
Sbjct: 1447 SGVDLQRLRRSITIIPQD-PTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQG 1505

Query: 449  ---------------DVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEP 493
                           +V K L +   I +   +LS G+ Q + +  SL  +  I L+DE 
Sbjct: 1506 ATRETSNEASSTNSENVNKFLDLSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEA 1565

Query: 494  SAYLDSEQRIICSKVIRR 511
            +A +D        + IR+
Sbjct: 1566 TASIDYSSDAKIQETIRK 1583

>YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporter
           of the ATP-binding cassette (ABC) superfamily, mediates
           transport of glutathione conjugates into the vacuole
           [4680 bp, 1559 aa]
          Length = 1559

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 79/168 (47%), Gaps = 20/168 (11%)

Query: 379 ILVMMGENGTGKTTLIKLLAGAIPADDGQD---IPKLNVSMKPQKIAPK----FTGTVRQ 431
           ++ ++G  G GK+T +K + G +P   G      PKL +         +       +VR+
Sbjct: 667 LVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQESWIMNASVRE 726

Query: 432 --LFFKRIRAQFLNPQFQTDVVKP-LKI-----DDIIDQEVQHLSGGELQRVAIVLSLGM 483
             LF  +    + +   +   + P LKI     + ++ ++   LSGG+  R+++  ++  
Sbjct: 727 NILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYS 786

Query: 484 NADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMAT 531
            ADIYL+D+  + +D+E     SK I  ++L   KTA +     I+ T
Sbjct: 787 RADIYLLDDILSAVDAE----VSKNIIEYVLIG-KTALLKNKTIILTT 829

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 456  IDDIIDQEVQ----HLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRR 511
            ++DI+D ++     +LS G+ Q + +  +L   + I ++DE +A +D E   I    IRR
Sbjct: 1441 VNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRR 1500

Query: 512  FILHNKKTAFIVEHDFIMATYLADKVIVFD 541
                  +T   + H  I     +DK+IV D
Sbjct: 1501 --EFKDRTILTIAHR-IDTVLDSDKIIVLD 1527

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDV---KQRLNAALIIRSLLNPTTYVICV 277
           +LSGG+  R ++  +    AD+Y+ D+  S +D    K  +   LI ++ L     +I  
Sbjct: 769 SLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILT 828

Query: 278 EHDLSVLDY 286
            + +S+L +
Sbjct: 829 TNTVSILKH 837

>CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member, start by similarity
          Length = 294

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 71/160 (44%), Gaps = 16/160 (10%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRFE----DPPEWQEIIKYFRGSELQN--YFTKMLE 161
           +VG NG GKST LK+L+GK     G  +    DP     +      + ++N   F    E
Sbjct: 38  VVGANGAGKSTLLKLLSGKHLCLTGNIKVNGLDPFSPLSMTTSIDNTLIENDDGFGNKGE 97

Query: 162 DDIKAIIKPQY--VDNIPRAIKGPVQKVGELL-KLRLEKSKDDAKRYIDILQLKNVLNRE 218
             +   +  ++  +  I R I      V ELL  +  +  K    R IDIL +   +N  
Sbjct: 98  CQVSTYLGTEWCHMSIINRDI-----GVLELLDSIGYQFFKQRGDRLIDILDID--VNWR 150

Query: 219 VSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRL 258
           +  LS G+ +R  + M  ++   V + DE +  LDV  R+
Sbjct: 151 MHRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDVIARM 190

>CAGL0G00242g complement(20428..24861) highly similar to sp|P53049
           Saccharomyces cerevisiae YGR281w YOR1 ATP-binding
           cassette transporter protein, hypothetical start
          Length = 1477

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 82/168 (48%), Gaps = 24/168 (14%)

Query: 346 EADASRAFTYPDMKRTQGDFS---LTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIP 402
           E D  R+ +  +  +T   FS     ++ GEF     +++ G  GTGK++L+  +AG +P
Sbjct: 598 EEDNERSTSNGEGTKTFTKFSNLNFEIKKGEF-----IMITGPIGTGKSSLLNAMAGFMP 652

Query: 403 ADDGQ-DI---------PKL-NVSMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVV 451
              G+ DI         P + N +++   I    +   R+ + + IR   L  Q   D++
Sbjct: 653 QTTGELDINGHMLLCGYPWIQNATVRDNIIFG--SPYDREKYKEVIRVCSL--QADIDIL 708

Query: 452 KPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
               + +I ++ +  LSGG+  R+ +  S+  N DIYL D+  + +DS
Sbjct: 709 PAGDMTEIGERGIT-LSGGQKARINLARSVYKNKDIYLFDDVLSAVDS 755

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD--VKQRLNAALIIRSLLNPTTYVICVE 278
            LSGG+  R  +  S  +  D+Y+FD+  S +D  V + +     +++L + T   I   
Sbjct: 722 TLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTR--ILAT 779

Query: 279 HDLSVLD 285
           H LS+++
Sbjct: 780 HQLSLIE 786

>Scas_693.42
          Length = 1512

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 71/153 (46%), Gaps = 14/153 (9%)

Query: 356 PDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVS 415
           P+ K    + +   + GE +      ++G+ G+GK+ +I+ + G +    G      NV+
Sbjct: 637 PEYKVALKNINFQAKKGELT-----CIVGKVGSGKSAMIQSILGDLFRVKGFATIHGNVA 691

Query: 416 MKPQKIAPKFTGTVRQ--LFFKRIRAQFLNPQFQT-----DVVKPLKIDD-IIDQEVQHL 467
              Q +A    GTV++  LF  +    F     +      D+   +  D  ++ ++   L
Sbjct: 692 YVSQ-VAWIMNGTVKENILFGHKYDEDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISL 750

Query: 468 SGGELQRVAIVLSLGMNADIYLIDEPSAYLDSE 500
           SGG+  R+++  ++   AD YL+D+P A +D  
Sbjct: 751 SGGQKARLSLARAVYSRADTYLLDDPLAAVDEH 783

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD 253
           +LSGG+  R ++  +    AD Y+ D+P + +D
Sbjct: 749 SLSGGQKARLSLARAVYSRADTYLLDDPLAAVD 781

>KLLA0F20075g complement(1868786..1873336) similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 glutathione
           S-conjugate transporter, vacuolar, start by similarity
          Length = 1516

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 120/277 (43%), Gaps = 43/277 (15%)

Query: 337 RMADAGDELEADASRAFTY---PDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTL 393
           ++ + GDE        F +   P+ K    + +   + GE +      ++G+ G+GK+ L
Sbjct: 615 KVKNIGDEGVKVNDATFLWQRKPEYKVALKNINFVAKKGELT-----CIVGKVGSGKSAL 669

Query: 394 IKLLAGAIPADDG-----QDIPKLNVSMKPQKIAPKFTGTVRQ--LFFKRIRAQFLNPQF 446
           I+ L G +    G      D+   NVS  P  +     GTV+   LF  +      +P+F
Sbjct: 670 IQSLLGDLIRVKGFATVHGDVA--NVSQVPWIM----NGTVKDNILFGHK-----YDPEF 718

Query: 447 QTDVVKP--LKID---------DIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSA 495
               +K   L ID          ++ ++   LSGG+  R+++  ++   AD YL+D+P A
Sbjct: 719 YQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLA 778

Query: 496 YLDSE--QRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDG--IPSKQAFAR 551
            +D    + +I   +    +LH+K    ++  + I    +AD + + +   I  + ++ +
Sbjct: 779 AVDEHVAKHLIEHVLGPHGLLHSKTK--VLATNKITVLSIADSITLMENGEIIQQGSYDQ 836

Query: 552 APESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQ 588
             ES  +  +K +       +  P+     + KL S+
Sbjct: 837 VNESTNSPLSKLIAEFGKKGKPTPSQSTTSLAKLASE 873

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD---VKQRLNAALIIRSLLNPTTYVIC 276
           +LSGG+  R ++  +    AD Y+ D+P + +D    K  +   L    LL+  T V+ 
Sbjct: 749 SLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLA 807

>Scas_714.42
          Length = 1520

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 76/173 (43%), Gaps = 31/173 (17%)

Query: 372  GEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPAD---DG----QDIPKLNVSMKPQ 419
            G      +  +MG +G GKTTL+  LA     G I  D   +G    Q  P+     + Q
Sbjct: 894  GWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVLVNGRPRDQSFPRSIGYCQQQ 953

Query: 420  KIAPKFTGTVRQLFFKRIRAQFLNP---------QFQTDVVKPLKIDDIIDQEVQHLSGG 470
             +  K T TVR+    R  A    P         Q+  DV+K L+++   D  V  ++G 
Sbjct: 954  DLHLK-TSTVRESL--RFSAYLRQPADVSIEEKNQYVEDVIKILEMEAYADA-VVGVAGE 1009

Query: 471  EL---QRVAIVLSLGMNAD---IYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
             L   QR  + + + + A    +  +DEP++ LDS+      +++++   H +
Sbjct: 1010 GLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLADHGQ 1062

>KLLA0E00462g complement(39173..44125) similar to sp|P32386
           Saccharomyces cerevisiae YLL048c YBT1 yeast bile
           transporter, start by similarity
          Length = 1650

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 92/215 (42%), Gaps = 32/215 (14%)

Query: 353 FTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQD-IPK 411
           FT+    +   DF L     +F   ++ V++G  G+GKT+L+  L G +   +G+  +P 
Sbjct: 706 FTW---DKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELLNGKVFVPS 762

Query: 412 LNVSMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVV-------------------- 451
           LN     +++  +  G    + +    A  LN   + +++                    
Sbjct: 763 LN---PREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNAPYNENRYNAVISACGLK 819

Query: 452 KPLKIDDIIDQ-EVQH----LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICS 506
           +  +I    DQ E+      LSGG+ QRV++  SL  ++   L+D+  + +DS   +   
Sbjct: 820 RDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDSHTALWIY 879

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFD 541
           +      L   +T  +V H+  +    AD VI+ +
Sbjct: 880 ENCITGPLMEGRTCVLVSHNVALTLKNADWVIIME 914

>Kwal_56.23844
          Length = 1494

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 73/151 (48%), Gaps = 14/151 (9%)

Query: 356 PDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVS 415
           P+ K    + +   + GE +      ++G+ G+GK+ LI+ + G +    G      +++
Sbjct: 625 PEYKVALKNINFQAKKGELT-----CIVGKVGSGKSALIQGILGDLFRVKGFASVHGSIA 679

Query: 416 MKPQKIAPKFTGTVRQ--LFFKRIRAQFLNPQFQT-----DV-VKPLKIDDIIDQEVQHL 467
              Q +     GTV++  LF  +  A F +   +      D+ + P   + ++ ++   L
Sbjct: 680 YVSQ-VPWIMNGTVKENILFGHKYDADFYDTTLRACALAVDLSILPKGDETLVGEKGISL 738

Query: 468 SGGELQRVAIVLSLGMNADIYLIDEPSAYLD 498
           SGG+  R+++  ++   AD YL+D+P A +D
Sbjct: 739 SGGQKARISLARAVYARADTYLLDDPLAAVD 769

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 221 ALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD---VKQRLNAALIIRSLLNPTTYVICV 277
           +LSGG+  R ++  +    AD Y+ D+P + +D    K  +   L  + LL+    V+  
Sbjct: 737 SLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSSKVKVLAT 796

Query: 278 E--HDLSVLDYLS 288
                LS+ D++S
Sbjct: 797 NKISVLSIADHIS 809

>AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH]
           (1697345..1699378) [2034 bp, 677 aa]
          Length = 677

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 83/201 (41%), Gaps = 23/201 (11%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQ-----EIIKYFRGSELQNYF 156
           PG+ + +VG +G GKST   +L         RF DP         E I+ F  S+ +   
Sbjct: 455 PGEHVCIVGPSGGGKSTVASLLL--------RFYDPISGSITIGGEDIRLFNLSKYRRMM 506

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLK----LRLEKSKDDAKRYIDILQLK 212
             + ++ +  +     ++NI  A+  P+    +  +    LRL         + + LQ  
Sbjct: 507 GIVQQEPV--LFNASILENITYAL--PLHLTKDPARIDRALRLSNCSAFVGSFPEGLQ-- 560

Query: 213 NVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTT 272
             +    + LSGG+ QR A+  + +Q+  + + DE +S LD K     A  +        
Sbjct: 561 TAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAK 620

Query: 273 YVICVEHDLSVLDYLSDFVCI 293
             I + H  S + + +  + +
Sbjct: 621 ITISIAHRKSTIQHSTRVIVL 641

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 20/85 (23%)

Query: 466 HLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQR-IICSKVIRR--------FILHN 516
            LSGG+ QRVA+  +   +  I ++DE ++ LDS+   I+ S +++R         I H 
Sbjct: 569 QLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKITISIAHR 628

Query: 517 KKTAFIVEHDFIMATYLADKVIVFD 541
           K T   ++H        + +VIV D
Sbjct: 629 KST---IQH--------STRVIVLD 642

>YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidrug
           resistance protein of the ATP-binding cassette (ABC)
           family, has similarity to Snq2p, Pdr5p and Candida
           albicans Cdr1p [4002 bp, 1333 aa]
          Length = 1333

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 73/164 (44%), Gaps = 34/164 (20%)

Query: 379 ILVMMGENGTGKTTLIKLLA----GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQ--- 431
           +  ++GE+G GKTTL+  LA    G I  D   D   ++ S K +      TG V+Q   
Sbjct: 760 LTALIGESGAGKTTLLNTLAQRNVGTITGDMLVDGLPMDASFKRR------TGYVQQQDL 813

Query: 432 ----LFFK---RIRAQFLNPQFQTDVVKPLKIDDIID----QEVQHLSGGEL-------- 472
               L  K   +  A+   PQ   D  K   ++ II     QE      GE+        
Sbjct: 814 HVAELTVKESLQFSARMRRPQSIPDAEKMEYVEKIISILEMQEFSEALVGEIGYGLNVEQ 873

Query: 473 -QRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRRFIL 514
            ++++I + L    D+ L +DEP++ LDS+      K+++R  L
Sbjct: 874 RKKLSIGVELVGKPDLLLFLDEPTSGLDSQSAWAVVKMLKRLAL 917

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIR 510
           +  +SGGE +RV+I  +L     IY  D  +  LDS   +  ++ IR
Sbjct: 177 ISGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDSSTALEFARAIR 223

>CAGL0M02387g 280372..282942 similar to sp|P41909 Saccharomyces
           cerevisiae YPL147w PXA1 Peroxisomal long-chain fatty
           acid import protein 2, hypothetical start
          Length = 856

 Score = 36.6 bits (83), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 79/177 (44%), Gaps = 29/177 (16%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDGQDIPKL----NVSMKPQKIAPKFT--GTVR-QL 432
           L+++G N  GKT++ +++A   P  + + +  +    N+   PQK  P FT  GT+R QL
Sbjct: 627 LLILGPNSCGKTSIQRIIAEIWPIYNKKGLMSIPAQENLICIPQK--PYFTRGGTLRDQL 684

Query: 433 FFKRIRAQFLNPQFQ----TDVVKPLKID------------DIIDQEVQHLSGGELQRVA 476
            +     +F +  F+      ++  +K+D            D +      LSGGE QRV 
Sbjct: 685 IYPMSSDEFFDRGFKDKYLVQIMSEVKLDYLLKRGTGLSYLDTVADWKDVLSGGEKQRVN 744

Query: 477 IVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRR----FILHNKKTAFIVEHDFIM 529
               +       ++DE +  + ++       +++R    FI  +++   I  HD ++
Sbjct: 745 FARIMFHRPLFVVLDEATNAISADMEDYLFNLLKRYRFNFITISQRPTLIKYHDLLL 801

>Scas_552.4
          Length = 720

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 91/221 (41%), Gaps = 41/221 (18%)

Query: 382 MMGENGTGKTTLIKLL-------AGAIPADDGQDIPKLNVS--MKPQKIAPK----FTGT 428
           ++G  G GK+T+I  L        G I  D+  DI  +N++   +   I P+    FTGT
Sbjct: 483 IVGRTGAGKSTIITALFRFLDPETGYIKIDN-IDITSINLNKLRRSINIIPQDPTLFTGT 541

Query: 429 VR-----------QLFFKRIRAQFLNPQ-----------FQTDVVKPLKIDDIIDQEVQH 466
           ++           +  F  +R   L P+              +V K L +++ I +   +
Sbjct: 542 IKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLNLNNEISEGGSN 601

Query: 467 LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LS G+ Q V +  SL  +  I L+DE +A +D        + IR+    N  T   + H 
Sbjct: 602 LSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIAHR 659

Query: 527 FIMATYLADKVIVFDGIPSKQAFARAPESLLTGCNKFLKNL 567
            + +    DK++V D    K+     P SLL        N+
Sbjct: 660 -LRSVIDYDKILVMDAGEVKE--YDHPYSLLLNKKSIFYNM 697

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 78/194 (40%), Gaps = 7/194 (3%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFE-DPPEWQEII--KYFRGSELQNY 155
           T  P   +G+VG  G GKST +  L     P  G  + D  +   I   K  R   +   
Sbjct: 474 TVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQ 533

Query: 156 FTKMLEDDIKAIIKP--QYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKN 213
              +    IK+ + P  +Y D         V  V E +   +E     ++     L L N
Sbjct: 534 DPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLNLNN 593

Query: 214 VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTY 273
            ++   S LS G+ Q   +  S ++   + + DE ++ +D          IR   N +T 
Sbjct: 594 EISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRKEFNSST- 652

Query: 274 VICVEHDL-SVLDY 286
           ++ + H L SV+DY
Sbjct: 653 ILTIAHRLRSVIDY 666

>CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 801

 Score = 36.2 bits (82), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 109/258 (42%), Gaps = 46/258 (17%)

Query: 275 ICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGIN----IF-LDGHIPSENLRF 329
           + +++ L++ D  +  +   Y   S++G+ T  S + +G      +F L   +PS +   
Sbjct: 399 LVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSIS--- 455

Query: 330 RTEALQFRMADAGDELEADASRAFTYPDMKRTQ--GDFSLTVEAGEFSDSQILVMMGENG 387
            T+ ++++  +   E +   + +F YP         + +  +EAG       + ++G +G
Sbjct: 456 TTKGVKYKPGNGEIEFK---NVSFAYPTRPSNMIFKNLNFKIEAGSN-----VCIVGPSG 507

Query: 388 TGKTTLIKLL-------AGAIPADDGQDIPKLNVSMKPQKIAPK------FTGTVRQLF- 433
            GK+T+  LL       +G I  D GQ+I  LN     + I          +GT+R    
Sbjct: 508 RGKSTVALLLEKYYKPSSGEILID-GQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIV 566

Query: 434 -----------FKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLG 482
                       +++  Q     F T        D +I      LSGG+ QR+AI  +L 
Sbjct: 567 YGLTEMPTKDEIRQVAKQCFCHNFITRFQS--SYDTVIGPHGTLLSGGQKQRIAIARALI 624

Query: 483 MNADIYLIDEPSAYLDSE 500
               I ++DE ++ LD E
Sbjct: 625 KKPRILILDEATSALDVE 642

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
           LSGG+ QR AI  + +++  + + DE +S LDV+
Sbjct: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVE 642

>Kwal_27.9666
          Length = 1474

 Score = 36.2 bits (82), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 82/194 (42%), Gaps = 26/194 (13%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFEDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    +        G   D   +   I Y +  +L
Sbjct: 854  KPGTLTALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNKRD-ASFARSIGYCQQQDL 912

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLK-LRLEKSKDDAKRYIDILQL 211
             +  T  + + ++     +   ++P + K   + V E++K L +EK  D           
Sbjct: 913  -HLQTATVRESLRFAAHLRQPQSVPSSEKD--KYVDEVIKILEMEKYADA---------- 959

Query: 212  KNVLNREVSALSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLLNP 270
              V+      L+  + +R  IG+       + +F DEP+S LD +   +   ++R L N 
Sbjct: 960  --VVGVAGEGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANH 1017

Query: 271  TTYVICVEHDLSVL 284
               ++C  H  S L
Sbjct: 1018 GQAILCTIHQPSAL 1031

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 73/171 (42%), Gaps = 27/171 (15%)

Query: 372  GEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPADDGQDIPKLNVSMK------PQK 420
            G      +  +MG +G GKTTL+  LA     G +  D   +  K + S         Q+
Sbjct: 851  GWVKPGTLTALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNKRDASFARSIGYCQQQ 910

Query: 421  IAPKFTGTVRQLFFKRIRAQFLNPQ---------FQTDVVKPLKIDDIIDQEV----QHL 467
                 T TVR+    R  A    PQ         +  +V+K L+++   D  V    + L
Sbjct: 911  DLHLQTATVRESL--RFAAHLRQPQSVPSSEKDKYVDEVIKILEMEKYADAVVGVAGEGL 968

Query: 468  SGGELQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRRFILHNK 517
            +  + +R+ I + L     + L +DEP++ LDS+      +++R+   H +
Sbjct: 969  NVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANHGQ 1019

>CAGL0G05093g complement(483230..484864) similar to sp|Q12298
           Saccharomyces cerevisiae YDR061w, hypothetical start
          Length = 544

 Score = 35.8 bits (81), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%)

Query: 450 VVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVI 509
           +V+ LK++++ ++    LS G+++R  +  SL    D+ L+D+P   LD     I SK +
Sbjct: 142 LVRELKLEELQNRWAMGLSNGQMRRARLARSLLKQPDLILVDDPFLGLDPTATAIISKFL 201

Query: 510 RRFILHNKKTAF 521
             +    K+ ++
Sbjct: 202 SNWGGAGKENSY 213

>KLLA0D04059g complement(338422..343128) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, start by
           similarity
          Length = 1568

 Score = 36.2 bits (82), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 75/161 (46%), Gaps = 25/161 (15%)

Query: 368 TVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIP---ADDGQDI-PKL-----NVSMKP 418
           ++E      +Q+  ++G  G+GK+T ++ + G +P   +D    + PK+     N++  P
Sbjct: 644 SIENFSAKKAQLTCIVGRVGSGKSTFLQAILGQLPCVSSDSASGVKPKVVIRADNLAYCP 703

Query: 419 QKIAPKFTGTVRQLFF----------KRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLS 468
           Q+           + F          K I+A  L P  +   + P     ++ ++   LS
Sbjct: 704 QQPWIMNASLKDNILFGYKYDEAMYKKTIKACQLLPDLE---ILPDGDQTLVGEKGISLS 760

Query: 469 GGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVI 509
           GG+  R+++  ++   AD+YL+D+  + +DS    +C  +I
Sbjct: 761 GGQKARLSLARAVYSRADLYLLDDVLSAVDSH---VCKSII 798

>Scas_643.1
          Length = 1289

 Score = 36.2 bits (82), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 85/209 (40%), Gaps = 42/209 (20%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
            L+G +G GK+T L +LA + +  +   E                       +L D    
Sbjct: 773 ALMGESGAGKTTLLNVLAQRIESGVVTGE-----------------------LLIDG--- 806

Query: 167 IIKPQYVDNIPRAIKGPVQK---------VGELLKLRLEKSKDDAKRYIDILQ--LKNVL 215
             KP   +N  R   G VQ+         V E L++      D   +Y++ +   LK  +
Sbjct: 807 --KPLTNENAFRRSIGFVQQQDLHLDLLTVKESLEISCRLRGDGDMKYLETISSLLKLPM 864

Query: 216 NREVSALSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLLNPTTYV 274
           N+ V+ LS  + +  +IG+  V +  + +F DEP+S LD +  L     ++ L      +
Sbjct: 865 NKLVAKLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLDSEAALTIVKFLKKLSQQGQAI 924

Query: 275 ICVEH--DLSVLDYLSDFVCIIYGVPSVY 301
            C  H    SV+ Y  +   +  G  SV+
Sbjct: 925 FCTIHQPSKSVISYFDNIFLLKRGGESVF 953

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 80/176 (45%), Gaps = 23/176 (13%)

Query: 354 TYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLN 413
           ++ ++  T GD  L      F  S +  +MGE+G GKTTL+ +LA  I  + G    +L 
Sbjct: 746 SWKNINYTIGDKKLINNVSGFIGSGLTALMGESGAGKTTLLNVLAQRI--ESGVVTGELL 803

Query: 414 VSMKPQKIAPKF---TGTVRQLFFKRIRAQFLNPQFQTDVVKPLKID-DI---------- 459
           +  KP      F    G V+Q   + +    L  +   ++   L+ D D+          
Sbjct: 804 IDGKPLTNENAFRRSIGFVQQ---QDLHLDLLTVKESLEISCRLRGDGDMKYLETISSLL 860

Query: 460 ---IDQEVQHLSGGELQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRR 511
              +++ V  LS  + + ++I + L     + L +DEP++ LDSE  +   K +++
Sbjct: 861 KLPMNKLVAKLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLDSEAALTIVKFLKK 916

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 456 IDDIIDQE-VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRR 511
           +D ++  + V+ +SGGE +R++I+ +   N  +YL D  +  LDS   +    ++++
Sbjct: 171 MDTVVGNDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLSILKK 227

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%)

Query: 216 NREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVI 275
           N  V  +SGGE +R +I  + +    VY++D  +  LD    L+   I++ +   T  V 
Sbjct: 177 NDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLSILKKMTEATKSVN 236

Query: 276 CVE 278
            V+
Sbjct: 237 LVK 239

>Scas_627.18
          Length = 533

 Score = 35.8 bits (81), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%)

Query: 442 LNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQ 501
           +N +    ++K LK+ ++ D+    LS G+++R  +  +L    D+ L+D+P   LD   
Sbjct: 132 VNMELYNKLIKSLKLVELQDRYAMGLSNGQMRRARLTHTLLKEPDLLLVDDPFLGLDPTA 191

Query: 502 RIICSKVIRRF 512
             I SK +  +
Sbjct: 192 TSIISKFLATY 202

>YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of the
            ATP-binding cassette (ABC) superfamily [4779 bp, 1592 aa]
          Length = 1592

 Score = 36.2 bits (82), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 83/197 (42%), Gaps = 40/197 (20%)

Query: 382  MMGENGTGKTTLIKLL-------AGAIPADDGQDIPKLNVSM--KPQKIAPK----FTGT 428
            ++G  G GK+T+I  L        G I  D GQDI K+++    +   I P+    F GT
Sbjct: 1355 IVGRTGAGKSTIITALFRLLEPITGCIKID-GQDISKIDLVTLRRSITIIPQDPILFAGT 1413

Query: 429  VR-----------QLFFKRIR----------AQFLNPQ--FQTDVVKPLKIDDIIDQEVQ 465
            ++           +  FK +            + LN +  F +   K L +   I +   
Sbjct: 1414 IKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGL 1473

Query: 466  HLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
            +LS GE Q + I  SL     I L+DE ++ +D +   +   +IR     NK T   + H
Sbjct: 1474 NLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRS--EFNKSTILTIAH 1531

Query: 526  DFIMATYLADKVIVFDG 542
              + +    D++IV D 
Sbjct: 1532 R-LRSVIDYDRIIVMDA 1547

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 87/196 (44%), Gaps = 16/196 (8%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLE 161
            P   +G+VG  G GKST +  L    +P  G  +   + Q+I K      L+   T + +
Sbjct: 1349 PQSKIGIVGRTGAGKSTIITALFRLLEPITGCIK--IDGQDISK-IDLVTLRRSITIIPQ 1405

Query: 162  D------DIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVL 215
            D       IK+ + P Y +   + I   + +V  +     E+  +  +R+         L
Sbjct: 1406 DPILFAGTIKSNVDP-YDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNL 1464

Query: 216  NREVSA----LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPT 271
            + E++     LS GE Q   I  S ++E  + + DE +S +D         IIRS  N +
Sbjct: 1465 HTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKS 1524

Query: 272  TYVICVEHDL-SVLDY 286
            T ++ + H L SV+DY
Sbjct: 1525 T-ILTIAHRLRSVIDY 1539

>KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 pleiotropic drug resistance
            protein, start by similarity
          Length = 1560

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 83/195 (42%), Gaps = 28/195 (14%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFEDPPEWQEIIKYFRGSEL 152
            +PG +  L+G++G GK+T L  LA +    +        GR  D   +Q    Y +  +L
Sbjct: 921  KPGTLTALMGSSGAGKTTLLDALADRISTGVITGDVLVNGRPTDA-SFQRSTGYCQQQDL 979

Query: 153  QNYFTKMLED-DIKAIIKPQYVDNIPRAIKGP-VQKVGELLKLRLEKSKDDAKRYIDILQ 210
                  + E     A ++  Y  N+ +  K   V+ +  LL++         + Y D L 
Sbjct: 980  HGRTQTVREALTFSAYLRQPY--NVSKKEKDEYVETIIRLLEM---------ETYADAL- 1027

Query: 211  LKNVLNREVSALSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLLN 269
                +      L+  + +R  IG+  V +  + +F DEP+S LD +   +   ++R L N
Sbjct: 1028 ----VGVTGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLAN 1083

Query: 270  PTTYVICVEHDLSVL 284
                ++C  H  S +
Sbjct: 1084 HGQAILCTIHQPSAI 1098

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 ATP-binding cassette transporter
           family member, hypothetical start
          Length = 706

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 91/204 (44%), Gaps = 23/204 (11%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKIL-----AGKQKPNLGRFEDPPEWQEIIKYFRGSELQ 153
           T RPG+ + +VG +G GKST   +L      G  +  LG         + I+ F   + +
Sbjct: 452 TVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLG--------NDNIRDFNLRKYR 503

Query: 154 NYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDIL--QL 211
                + ++ +  +     +DNI  A+  P + V +  ++     + +  +++      L
Sbjct: 504 RLLGVVQQEPM--LFSGTILDNITYAV--PQELVNDETRISRAIGQANCTKFLANFPDGL 559

Query: 212 KNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR--LNAALIIRSLLN 269
           +  +    + LSGG+ QR A+  + + +  + + DE +S LD +    +  +L  RS   
Sbjct: 560 QTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARG 619

Query: 270 PTTYVICVEHDLSVLDYLSDFVCI 293
            TT  I + H +S + + S  + +
Sbjct: 620 KTT--ISIAHRVSTIQHSSRVIVL 641

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 466 HLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
            LSGG+ QR+A+  +  ++  I ++DE ++ LDS+   + ++ +++     K T  I   
Sbjct: 569 QLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARGKTTISIAHR 628

Query: 526 DFIMATYLADKVIVFD 541
             +     + +VIV +
Sbjct: 629 --VSTIQHSSRVIVLN 642

>YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane
           transporter of the ATP-binding cassette (ABC)
           superfamily, plays a role in sterol uptake and anaerobic
           growth [4236 bp, 1411 aa]
          Length = 1411

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 354 TYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-----AGAIPAD---D 405
           ++ ++  T GD  L  +A  +  S +  +MGE+G GKTTL+ +L     +G +  +   D
Sbjct: 752 SWKNINYTIGDKKLINDASGYISSGLTALMGESGAGKTTLLNVLSQRTESGVVTGELLID 811

Query: 406 GQDIPKLN 413
           GQ +  ++
Sbjct: 812 GQPLTNID 819

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
           V+ +SGGE +R++I+ +   N  +YL D  +  LDS
Sbjct: 169 VRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDS 204

>CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 or sp|Q04182 Saccharomyces
            cerevisiae YDR406w PDR15 or sp|P51533 Saccharomyces
            cerevisiae YOR328w, hypothetical start
          Length = 1499

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 72/171 (42%), Gaps = 27/171 (15%)

Query: 372  GEFSDSQILVMMGENGTGKTTLIKLLA---------GAIPADDGQ--DIPKLNVSMKPQK 420
            G      +  +MG +G GKTTL+  LA         G +  D  Q  D    ++    Q+
Sbjct: 881  GWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQRDDSFARSIGYCQQQ 940

Query: 421  IAPKFTGTVRQLFFKRIRAQFLNP---------QFQTDVVKPLKIDDIIDQEV----QHL 467
                 T TVR+    R  A    P         Q+  DV+K L+++   D  V    + L
Sbjct: 941  DLHLKTSTVRESL--RFSAYLRQPADVSIEEKNQYVEDVIKILEMEQYADAVVGVPGEGL 998

Query: 468  SGGELQRVAIVLSLGMNADIY-LIDEPSAYLDSEQRIICSKVIRRFILHNK 517
            +  + +R+ I + L     +   +DEP++ LDS+      +++++   H +
Sbjct: 999  NVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQ 1049

>Scas_567.1
          Length = 810

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 78/181 (43%), Gaps = 25/181 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFE-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G F  D  +  E++  ++G      EL 
Sbjct: 180 GEMLFVVGRPGAGCSTLLKTISGETSDMVEVQGDFSYDGLDQAEMMSKYKGYVVYCPELD 239

Query: 154 NYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLKN 213
            +F K+    +K  I      +     K P  ++  + +     S  D   +  +  L++
Sbjct: 240 FHFPKI---TVKETI------DFALKCKTPRTRIDNMSRAEYVDSLRDM--WCTVFGLRH 288

Query: 214 -----VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
                V N  V  +SGGE +R ++  +    A +Y +D  +  LD    L  A  IR+  
Sbjct: 289 TYATKVGNDFVRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIRTAT 348

Query: 269 N 269
           N
Sbjct: 349 N 349

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV++V +  M A IY  D  +  LD+   +  ++ IR
Sbjct: 299 VRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIR 345

>Sklu_1870.3 YFL028C, Contig c1870 3336-4133
          Length = 265

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 70/158 (44%), Gaps = 28/158 (17%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRF----EDPPEWQEIIKYFRGSELQNYFTKMLED- 162
           +VG+NG GKST LK+L+GK     GR      DP         F  + +Q    K  ED 
Sbjct: 37  VVGSNGAGKSTLLKLLSGKHLCLNGRILVNGLDP---------FSPTSMQ----KDAEDC 83

Query: 163 DIKAIIKPQY--VDNIPRAIKGPVQKVGELLK-LRLEKSKDDAKRYIDILQLKNVLNREV 219
            I   +  ++  +  I R I      + ELL  +  E  ++  +  I IL +   L   +
Sbjct: 84  QITTYLGTEWCHMSIINRDI-----GILELLNSIGFEHYRERGEELISILDID--LEWRM 136

Query: 220 SALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
             LS G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 137 HRLSDGQKRRVQLTMGLLKPWKVLLLDEVTVDLDVVAR 174

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 72/187 (38%), Gaps = 33/187 (17%)

Query: 381 VMMGENGTGKTTLIKLLAGAI----------------------PADDGQDIPKLNVSMKP 418
           +++G NG GK+TL+KLL+G                         A+D Q    L      
Sbjct: 36  LVVGSNGAGKSTLLKLLSGKHLCLNGRILVNGLDPFSPTSMQKDAEDCQITTYLGTEWCH 95

Query: 419 QKIAPKFTGTVRQL---FFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRV 475
             I  +  G +  L    F+  R +        +++  L ID  ++  +  LS G+ +RV
Sbjct: 96  MSIINRDIGILELLNSIGFEHYRER------GEELISILDID--LEWRMHRLSDGQKRRV 147

Query: 476 AIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLAD 535
            + + L     + L+DE +  LD   R      + +     + +     H F   ++  D
Sbjct: 148 QLTMGLLKPWKVLLLDEVTVDLDVVARSKLLDFLEKETRTRRCSVVYATHIFDGLSHWPD 207

Query: 536 KVIVFDG 542
           +VI   G
Sbjct: 208 RVIHIKG 214

>YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resistance
           factor, member of the ATP-binding cassette (ABC)
           superfamily [4434 bp, 1477 aa]
          Length = 1477

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 30/171 (17%)

Query: 340 DAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAG 399
           D  ++LE  + R F          D +  ++ GEF     +++ G  GTGK++L+  +AG
Sbjct: 591 DGPEDLEKTSFRGFK---------DLNFDIKKGEF-----IMITGPIGTGKSSLLNAMAG 636

Query: 400 AIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVK--PLKID 457
           ++   DG+   ++N  +           +VR      I     N +   +VV+   LK D
Sbjct: 637 SMRKTDGK--VEVNGDLLMCGYPWIQNASVRD---NIIFGSPFNKEKYDEVVRVCSLKAD 691

Query: 458 -DI--------IDQEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
            DI        I +    LSGG+  R+ +  S+    DIYL D+  + +DS
Sbjct: 692 LDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDS 742

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 83/198 (41%), Gaps = 33/198 (16%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKML 160
           + G+ + + G  G GKS+ L  +AG  +   G+ E             G  L   +  + 
Sbjct: 612 KKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVE-----------VNGDLLMCGYPWIQ 660

Query: 161 EDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDIL---QLKNVLNR 217
              ++        DNI        +K  E++++   K+       +DIL    +  +  R
Sbjct: 661 NASVR--------DNIIFGSPFNKEKYDEVVRVCSLKAD------LDILPAGDMTEIGER 706

Query: 218 EVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLD--VKQRLNAALIIRSLLNPTTYVI 275
            ++ LSGG+  R  +  S  ++ D+Y+FD+  S +D  V + +    +   L N T   I
Sbjct: 707 GIT-LSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTR--I 763

Query: 276 CVEHDLSVLDYLSDFVCI 293
              H LS+++  S  + +
Sbjct: 764 LATHQLSLIERASRVIVL 781

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 90/206 (43%), Gaps = 32/206 (15%)

Query: 101  RPGQVLGLVGTNGIGKSTALKIL-------AGK------QKPNLGRFEDPPEWQEIIK-- 145
            + G+ +G+ G  G GKST +  L       AGK          LG F+   +   I +  
Sbjct: 1238 KSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDP 1297

Query: 146  -YFRGSELQNY--FTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDA 202
              FRG+  +N   F +  +D++         D + R   G + K  +L +++L+K  ++ 
Sbjct: 1298 VLFRGTIRKNLDPFNERTDDEL--------WDALVRG--GAIAK-DDLPEVKLQKPDENG 1346

Query: 203  KR-YIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAA 261
                +    L   +  E S  S GE Q  A+  + V+++ + + DE +S +D +      
Sbjct: 1347 THGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQ 1406

Query: 262  LIIRSLLNPTTYVICVEHDL-SVLDY 286
              I       T ++C+ H L ++++Y
Sbjct: 1407 TRIVEEFGDCT-ILCIAHRLKTIVNY 1431

>KLLA0F21692g complement(2014152..2018729)
            gi|14571818|gb|AAK67294.1|AF245358_1 Kluyveromyces lactis
            multidrug pump KlPDR5, start by similarity
          Length = 1525

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 96/233 (41%), Gaps = 37/233 (15%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFEDPPEWQEIIKYFRGSEL 152
            +PG +  L+G++G GK+T L  LA +    +        G   D   +   I Y +  +L
Sbjct: 887  KPGTLTALMGSSGAGKTTLLDCLASRVTMGVITGDMFVNGHLRDN-SFPRSIGYCQQQDL 945

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLK 212
                  +    ++  ++       P ++              +E+  +  +  I+IL+++
Sbjct: 946  H-----LSTSTVRESLRFSAYLRQPSSVS-------------IEEKNNYVEDVINILEMQ 987

Query: 213  NVLNREVSALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSL 267
               +  V     G    + +R  IG+    +  + +F DEP+S LD +   +   ++R L
Sbjct: 988  QYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKL 1047

Query: 268  LNPTTYVICVEHDLSVLDYLSDFVCIIY---GVPSVYGVVTLPSSVREGINIF 317
             +    ++C  H  S L  + +F  +++   G  +VY    L    +E IN F
Sbjct: 1048 ADHGQAILCTIHQPSAL-LMQEFDILLFLQKGGKTVY-FGNLGEGCQEMINYF 1098

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 73/165 (44%), Gaps = 29/165 (17%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GAIPAD---DGQ----DIPK---------LNVSMK 417
            +  +MG +G GKTTL+  LA     G I  D   +G       P+         L++S  
Sbjct: 891  LTALMGSSGAGKTTLLDCLASRVTMGVITGDMFVNGHLRDNSFPRSIGYCQQQDLHLSTS 950

Query: 418  PQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEV----QHLSGGELQ 473
              + + +F+  +RQ     I  +     +  DV+  L++    D  V    + L+  + +
Sbjct: 951  TVRESLRFSAYLRQPSSVSIEEK---NNYVEDVINILEMQQYADAVVGVAGEGLNVEQRK 1007

Query: 474  RVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRRFILHNK 517
            R+ I + L     + L +DEP++ LDS+      +++R+   H +
Sbjct: 1008 RLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQ 1052

>CAGL0L06644g 748310..750796 some similarities with sp|P38850
           Saccharomyces cerevisiae YHR154w, hypothetical start
          Length = 828

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 61/133 (45%), Gaps = 17/133 (12%)

Query: 245 FDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSVYGVV 304
           FD+P     + + ++  +I++ +LNPT  ++  +  L     +S    I Y  P  Y  +
Sbjct: 169 FDDP-----LVKEMDDNVILKEVLNPTMKIVSYQWLLDCFKTVSWANEIKYSSPGPYMSI 223

Query: 305 TLPSS-----VREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMK 359
           T  +S     V + I+I L   IP +  +F +E   F  ++ G  + A+   ++   D +
Sbjct: 224 TCNNSNPLSPVFQNISIHLSDSIPGDIRQFLSE---FVRSNGGSTVTAEDKESYRIIDYQ 280

Query: 360 RT----QGDFSLT 368
            T    Q  F++T
Sbjct: 281 DTPTDDQNSFTIT 293

>YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-binding
            cassette (ABC) superfamily [4590 bp, 1529 aa]
          Length = 1529

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 75/172 (43%), Gaps = 29/172 (16%)

Query: 372  GEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPAD---DG----QDIPKLNVSMKPQ 419
            G      +  +MG +G GKTTL+  LA     G I  +   DG    +  P+     + Q
Sbjct: 908  GWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGRLRDESFPRSIGYCQQQ 967

Query: 420  KIAPKFTGTVRQLFFKRIRAQFLNP---------QFQTDVVKPLKI----DDIIDQEVQH 466
             +  K T TVR+    R  A    P         ++  +V+K L++    D ++    + 
Sbjct: 968  DLHLK-TATVRESL--RFSAYLRQPSSVSIEEKNRYVEEVIKILEMQQYSDAVVGVAGEG 1024

Query: 467  LSGGELQRVAIVLSLGMNADIY-LIDEPSAYLDSEQRIICSKVIRRFILHNK 517
            L+  + +R+ I + L     +   +DEP++ LDS+      +++R+   H +
Sbjct: 1025 LNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKLATHGQ 1076

>KLLA0E19074g complement(1691643..1692623) highly similar to
           sp|P52920 Saccharomyces cerevisiae YGL091c NBP35
           nucleotide-binding protein, start by similarity
          Length = 326

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 3/118 (2%)

Query: 339 ADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLA 398
           A  GD  +  A++       K    D  L  E       +IL++ G+ G GK+T   +L+
Sbjct: 33  AGKGDSCQGCANKEVCESLPKGPDPDLPLIKENLANIKHKILILSGKGGVGKSTFTTMLS 92

Query: 399 GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKI 456
            A+ AD+   +  +++ +    + P   G VR+   +        P + TD +  + I
Sbjct: 93  WALSADEDLQVGAMDLDICGPSL-PHMLGCVRETIHESNTG--WTPVYVTDNLATMSI 147

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L +     A  YL DE  A LD + RI  ++ I+        T
Sbjct: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNL----SDT 1228

Query: 520  AFIVEHDFIMATYLADKVIVFD 541
            A      FI  T+  D + V D
Sbjct: 1229 A-----QFICTTFRTDMINVAD 1245

>YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in
           sterol uptake and anaerobic growth, member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [4185 bp, 1394 aa]
          Length = 1394

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 354 TYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLA 398
           ++ ++  T G   L   A  F  S +  +MGE+G GKTTL+ +L+
Sbjct: 752 SWKNINYTVGTKKLINNASGFISSGLTALMGESGAGKTTLLNVLS 796

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 85/209 (40%), Gaps = 29/209 (13%)

Query: 326 NLRFRTEALQFRMADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGE 385
           +L F    +QF  ADA  E +       + P+      D +   EAGE     +LV+   
Sbjct: 14  SLTFNGANIQFG-ADAQGESKKSYDAEDSMPNPANQLNDITFQAEAGE----MVLVLGYP 68

Query: 386 NGT-------GKTTLIKLLAGAIPADD------GQDIPKLNVSMKPQKIAPKFTGTVRQL 432
             T       GKT+L     G+I   +       +  P   +    Q +   F  TV Q 
Sbjct: 69  TSTLFKTLFHGKTSLSYSPPGSIKFKNNEFKSFSEKCPHQIIYNNEQDVHFPFL-TVEQT 127

Query: 433 FFKRIRAQFLNP-----QFQTDVVKPLKIDDIIDQEVQH-----LSGGELQRVAIVLSLG 482
               +  +F  P     Q + ++++   +  ++   V +     +SGGE +R++I+ +  
Sbjct: 128 IDFALSCKFDIPKGERDQIRNELLREFGLSHVLKTIVGNDFFRGVSGGERKRISIIETFI 187

Query: 483 MNADIYLIDEPSAYLDSEQRIICSKVIRR 511
            N  +YL D  +  LDS   +   +++R+
Sbjct: 188 ANGSVYLWDNSTKGLDSATALDFLEILRK 216

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%)

Query: 214 VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPT 271
           V N     +SGGE +R +I  + +    VY++D  +  LD    L+   I+R +   T
Sbjct: 164 VGNDFFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALDFLEILRKMAKAT 221

>YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the
           ATP-binding cassette (ABC) superfamily [921 bp, 306 aa]
          Length = 306

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 85/211 (40%), Gaps = 40/211 (18%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKML 160
           + G  +G+VG  G GKS+   I+A      + R  D   W+         ++++   + L
Sbjct: 58  KAGTKVGIVGRTGAGKSS---IIAA-----IYRLSD---WENGTITIDNKDIKHIPLERL 106

Query: 161 EDDIKAIIK-PQYVDNIPRAIKGP------VQKVGELLKLRLEKSKDD------------ 201
            + I  I + P   D   R+   P      VQ  G L K+ L +  D+            
Sbjct: 107 RNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNF 166

Query: 202 -----AKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQ 256
                  R+ID   L  V+    S LS G+ Q   +  S +   ++ + DE ++ +D   
Sbjct: 167 SSHKLRNRFID---LNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYIS 223

Query: 257 RLNAALIIRSLLNPTTYVICVEHDL-SVLDY 286
                  IR  +  TT ++ + H L SV+DY
Sbjct: 224 DAKIQKTIRETMKNTT-ILTIAHRLRSVIDY 253

>Scas_612.11*
          Length = 1506

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 66/153 (43%), Gaps = 33/153 (21%)

Query: 364 DFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQ----------DIPKL- 412
           D +  ++ GEF     ++M+G  GTGKT+L+   AG +    G+            P + 
Sbjct: 651 DLNFEIKKGEF-----IIMVGPIGTGKTSLLNAFAGFMNKVSGRIQINGDLLLCGYPWIQ 705

Query: 413 NVSMKPQKI------APKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQH 466
           N S+K   I        K+   +R    K             D++    + +I ++ +  
Sbjct: 706 NASVKDNIIFGSPYNKAKYDEVIRVCSLKS----------DLDILPAGDLTEIGERGIT- 754

Query: 467 LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDS 499
           LSGG+  R+ +  S+    DIYL D+  + +DS
Sbjct: 755 LSGGQKARINLARSVYKQKDIYLFDDVLSAVDS 787

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 81/199 (40%), Gaps = 35/199 (17%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKML 160
           + G+ + +VG  G GK++ L   AG      GR +             G  L   +  + 
Sbjct: 657 KKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQ-----------INGDLLLCGYPWIQ 705

Query: 161 EDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDIL---QLKNVLNR 217
              +K        DNI      P  K      +R+   K D    +DIL    L  +  R
Sbjct: 706 NASVK--------DNI--IFGSPYNKAKYDEVIRVCSLKSD----LDILPAGDLTEIGER 751

Query: 218 EVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALI---IRSLLNPTTYV 274
            ++ LSGG+  R  +  S  ++ D+Y+FD+  S +D   R+   ++      LL   T +
Sbjct: 752 GIT-LSGGQKARINLARSVYKQKDIYLFDDVLSAVD--SRVGKHIMDECFLGLLKDKTRI 808

Query: 275 ICVEHDLSVLDYLSDFVCI 293
           +   H LS+L+  S  + +
Sbjct: 809 LAT-HQLSLLERASRVIVL 826

>YNR011C (PRP2) [4594] chr14 complement(644319..646949) Pre-mRNA
           splicing factor and RNA-dependent ATPase of DEAH box
           family, required for first catalytic event of pre-mRNA
           splicing [2631 bp, 876 aa]
          Length = 876

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 319 DGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKRTQGDFSLTVEA-GEFSDS 377
           D  +P E L++     + R+A A   LE +  R  T  + ++         E   E   +
Sbjct: 188 DDLLPEEKLQY-----EARLAQA---LETEEKRILTIQEARKLLPVHQYKDELLQEIKKN 239

Query: 378 QILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSM-KPQKIA 422
           Q+L++MGE G+GKTT    L   +  D   D  KL +++ +P+++A
Sbjct: 240 QVLIIMGETGSGKTT---QLPQYLVEDGFTDQGKLQIAITQPRRVA 282

>Kwal_14.2435
          Length = 1247

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 35/83 (42%), Gaps = 13/83 (15%)

Query: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L +     A  YL DE  A LD + R   +  I+    H +  
Sbjct: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197

Query: 520  AFIVEHDFIMATYLADKVIVFDG 542
                   FI  T+  D + V D 
Sbjct: 1198 -------FICTTFRTDMLQVADS 1213

>YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-binding
            cassette (ABC) superfamily [4695 bp, 1564 aa]
          Length = 1564

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 85/194 (43%), Gaps = 26/194 (13%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFEDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    L        GR  D   +   I Y +  +L
Sbjct: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRD-QSFPRSIGYCQQQDL 1008

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGP-VQKVGELLKLRLEKSKDDAKRYIDILQL 211
             +  T  + + ++     +  D++    K   V++V E+L+++L         Y D    
Sbjct: 1009 -HLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKL---------YADA--- 1055

Query: 212  KNVLNREVSALSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLLNP 270
              ++      L+  + +R  IG+    +  + +F DEP+S LD +   +   +++ L + 
Sbjct: 1056 --IVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR 1113

Query: 271  TTYVICVEHDLSVL 284
               ++C  H  S L
Sbjct: 1114 GQAILCTIHQPSAL 1127

>CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces
           cerevisiae YLL048c YBT1 yeast bile transporter,
           hypothetical start
          Length = 1648

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 91/196 (46%), Gaps = 31/196 (15%)

Query: 373 EFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDI-PKLNVSMKPQ------------ 419
           EF   ++ V++G  G+GKT+++  L G +   +G+ I P L+   + Q            
Sbjct: 730 EFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKIIVPSLSPRHEYQSQAGVINDSIAY 789

Query: 420 --KIAPKFTGTVRQ--LF---FKRIR------AQFLNPQFQTDVVKPLKIDDIIDQEVQH 466
             + A     TVR   LF   F + R      A  L   FQ  ++K     +I ++ +  
Sbjct: 790 CSQAAWLLNDTVRNNILFNAPFDQARYDAVVEACSLKRDFQ--ILKAGDSTEIGEKGIT- 846

Query: 467 LSGGELQRVAIVLSLGMNADIYLIDEPSAYLDSEQRI-ICSKVIRRFILHNKKTAFIVEH 525
           LSGG+ QRV++  +L  +A   L+D+  + +DS   + I  K I   ++   +T  +V H
Sbjct: 847 LSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTALWIYDKCISGPLMEG-RTCILVTH 905

Query: 526 DFIMATYLADKVIVFD 541
           +  +    AD V++ +
Sbjct: 906 NIALTMKNADFVVMIE 921

>Scas_586.3
          Length = 1531

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 76/164 (46%), Gaps = 25/164 (15%)

Query: 372  GEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPAD---DG----QDIPKLNVSMKPQ 419
            G      +  +MG +G GKTTL+  LA     G I  D   +G    +  P+     + Q
Sbjct: 891  GWVKPGTLTALMGASGAGKTTLLDCLAQRVTVGTITGDVFVNGCLRDESFPRSIGYCQQQ 950

Query: 420  KIAPKFTGTVRQ--LFFKRIRAQFLNP-----QFQTDVVKPLKIDDIIDQEV----QHLS 468
             +  K T TVR+   F   +R  F  P     ++  +++K L+++   D  V    + L+
Sbjct: 951  DLHLK-TSTVRESLRFSAYLRQPFDVPVEEKNKYVEEIIKTLEMETYADAVVGVPGEGLN 1009

Query: 469  GGELQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRR 511
              + +R+ I + L     + + +DEP++ LDS+      +++++
Sbjct: 1010 VEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKK 1053

>Scas_711.39
          Length = 1227

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 13/82 (15%)

Query: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L +     A  YL DE  A LD + R   + +I++        
Sbjct: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ-------- 1171

Query: 520  AFIVEHDFIMATYLADKVIVFD 541
               V   FI  T+  D + V D
Sbjct: 1172 -LSVNAQFICTTFRTDMLQVAD 1192

>YPL147W (PXA1) [5300] chr16 (273254..275866) Protein required for
           long-chain fatty acid transport across the peroxisomal
           membrane, member of the ATP-binding cassette (ABC)
           superfamily, has similarity to a human gene associated
           with adrenoleukodystrophy [2613 bp, 870 aa]
          Length = 870

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 80/177 (45%), Gaps = 29/177 (16%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDGQDIPKL----NVSMKPQKIAPKFT--GTVR-QL 432
           L+++G NG GK+++ +++A   P  +   +  +    N+   PQK  P F+  GT+R Q+
Sbjct: 641 LLILGPNGCGKSSIQRIIAEIWPVYNKNGLLSIPSENNIFFIPQK--PYFSRGGTLRDQI 698

Query: 433 FFKRIRAQFLNPQFQ----TDVVKPLKIDDIIDQEV------------QHLSGGELQRVA 476
            +     +F +  F+      ++  +K+D ++ + V              LSGGE QRV 
Sbjct: 699 IYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIADWKDLLSGGEKQRVN 758

Query: 477 IVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRR----FILHNKKTAFIVEHDFIM 529
               +       ++DE +  +  +       +++R    FI  +++   I  H+ ++
Sbjct: 759 FARIMFHKPLYVVLDEATNAISVDMEDYLFNLLKRYRFNFISISQRPTLIKYHEMLL 815

>Kwal_34.15770
          Length = 1436

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 70/164 (42%), Gaps = 43/164 (26%)

Query: 382  MMGENGTGKTTLIKLL-------AGAIPADDGQDIPKLNVSMKPQKIA--PK----FTGT 428
            ++G  G GK+T+I  L       +G I  D+  DI  + +    Q I   P+    FTGT
Sbjct: 1192 IVGRTGAGKSTIITALFRFLDPESGYIKIDN-VDITSVELKRLRQSITIIPQDPTLFTGT 1250

Query: 429  VR------------QLFFKRIRAQFLNPQ---------------FQTDVVKPLKIDDIID 461
            V+            Q+F    R   L  +                  +V K L++D+ I 
Sbjct: 1251 VKSNLDPYDEYSDGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRLDNEIT 1310

Query: 462  QEVQHLSGGELQRVAIVLSLGMNADIYLIDEPSAYLD--SEQRI 503
            +   +LS G+ Q V +  SL  +  + L+DE +A +D  S+ RI
Sbjct: 1311 EGGANLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARI 1354

>Scas_472.1*
          Length = 393

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 464 VQHLSGGELQRVAIVLSLGMNADIYLI--DEPSAYLDSEQRIICSKVIRRF 512
           ++ LSGG  Q+V +VL+ G     +LI  DEP+ YLD +     SK ++ F
Sbjct: 243 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF 291

>YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump
            involved in resistance to multiple drugs, member of the
            ATP-binding cassette (ABC) superfamily [4536 bp, 1511 aa]
          Length = 1511

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 76/173 (43%), Gaps = 31/173 (17%)

Query: 372  GEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPAD---DG----QDIPKLNVSMKPQ 419
            G      +  +MG +G GKTTL+  LA     G I  D   +G    +  P+     + Q
Sbjct: 893  GWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDILVNGIPRDKSFPRSIGYCQQQ 952

Query: 420  KIAPKFTGTVRQLFFKRIRAQFLNP---------QFQTDVVKPLKIDDIIDQEVQHLSGG 470
             +  K T TVR+    R  A    P         ++  +V+K L+++   D  V  ++G 
Sbjct: 953  DLHLK-TATVRESL--RFSAYLRQPAEVSIEEKNRYVEEVIKILEMEKYADA-VVGVAGE 1008

Query: 471  EL---QRVAIVLSLGMNAD---IYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
             L   QR  + + + + A    +  +DEP++ LDS+      +++++   H +
Sbjct: 1009 GLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQ 1061

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 81/207 (39%), Gaps = 52/207 (25%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA  ++  +G                          ++
Sbjct: 896  KPGTLTALMGASGAGKTTLLDCLA--ERVTMG--------------------------VI 927

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPVQ--------------KVGELLKLRLEKSKDDAKRYI 206
              DI     P+   + PR+I    Q              +    L+   E S ++  RY+
Sbjct: 928  TGDILVNGIPR-DKSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPAEVSIEEKNRYV 986

Query: 207  D----ILQLKNVLNREVSALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQR 257
            +    IL+++   +  V     G    + +R  IG+    +  + +F DEP+S LD +  
Sbjct: 987  EEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTA 1046

Query: 258  LNAALIIRSLLNPTTYVICVEHDLSVL 284
             +   +++ L N    ++C  H  S +
Sbjct: 1047 WSICQLMKKLANHGQAILCTIHQPSAI 1073

>Scas_717.6*
          Length = 1400

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 10/86 (11%)

Query: 428 TVRQLFFKRIRAQFLNP-----QFQTDVVKPLKIDDIIDQ-----EVQHLSGGELQRVAI 477
           TVRQ     +  +F  P     Q + +++    +  ++D       V+ +SGGE +R++I
Sbjct: 129 TVRQTIDFALSCKFHIPLEERNQMRDELLNGFGLSHVVDTFVGNDYVRGVSGGERKRISI 188

Query: 478 VLSLGMNADIYLIDEPSAYLDSEQRI 503
           + +   N  +YL D  +  LDS   +
Sbjct: 189 IETFIANGSVYLWDNSTKGLDSSTAL 214

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 21/173 (12%)

Query: 362 QGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLA-----GAIPAD---DGQDIPKLN 413
           +GD  L  +   F  S +  +MGE+G GKTTL+ +L+     G +  +   DGQ  P  N
Sbjct: 757 EGDKQLINDCSGFISSGLTALMGESGAGKTTLLNVLSQRVTSGEVTGELLIDGQ--PLTN 814

Query: 414 VS--------MKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQ 465
           ++        ++ Q +          L    I     +  +   V K LK+    +  V 
Sbjct: 815 IAAFRRSIGFVQQQDVHLDLLTVKESLEISCILRGDGDRDYLGTVAKLLKLP--ANTLVA 872

Query: 466 HLSGGELQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRRFILHNK 517
            L+  E + ++I + L     + L +DEP++ LD+E  +   + +++  L  +
Sbjct: 873 DLTPTEKKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQ 925

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%)

Query: 214 VLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLLNPT 271
           V N  V  +SGGE +R +I  + +    VY++D  +  LD    L    I++++   T
Sbjct: 170 VGNDYVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALEFLSILQTMARTT 227

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 10/117 (8%)

Query: 211 LKNVLNREVSALSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLLN 269
           LK   N  V+ L+  E +  +IG+  V +  + +F DEP+S LD +  L     ++ L  
Sbjct: 863 LKLPANTLVADLTPTEKKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSL 922

Query: 270 PTTYVICVEH--DLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFL--DGHI 322
               ++C  H    SV+ Y  +   +  G   VY        + +G + FL  D H+
Sbjct: 923 QGQAILCTIHQPSKSVIKYFDNIYLLKRGGECVYF-----GHIDDGCDYFLTHDEHL 974

>Scas_469.1
          Length = 609

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 6/50 (12%)

Query: 351 RAFT--YPDMKRTQGDFSLTVEAGEF----SDSQILVMMGENGTGKTTLI 394
           R FT  Y D+ + + D  +  +  EF     ++QI+V +GE G+GKTT I
Sbjct: 114 RDFTPKYFDILKIRRDLPVHAQRAEFLKIYQENQIMVFVGETGSGKTTQI 163

>Kwal_27.11147
          Length = 323

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%)

Query: 339 ADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLA 398
           A  GD     A++       K    D  L  E     D ++LV+ G+ G GK+T   LL 
Sbjct: 30  AGQGDACNGCANKEICESLPKGPDPDIPLITENLSQIDHKVLVLSGKGGVGKSTFTSLLC 89

Query: 399 GAIPADD 405
            A+ +D+
Sbjct: 90  WALSSDE 96

>Kwal_14.1242
          Length = 269

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 69/155 (44%), Gaps = 21/155 (13%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRFE----DPPEWQEIIKYFRGSELQNYFTKMLEDD 163
           ++G+NG GKST LK+L+GK     G  +    DP        +   S  QN      E D
Sbjct: 37  IIGSNGAGKSTLLKLLSGKHLCLSGEIKVNGLDP--------FSPHSMHQN------EAD 82

Query: 164 IKAIIKPQYVDNIPRAIKGPVQKVGELL-KLRLEKSKDDAKRYIDILQLKNVLNREVSAL 222
              I      +    +I      V ELL  +  +  ++  ++ IDIL +   +N  +  L
Sbjct: 83  NCQITTYLGTEWCHMSIINRDIGVLELLDSIGFQSLRERGQKLIDILDVN--VNWRMHRL 140

Query: 223 SGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQR 257
           S G+ +R  + M  ++   + + DE +  LDV+ R
Sbjct: 141 SDGQKRRVQLTMGLLKPWRLLLLDEVTVDLDVRAR 175

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query: 381 VMMGENGTGKTTLIKLLAG 399
           +++G NG GK+TL+KLL+G
Sbjct: 36  LIIGSNGAGKSTLLKLLSG 54

>Kwal_26.8730
          Length = 831

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 79/177 (44%), Gaps = 29/177 (16%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMK----PQKIAPKFT--GTVR-QL 432
           ++++G NG+GKT++ +++A   P  +   +  +    +    PQK  P F   GT R Q+
Sbjct: 604 MLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSVPAERELICIPQK--PYFIQGGTFREQI 661

Query: 433 FFKRIRAQFLNPQFQ----TDVVKPLKID------------DIIDQEVQHLSGGELQRVA 476
            +     Q+ +  ++      V+K +K++            D + +    LSGGE QR+ 
Sbjct: 662 IYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGWRYLDAVAEWKDVLSGGERQRMN 721

Query: 477 IVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRR----FILHNKKTAFIVEHDFIM 529
               +       ++DE +  + ++       +++R    FI  +++ + I  HD  +
Sbjct: 722 FARIMFHKPKFVVLDEATNAISADMEDYLFNMLKRYRFNFITISQRPSLIKYHDLAL 778

>YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein that
           associates with Ccr4p, member of the non-transporter
           group of the ATP-binding cassette (ABC) superfamily [870
           bp, 289 aa]
          Length = 289

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 39  VVGANGAGKSTLLKLLSGKH 58

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 381 VMMGENGTGKTTLIKLLAGAIPADDGQ 407
           +++G NG GK+TL+KLL+G     DG+
Sbjct: 38  LVVGANGAGKSTLLKLLSGKHLCLDGK 64

>AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH]
           (710017..710829) [813 bp, 270 aa]
          Length = 270

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           L G+NG GKST LK+L+GK 
Sbjct: 39  LCGSNGAGKSTLLKLLSGKH 58

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%)

Query: 380 LVMMGENGTGKTTLIKLLAG 399
           +++ G NG GK+TL+KLL+G
Sbjct: 37  MLLCGSNGAGKSTLLKLLSG 56

>YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative
           nucleotide-binding protein, has similarity to bacterial
           partitioning ATPases [987 bp, 328 aa]
          Length = 328

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFK 435
           + +ILV+ G+ G GK+T   +L+ A+ AD+   +  +++ +    + P   G +++   +
Sbjct: 72  EHKILVLSGKGGVGKSTFAAMLSWALSADEDLQVGAMDLDICGPSL-PHMLGCIKETVHE 130

Query: 436 RIRAQFLNPQFQTDVVKPLKI 456
                   P + TD +  + I
Sbjct: 131 SNSG--WTPVYVTDNLATMSI 149

>Sklu_2062.2 YGL091C, Contig c2062 3197-4183
          Length = 328

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 1/93 (1%)

Query: 339 ADAGDELEADASRAFTYPDMKRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLA 398
           A  GD     A++       K    D  L  E       ++LV+ G+ G GK+T   +L+
Sbjct: 35  AGKGDACAGCANKDICESLPKGPDPDIPLITENLSQIKHKVLVLSGKGGVGKSTFTTMLS 94

Query: 399 GAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQ 431
            A+ AD+   +  +++ +    + P+  G V++
Sbjct: 95  WALSADEDLQVGAMDLDICGPSL-PRMLGCVKE 126

>CAGL0H03091g complement(292976..293980) highly similar to sp|P52920
           Saccharomyces cerevisiae YGL091c NBP35
           nucleotide-binding protein, start by similarity
          Length = 334

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 378 QILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSM 416
           +ILV+ G+ G GK+T   +L+ A+ ADD   +  +++ +
Sbjct: 80  KILVLSGKGGVGKSTFTTMLSWALSADDNLQVGAMDLDI 118

>Sklu_2361.8 YPL147W, Contig c2361 14520-17030
          Length = 836

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 83/184 (45%), Gaps = 31/184 (16%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDGQ---DIP-KLNVSMKPQKIAPKFT--GTVR-QL 432
           L+++G N  GK+++ +++A   P  +      IP  +N+   PQK  P F   GT+R Q+
Sbjct: 609 LLILGPNSCGKSSIQRIIAEIWPIYNKNGLLSIPTSVNLFCIPQK--PYFLQGGTLRDQI 666

Query: 433 FFKRIRAQFLNPQFQ-TDVVKPLK----------------IDDIIDQEVQHLSGGELQRV 475
            +     +F +   +  D+V+ L+                +D + D +   LSGGE QR+
Sbjct: 667 IYPMSTDEFFDRGHKDKDLVQALQEVKLEYLLKRDRGWKYLDAVADWK-DVLSGGERQRM 725

Query: 476 AIVLSLGMNADIYLIDEPSAYLDSEQRIICSKVIRR----FILHNKKTAFIVEHDFIMAT 531
                +       ++DE +  + ++       +++R    FI  +++ + I  HDF++  
Sbjct: 726 NFARIMFHRPRFVVLDEATNAISADMEDYLFNMLKRYRFNFITISQRPSLIKYHDFLLEI 785

Query: 532 YLAD 535
              D
Sbjct: 786 SAGD 789

>Kwal_26.6702
          Length = 617

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 9/96 (9%)

Query: 198 SKDDAKRYID----ILQLKNVLNREVSALSGG----ELQRFAIGMSCVQEADVYMF-DEP 248
           S  +  +Y+D    IL+++   +  V     G    + +R  IG+    +  + +F DEP
Sbjct: 75  SIAEKNKYVDEVIKILEMQKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEP 134

Query: 249 SSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVL 284
           +S LD +   +   ++R L N    ++C  H  S L
Sbjct: 135 TSGLDSQTAWSICQLMRRLANHGQAILCTIHQPSAL 170

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 69/160 (43%), Gaps = 27/160 (16%)

Query: 383 MGENGTGKTTLIKLLA-----GAIPAD---DG---QDIPKLNVSMKPQKIAPKFTGTVRQ 431
           M  +G GKTTL+  LA     G I  D   +G    D    ++    Q+     T TVR+
Sbjct: 1   MSASGAGKTTLLDCLASRVTMGTITGDMFINGFLRDDSFARSIGYCQQQDLHLETATVRE 60

Query: 432 LFFKRIRAQFLNP---------QFQTDVVKPLKIDDIIDQEV----QHLSGGELQRVAIV 478
               R  A    P         ++  +V+K L++    D  V    + L+  + +R+ I 
Sbjct: 61  SL--RFSAYLRQPASVSIAEKNKYVDEVIKILEMQKYADAVVGVAGEGLNVEQRKRLTIG 118

Query: 479 LSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRRFILHNK 517
           + L     + L +DEP++ LDS+      +++RR   H +
Sbjct: 119 VELAAKPKLLLFLDEPTSGLDSQTAWSICQLMRRLANHGQ 158

>KLLA0B02563g complement(222951..225377) similar to sp|P34230
           Saccharomyces cerevisiae YKL188c PXA2 ABC transporter,
           peroxisomal, start by similarity
          Length = 808

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 15/84 (17%)

Query: 57  GCGICVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRP-GQVL--------- 106
           G  + + K   +   IIN P   D  V   Y  N  +   +P   P GQVL         
Sbjct: 469 GVSLRLNKFNDELDNIINAPKERDDTVPVEYDDNVIEFQNVPLITPTGQVLISELTFKLE 528

Query: 107 -----GLVGTNGIGKSTALKILAG 125
                 ++G NG GKS+  ++L G
Sbjct: 529 RFNHLLIIGPNGCGKSSLFRVLGG 552

>CAGL0F01419g complement(142623..146819) highly similar to tr|Q08409
           Saccharomyces cerevisiae YOR011w AUS1, start by
           similarity
          Length = 1398

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 82/209 (39%), Gaps = 42/209 (20%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
            L+G +G GK+T L +L+ + +                            + ++  +I  
Sbjct: 784 ALMGESGAGKTTLLNVLSQRTE----------------------------SGVVSGEILI 815

Query: 167 IIKPQYVDNIPRAIKGPVQK---------VGELLKLRLEKSKDDAKRYIDILQ--LKNVL 215
             KP   +N  R   G VQ+         V E L++  E   D    Y++ +   LK  L
Sbjct: 816 DGKPLTNENAFRRSIGFVQQQDIHLELLTVKESLEISSELRGDGDMEYVESISELLKLPL 875

Query: 216 NREVSALSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLLNPTTYV 274
           +  V  L+  + +  +IG+  V +  + +F DEP+S LD +  L     ++ L      +
Sbjct: 876 DSLVRELNPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQAI 935

Query: 275 ICVEH--DLSVLDYLSDFVCIIYGVPSVY 301
            C  H    SV+ Y  +   +  G   VY
Sbjct: 936 FCTIHQPSKSVISYFDNIYLLKRGGECVY 964

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 78/178 (43%), Gaps = 33/178 (18%)

Query: 363 GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLL-----AGAIPAD---DGQDIPKLNV 414
           GD  L      +  S +  +MGE+G GKTTL+ +L     +G +  +   DG+ +   N 
Sbjct: 766 GDKRLINNVSGYIGSGLTALMGESGAGKTTLLNVLSQRTESGVVSGEILIDGKPLTNENA 825

Query: 415 SMKPQKIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKID-DI-------------I 460
             +         G V+Q   + I  + L  +   ++   L+ D D+             +
Sbjct: 826 FRRS-------IGFVQQ---QDIHLELLTVKESLEISSELRGDGDMEYVESISELLKLPL 875

Query: 461 DQEVQHLSGGELQRVAIVLSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRRFILHNK 517
           D  V+ L+  + + ++I + L     + L +DEP++ LD+E  +   + +++  L  +
Sbjct: 876 DSLVRELNPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQ 933

>Scas_640.8
          Length = 868

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 81/185 (43%), Gaps = 45/185 (24%)

Query: 380 LVMMGENGTGKTTLIKLLAG-----------AIPADDGQDIPKLNVSMKPQKIAPKFT-- 426
           L+++G N  GKT++ +++A            +IPA+D       N+   PQK  P FT  
Sbjct: 640 LLILGPNSCGKTSIQRIIAEIWPIYNKNGLLSIPAED-------NLFCVPQK--PYFTRG 690

Query: 427 GTVR----------QLFFKRIR-AQFLNPQFQTDVVKPLK-------IDDIIDQEVQHLS 468
           GT+R          + + + I+ AQ +    +  +   LK       +D++ D +   LS
Sbjct: 691 GTLRDQIIYPMSSDEFYDRGIKDAQLVQIMAEVHLDYLLKRGTGFSYLDNVADWK-DVLS 749

Query: 469 GGELQRVAIVLSLGMNADIYLIDEP----SAYLDSEQRIICSKVIRRFILHNKKTAFIVE 524
           GGE QR+     L       ++DE     SA ++     I  K    FI  +++ A I  
Sbjct: 750 GGEKQRMNFARILFHKPRFVVLDEATNAISADMEDHLFNILKKYRFNFITISQRPALIEY 809

Query: 525 HDFIM 529
           HD ++
Sbjct: 810 HDLLL 814

>YGL120C (PRP43) [1866] chr7 complement(281638..283941) Pre-mRNA
           splicing factor required for release of the
           lariat-intron from the spliceosome, member of the
           DEAH-box RNA helicase family [2304 bp, 767 aa]
          Length = 767

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 6/50 (12%)

Query: 351 RAFT--YPDMKRTQGDFSLTVEAGEF----SDSQILVMMGENGTGKTTLI 394
           R FT  Y D+ + + +  +  +  EF     ++QI+V +GE G+GKTT I
Sbjct: 77  REFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQI 126

>Kwal_56.23638
          Length = 4922

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 29/43 (67%), Gaps = 4/43 (9%)

Query: 377 SQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQ 419
           S+ ++++GE GTGKTT+++ +A A+     Q +  +NVS + +
Sbjct: 649 SEPVLLVGETGTGKTTVVQQVAKAV----NQRLTVINVSQQTE 687

>Kwal_26.9532
          Length = 1471

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 85/201 (42%), Gaps = 22/201 (10%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFE-DPPEWQEIIKYFRGSELQNYFTKM 159
            R G+ +G+ G  G GKST +  L    + + G    D  +  ++  Y    EL++    +
Sbjct: 1232 RGGEKIGICGRTGAGKSTIMSALYRMIELHDGSITIDGIDIAQLGLY----ELRSKLAII 1287

Query: 160  LED------DIKAIIKP-------QYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYI 206
             +D      D++  + P       +  D + RA  G +    E     + ++   A   +
Sbjct: 1288 PQDPVLFKGDVRKNLDPFHERSDNELWDALVRA--GAIATEDEAAARAVTRATAGALTNL 1345

Query: 207  DILQLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRS 266
                L+  +  + S  S GE Q  A+  + V+ + + + DE +S +D +        I  
Sbjct: 1346 HKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRILILDEATSSVDYETDAKIQARIAD 1405

Query: 267  LLNPTTYVICVEHDL-SVLDY 286
              +  T V+C+ H L ++LDY
Sbjct: 1406 AFSECT-VLCIAHRLNTILDY 1425

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 222 LSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVK 255
           LSGG+  R  +  S  ++ D+Y+FD+  S +D +
Sbjct: 700 LSGGQKARINLARSVYKKKDIYLFDDVLSAVDAR 733

>YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing
           factor of DEAH box family, required for release of
           mature mRNA from the spliceosome [3438 bp, 1145 aa]
          Length = 1145

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 65/136 (47%), Gaps = 20/136 (14%)

Query: 376 DSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPKFTGTVRQLFFK 435
           D+Q LV++GE G+GKTT I         ++G     +    +P+++A            K
Sbjct: 498 DNQFLVIVGETGSGKTTQITQYLD----EEGFSNYGMIGCTQPRRVAAVSVA-------K 546

Query: 436 RIRAQFLNPQFQTDVVKPLKIDDII--DQEVQHLSGGELQRVAIVLSLGMNADIYLIDEP 493
           R+ A+ +  +   DV   ++ +D+   D  +++++ G LQR A++        + ++DE 
Sbjct: 547 RV-AEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDE- 604

Query: 494 SAYLDSEQRIICSKVI 509
                + +R + + V+
Sbjct: 605 -----AHERTVATDVL 615

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 13/82 (15%)

Query: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L +     A  YL DE  A LD + R   +  +++        
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-------- 1174

Query: 520  AFIVEHDFIMATYLADKVIVFD 541
                +  FI  T+  D + V D
Sbjct: 1175 -LSSQAQFICTTFRGDMIAVAD 1195

>CAGL0D00352g complement(42946..45531) similar to sp|P34230
           Saccharomyces cerevisiae YKL188c PXA2 ABC transporter,
           hypothetical start
          Length = 861

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 373 EFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIA 422
           E      L+++G NG GK++L +LL G  P    +   +  +++ P+KI 
Sbjct: 519 ELKHGDHLLIIGPNGCGKSSLFRLLGGLWPIRQIETGVQTKLTVPPRKIG 568

>CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-binding
            cassette transporter, identified start
          Length = 1542

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 39/197 (19%), Positives = 78/197 (39%), Gaps = 32/197 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFEDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    +        GR  D   +   I Y +  +L
Sbjct: 912  KPGTLTALMGASGAGKTTLLDCLAERTTMGVITGDVMVNGRPRDT-SFSRSIGYCQQQDL 970

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLEKSKDDAKRYIDILQLK 212
                  +    ++  ++       P ++              +E+  +  +  I IL+++
Sbjct: 971  H-----LKTATVRESLRFSAYLRQPSSVS-------------IEEKNEYVEAVIKILEME 1012

Query: 213  NVLNREVSALSGG----ELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSL 267
               +  V     G    + +R  IG+    +  + +F DEP+S LD +       +++ L
Sbjct: 1013 TYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKKL 1072

Query: 268  LNPTTYVICVEHDLSVL 284
             N    ++C  H  S +
Sbjct: 1073 ANHGQAILCTIHQPSAM 1089

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 20/133 (15%)

Query: 184 VQKVGELLK-LRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEADV 242
           V K+G+ LK LR  KS    KR   + +LKN++ + VS+LS   L   ++    + E   
Sbjct: 65  VNKIGDRLKILRKSKSFQRDKRIEQVNRLKNLMEK-VSSLSTATL---SMNSELIPEKHC 120

Query: 243 YMF---DEPSSYLDVKQRLNAALIIRSLL------------NPTTYVICVEHDLSVLDYL 287
            +F   D  +  ++V    NA  I + L+            N     +  ++D+ VLDY 
Sbjct: 121 VIFILNDGSAKKVNVNGCFNADSIKKRLIRRLPHELLATNSNGEVTKMVQDYDVFVLDYT 180

Query: 288 SDFVCIIYGVPSV 300
            + + ++Y V  V
Sbjct: 181 KNVLHLLYDVELV 193

>Kwal_23.4045
          Length = 761

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 373 EFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIP-KLNVSMKPQKIAP 423
           E      L+++G NG GK++L ++L G  P       P KL+  + P ++ P
Sbjct: 465 ELKHGDHLLIIGPNGCGKSSLFRVLGGLWPVMKSFTHPEKLSKLIMPPRVGP 516

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 13/82 (15%)

Query: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L +     A  YL DE  A LD + R   + +++       K 
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL----SKN 1178

Query: 520  AFIVEHDFIMATYLADKVIVFD 541
            A      FI  T+  D + V D
Sbjct: 1179 A-----QFICTTFRTDMLQVAD 1195

>KLLA0F14575g complement(1351796..1354351) some similarities with
           sp|P47068 Saccharomyces cerevisiae YJL020c singleton,
           hypothetical start
          Length = 851

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 6/84 (7%)

Query: 386 NGTGKTTLIKLLAGAI---PADDGQDIPKLNVSMKP--QKIAPKF-TGTVRQLFFKRIRA 439
           N   +   I+ + GA    PA      P++  S +P  +    KF  GT+ +L F +   
Sbjct: 566 NAPQRRPSIQTIPGAANSSPATPSSAAPQIPASFQPLRRTTTAKFEPGTIPELEFSKQST 625

Query: 440 QFLNPQFQTDVVKPLKIDDIIDQE 463
            +L    Q D VKP K+  I + +
Sbjct: 626 WWLTKTVQADTVKPSKVKYIWESQ 649

>Kwal_14.1724
          Length = 770

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 339 ADAGDELEADASRAFT-------YPDMKRTQGDFSLTVEAGEF----SDSQILVMMGENG 387
           A+   ELE      FT       Y D+ + + +  +  +  EF     ++Q++V +GE G
Sbjct: 62  AEQAAELEIGKINPFTGGAFSPRYFDILKIRRELPVHAQRNEFLKIYQENQVMVFVGETG 121

Query: 388 TGKTTLI 394
           +GKTT I
Sbjct: 122 SGKTTQI 128

>CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter, start by
            similarity
          Length = 1659

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 209  LQLKNVLNREVSALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
            L L+N +    + LS G+ Q   +  + ++   V + DE ++ +D          IR++ 
Sbjct: 1526 LNLENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVF 1585

Query: 269  NPTTYVICVEHDL-SVLDY 286
            + +T V+ + H L SV+DY
Sbjct: 1586 DKST-VLTIAHRLRSVIDY 1603

>AAR180C [368] [Homologous to ScYGL120C (PRP43) - SH]
           (665711..668011) [2301 bp, 766 aa]
          Length = 766

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 328 RFRTEALQFRMADAGDELEADASRAFT--YPDMKRTQGDFSLTVEAGEF----SDSQILV 381
           R +T A Q R  + G E      + F+  Y  + + + D  +  +  EF     ++Q++V
Sbjct: 55  RHKTTASQARQLEDG-ENNPFTGKPFSENYVKILKVRRDLPVHAQRDEFLKMYQENQVMV 113

Query: 382 MMGENGTGKTTLI 394
            +GE G+GKTT I
Sbjct: 114 FVGETGSGKTTQI 126

>Kwal_23.6117
          Length = 897

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 343 DELEADASRAFTYPDMKRTQGDFSLTVEAGE-FSDSQILVMMGENGTGKTT 392
           DELE +  R  T  + +++   +    E  +   ++Q+L+++GE G+GKTT
Sbjct: 230 DELEKENERLATIQETRKSLPVYRFRRELLQSVKENQVLIVVGETGSGKTT 280

>Scas_720.7
          Length = 332

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 346 EADASRAFTYPDM-----KRTQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGA 400
           +ADA +  +  D+     K    D  L  E       +ILV+ G+ G GK+T   +L+ A
Sbjct: 41  KADACQGCSNKDICESLPKGPDPDIPLITENLAGIKHKILVLSGKGGVGKSTFTTMLSWA 100

Query: 401 IPADD 405
           + AD+
Sbjct: 101 LSADE 105

>CAGL0K06281g complement(608987..609544) highly similar to sp|P15454
           Saccharomyces cerevisiae YDR454c Guanylate kinase, start
           by similarity
          Length = 185

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 377 SQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQKIAPK 424
           S+ +V+ G +GTGK+TL+K L    P   G  +     S +P ++  K
Sbjct: 2   SRPIVISGPSGTGKSTLLKKLFAEFPDTFGFSVSSTTRSPRPGEVHGK 49

>YMR128W (ECM16) [4085] chr13 (523695..527498) Component of U3
           snoRNP (also called small subunit processome), which is
           required for 18S rRNA biogenesis, putative DEAH-box RNA
           helicase [3804 bp, 1267 aa]
          Length = 1267

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 363 GDFSLTVEAGEFSDSQILVMMGENGTGKTTLIK--LLAGAIPADDGQDIPKLNVSMKPQK 420
           G+    +EA   +D  ++++ GE G+GKTT +   L      A+D  D P +    +P++
Sbjct: 395 GEEHKIMEAIHHND--VVIICGETGSGKTTQVPQFLYEAGFGAEDSPDYPGMVGITQPRR 452

Query: 421 IA 422
           +A
Sbjct: 453 VA 454

>Scas_716.82
          Length = 675

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 69/154 (44%), Gaps = 26/154 (16%)

Query: 382 MMGENGTGKTTLIKLLA----GAIPAD---DGQDIPKL------NVSMKPQKIAPKFTGT 428
           +MGE+G GKTTL+  LA    G I  D   +G+ I          V  +   IA      
Sbjct: 62  VMGESGAGKTTLLNTLAQRNVGIITGDMLINGRPIDASFERRTGYVQQQDVHIAELTVRE 121

Query: 429 VRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIID-QEVQHLSGGELQR---------VAIV 478
             Q   +  RAQ +  + +   V+  KI  ++D QE      GE+ R         ++I 
Sbjct: 122 SLQFSARMRRAQAIPDEEKMAYVE--KIIHVLDMQEYAEALVGEIGRGLNVEQRKKLSIG 179

Query: 479 LSLGMNADIYL-IDEPSAYLDSEQRIICSKVIRR 511
           + L    D+ L +DEP++ LDS+      +++R+
Sbjct: 180 VELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRK 213

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 228 QRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEH 279
           ++ +IG+  V + D+ +F DEP+S LD +       ++R L      ++C  H
Sbjct: 174 KKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRKLAQAGQSILCTIH 226

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,585,831
Number of extensions: 881772
Number of successful extensions: 3611
Number of sequences better than 10.0: 195
Number of HSP's gapped: 3508
Number of HSP's successfully gapped: 446
Length of query: 598
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 491
Effective length of database: 12,891,983
Effective search space: 6329963653
Effective search space used: 6329963653
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)