Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17534g100599051500.0
AGR126C101399133350.0
CAGL0G04015g1019100833040.0
Scas_604.61011100231730.0
YLL031C (GPI13)101798331110.0
Kwal_55.206641791677486e-93
KLLA0F01705g7873474915e-51
Kwal_14.25878083724829e-50
AEL166C8063344792e-49
Scas_711.508313284651e-47
YJL062W (LAS21)8303414581e-46
CAGL0J05236g8423734117e-41
Scas_689.289241761536e-10
Kwal_33.138569221791529e-10
YKL165C (MCD4)9191971465e-09
AEL113C9252001448e-09
KLLA0B07249g9192061431e-08
CAGL0M08448g9212011341e-07
KLLA0A11374g62148790.33
KLLA0F11935g47050731.7
AEL259W26575721.7
Kwal_14.2574443112694.5
AFR307C650138695.2
Kwal_27.1094593583695.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17534g
         (990 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17534g 1540967..1543984 similar to sgd|S0003954 Saccharomy...  1988   0.0  
AGR126C [4437] [Homologous to ScYLL031C (GPI13) - SH] (989241..9...  1289   0.0  
CAGL0G04015g 379330..382389 highly similar to tr|Q07830 Saccharo...  1277   0.0  
Scas_604.6                                                           1226   0.0  
YLL031C (GPI13) [3389] chr12 complement(77151..80204) Protein in...  1202   0.0  
Kwal_55.20664                                                         292   6e-93
KLLA0F01705g complement(159469..161832) similar to sp|P40367 Sac...   193   5e-51
Kwal_14.2587                                                          190   9e-50
AEL166C [2340] [Homologous to ScYJL062W (LAS21) - SH] (322853..3...   189   2e-49
Scas_711.50                                                           183   1e-47
YJL062W (LAS21) [2849] chr10 (317200..319692) Protein required f...   181   1e-46
CAGL0J05236g complement(502420..504948) similar to sp|P40367 Sac...   162   7e-41
Scas_689.28                                                            64   6e-10
Kwal_33.13856                                                          63   9e-10
YKL165C (MCD4) [3105] chr11 complement(137937..140696) Protein r...    61   5e-09
AEL113C [2393] [Homologous to ScYKL165C (MCD4) - SH] (409096..41...    60   8e-09
KLLA0B07249g complement(630336..633095) similar to sp|P36051 Sac...    60   1e-08
CAGL0M08448g complement(841439..844204) highly similar to sp|P36...    56   1e-07
KLLA0A11374g complement(985471..987336) some similarities with s...    35   0.33 
KLLA0F11935g 1095626..1097038 similar to sgd|S0002512 Saccharomy...    33   1.7  
AEL259W [2247] [Homologous to ScYPR167C (MET16) - SH] complement...    32   1.7  
Kwal_14.2574                                                           31   4.5  
AFR307C [3499] [Homologous to ScYGR128C - SH] (997175..999127) [...    31   5.2  
Kwal_27.10945                                                          31   5.7  

>KLLA0C17534g 1540967..1543984 similar to sgd|S0003954 Saccharomyces
           cerevisiae YLL031c GPI13 protein involved in
           glycosylphosphatidylinositol biosynthesis, start by
           similarity
          Length = 1005

 Score = 1988 bits (5150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 967/990 (97%), Positives = 967/990 (97%)

Query: 1   MNPTVSDERDRAERIRLSIMGPQTRSSRMSYRISRFKSTHTXXXXXXXXXXXXQFISIAF 60
           MNPTVSDERDRAERIRLSIMGPQTRSSRMSYRISRFKSTHT            QFISIAF
Sbjct: 1   MNPTVSDERDRAERIRLSIMGPQTRSSRMSYRISRFKSTHTLYILLLASLAVLQFISIAF 60

Query: 61  FAKGFLLTRTVLDNVAELDPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYNPNYHN 120
           FAKGFLLTRTVLDNVAELDPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYNPNYHN
Sbjct: 61  FAKGFLLTRTVLDNVAELDPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYNPNYHN 120

Query: 121 NLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGDVIDEDNL 180
           NLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGDVIDEDNL
Sbjct: 121 NLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGDVIDEDNL 180

Query: 181 IKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISYLEEYYFNE 240
           IKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISYLEEYYFNE
Sbjct: 181 IKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISYLEEYYFNE 240

Query: 241 EKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTADDNTLYVVMGDH 300
           EKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTADDNTLYVVMGDH
Sbjct: 241 EKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTADDNTLYVVMGDH 300

Query: 301 GMDHTGNHGGDSQDELESVLWLYAKNANWSKDYDSYNTTDLGTSYKQMNQIDLVPTLSLL 360
           GMDHTGNHGGDSQDELESVLWLYAKNANWSKDYDSYNTTDLGTSYKQMNQIDLVPTLSLL
Sbjct: 301 GMDHTGNHGGDSQDELESVLWLYAKNANWSKDYDSYNTTDLGTSYKQMNQIDLVPTLSLL 360

Query: 361 LGIPIPFNNLGWPLDEIANDPEELTLYHNICRNQLEKYLSVSNIIGATARRDALISVENH 420
           LGIPIPFNNLGWPLDEIANDPEELTLYHNICRNQLEKYLSVSNIIGATARRDALISVENH
Sbjct: 361 LGIPIPFNNLGWPLDEIANDPEELTLYHNICRNQLEKYLSVSNIIGATARRDALISVENH 420

Query: 421 PEFQQMFLEICKDLWARFDFTSICVGIALMAFSXXXXXXXXXXXPSIVVGQMVGDFVGCV 480
           PEFQQMFLEICKDLWARFDFTSICVGIALMAFS           PSIVVGQMVGDFVGCV
Sbjct: 421 PEFQQMFLEICKDLWARFDFTSICVGIALMAFSLILLLIIIKLIPSIVVGQMVGDFVGCV 480

Query: 481 VVISAISNVSFQGIYQVLHQPAFLDNSLWCSAFATSVGIILGVFIPIFDRYSVQWLCLRL 540
           VVISAISNVSFQGIYQVLHQPAFLDNSLWCSAFATSVGIILGVFIPIFDRYSVQWLCLRL
Sbjct: 481 VVISAISNVSFQGIYQVLHQPAFLDNSLWCSAFATSVGIILGVFIPIFDRYSVQWLCLRL 540

Query: 541 VEELSDYWSRIATLFITLHALLFTSNSFTIWEDRIVAFLLTTFGMLTLYEFAFLPQRHST 600
           VEELSDYWSRIATLFITLHALLFTSNSFTIWEDRIVAFLLTTFGMLTLYEFAFLPQRHST
Sbjct: 541 VEELSDYWSRIATLFITLHALLFTSNSFTIWEDRIVAFLLTTFGMLTLYEFAFLPQRHST 600

Query: 601 AAILSGAGEKQGTLSGKSVGESNSDSLPLGRFARILGGYHSIVLVLCTRLSSMITICREE 660
           AAILSGAGEKQGTLSGKSVGESNSDSLPLGRFARILGGYHSIVLVLCTRLSSMITICREE
Sbjct: 601 AAILSGAGEKQGTLSGKSVGESNSDSLPLGRFARILGGYHSIVLVLCTRLSSMITICREE 660

Query: 661 QGPYCTPTFTISNNYSYYTMLGCLFLIPAIPSCIKGYYNVCSSYQAAAPIWIGLILKGSL 720
           QGPYCTPTFTISNNYSYYTMLGCLFLIPAIPSCIKGYYNVCSSYQAAAPIWIGLILKGSL
Sbjct: 661 QGPYCTPTFTISNNYSYYTMLGCLFLIPAIPSCIKGYYNVCSSYQAAAPIWIGLILKGSL 720

Query: 721 FASFTYWSLLTIENKFEDLAWDLTIWKYTISRIIVGISLIACNIGWMKGPLCVKLNIHNT 780
           FASFTYWSLLTIENKFEDLAWDLTIWKYTISRIIVGISLIACNIGWMKGPLCVKLNIHNT
Sbjct: 721 FASFTYWSLLTIENKFEDLAWDLTIWKYTISRIIVGISLIACNIGWMKGPLCVKLNIHNT 780

Query: 781 DLKSQQATILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLSIFLMCNQLLSIIEICDLL 840
           DLKSQQATILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLSIFLMCNQLLSIIEICDLL
Sbjct: 781 DLKSQQATILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLSIFLMCNQLLSIIEICDLL 840

Query: 841 KVKESLIGPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTEKIIFPWTHLGIVLNTFGP 900
           KVKESLIGPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTEKIIFPWTHLGIVLNTFGP
Sbjct: 841 KVKESLIGPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTEKIIFPWTHLGIVLNTFGP 900

Query: 901 FILVALSVALLTLWKQPPSVLQPQTILARIVSNSGTLLIYNSVLCLSSFVWVTHFRRHLM 960
           FILVALSVALLTLWKQPPSVLQPQTILARIVSNSGTLLIYNSVLCLSSFVWVTHFRRHLM
Sbjct: 901 FILVALSVALLTLWKQPPSVLQPQTILARIVSNSGTLLIYNSVLCLSSFVWVTHFRRHLM 960

Query: 961 VWKIFCPRFLFASLCLIVSQLVVTFITIGF 990
           VWKIFCPRFLFASLCLIVSQLVVTFITIGF
Sbjct: 961 VWKIFCPRFLFASLCLIVSQLVVTFITIGF 990

>AGR126C [4437] [Homologous to ScYLL031C (GPI13) - SH]
           (989241..992282) [3042 bp, 1013 aa]
          Length = 1013

 Score = 1289 bits (3335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/991 (64%), Positives = 782/991 (78%), Gaps = 17/991 (1%)

Query: 13  ERIRLSIMGPQTRSSRMS-YRISRFKSTHTXXXXXXXXXXXXQFISIAFFAKGFLLTRTV 71
           E ++ S++       R++  RI RF++THT            QFI+IAFF +GFLL+R V
Sbjct: 12  ELLKQSVLNNDEDDRRLTKLRIERFRTTHTLYIFLYSALAALQFIAIAFFTRGFLLSRKV 71

Query: 72  LDNVAELDPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYNPNYHNNLKVLYETAHN 131
           LD+VA  D      AK+D++VLL+VDALRFDFVIPVD     YN +YHN+L+ LYE    
Sbjct: 72  LDDVANRDESTA-PAKFDRLVLLVVDALRFDFVIPVDVAAEGYNSHYHNHLRALYE---R 127

Query: 132 STDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGDVIDEDNLIKQLYLHNKKI 191
             +S+LLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNG VIDE  +IKQ+ L NK I
Sbjct: 128 WDESILLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGIVIDEGYIIKQMCLINKTI 187

Query: 192 FFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISYLEEYYFNE-EKRSEYDILI 250
           +FAGDDTWDALF+PYL+  S+PYESLNVWDLDTVDNGVIS+ E++  N   ++ E+D+L+
Sbjct: 188 YFAGDDTWDALFHPYLSNVSMPYESLNVWDLDTVDNGVISFFEDHLLNNPTEKKEWDVLV 247

Query: 251 GHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTADDNTLYVVMGDHGMDHTGNHGG 310
           GHMLG+DHVGHKYGP+HF+M EKQ QVD  +R+II   D++TL VVMGDHGMDHTGNHGG
Sbjct: 248 GHMLGIDHVGHKYGPSHFSMAEKQSQVDGFIRQIIDAVDEDTLLVVMGDHGMDHTGNHGG 307

Query: 311 DSQDELESVLWLYAKN-ANWSKDY-DSYNTTDLGTSYKQMNQIDLVPTLSLLLGIPIPFN 368
           DS  ELES LWLY K    W +    +YNTT+LG  Y+ +NQIDLVP+LSLLLG+PIPFN
Sbjct: 308 DSPAELESTLWLYTKRPGTWRRQAPAAYNTTELGRYYRAVNQIDLVPSLSLLLGLPIPFN 367

Query: 369 NLGWPLDEIANDPEELTLYHNICRNQLEKYLSVSNIIGATARRDALISVE--------NH 420
           NLGWP++E+A+D +E  L+      QLE Y + SN I  +++   L  ++        + 
Sbjct: 368 NLGWPIEELAHDDDEWRLFTRQTLMQLETYRNTSNSITDSSKLKILEELKINANSNSSDA 427

Query: 421 PEFQQMFLEICKDLWARFDFTSICVGIALMAFSXXXXXXXXXXXPSIVVGQMVGDFVGCV 480
             +Q + LE+ KDLWARFD+ SI  GI L+  S           PSIVVGQM+ + V  +
Sbjct: 428 GNYQAILLEMYKDLWARFDYYSIGTGIILLIISLAMLITITRLIPSIVVGQMLSELVPTI 487

Query: 481 VVISAISNVSFQGIYQVLHQPAFLDNSLWCSAFATSVGIILGVFIPIFDRYSVQWLCLRL 540
           +V+  +SNV F G++ VL QPAFL N LW S  AT+VGII+G ++PIFDRY++ WL LR 
Sbjct: 488 IVMPLVSNVCFLGVFYVLRQPAFLQNWLWASLLATAVGIIIGFYVPIFDRYNLTWLVLRF 547

Query: 541 VEELSDYWSRIATLFITLHALLFTSNSFTIWEDRIVAFLLTTFGMLTLYEFAFLPQRHST 600
            EELSDYWSR+A   ITLHAL+FTSNSFTIWED+IV+F LTT GMLTLYEF FLP+RHST
Sbjct: 548 GEELSDYWSRVAAFLITLHALIFTSNSFTIWEDKIVSFSLTTLGMLTLYEFVFLPKRHST 607

Query: 601 AAILSGA-GEKQGTLSGKSVGESNSDSLPLGRFARILGGYHSIVLVLCTRLSSMITICRE 659
           +AIL+ A GEK+GT+SG S G++NSDSLPLGRFARI+GGYHSIVL++CTRL+S+ITICRE
Sbjct: 608 SAILAAALGEKEGTVSGISSGQANSDSLPLGRFARIVGGYHSIVLIVCTRLASLITICRE 667

Query: 660 EQGPYCTPTFTISNNYSYYTMLGCLFLIPAIPSCIKGYYNVCSSYQAAAPIWIGLILKGS 719
           EQG YCTPTFT++NNYS+  MLGCLFL+ A P+CIKGYYNV SSYQAAAPIWIG+++K  
Sbjct: 668 EQGAYCTPTFTLTNNYSFSVMLGCLFLVFATPACIKGYYNVSSSYQAAAPIWIGMLMKSI 727

Query: 720 LFASFTYWSLLTIENKFEDLAWDLTIWKYTISRIIVGISLIACNIGWMKGPLCVKLNIHN 779
           LF +F YW L T EN  +    +LTI+  TISRI+VG+SL+A NIGWM GPLC+KLN+HN
Sbjct: 728 LFVNFIYWELKTFENTSDTHGLNLTIFNLTISRIVVGVSLVAANIGWMMGPLCIKLNVHN 787

Query: 780 TDLKSQQATILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLSIFLMCNQLLSIIEICDL 839
            D +SQQATILGY+N YG+QYFLLVINF M I+LFNKPL QLS+FLMCNQLLSI+EI DL
Sbjct: 788 NDRRSQQATILGYANAYGAQYFLLVINFFMCILLFNKPLAQLSLFLMCNQLLSILEIFDL 847

Query: 840 LKVKESLIGPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTEKIIFPWTHLGIVLNTFG 899
           LK+KE+LIGPVALGLL+YQQFFSTGHQATIP+VQWDMGFILTE+I FP+THLGIVLNTFG
Sbjct: 848 LKLKENLIGPVALGLLSYQQFFSTGHQATIPAVQWDMGFILTERITFPFTHLGIVLNTFG 907

Query: 900 PFILVALSVALLTLWKQPPSVLQPQTILARIVSNSGTLLIYNSVLCLSSFVWVTHFRRHL 959
           P IL  +SVALLTLWKQPP +L+  T+LAR+VSN G LLIY +VLCLS+F+WVT+FRRHL
Sbjct: 908 PHILCGISVALLTLWKQPPGILRANTLLARVVSNCGMLLIYQTVLCLSTFIWVTNFRRHL 967

Query: 960 MVWKIFCPRFLFASLCLIVSQLVVTFITIGF 990
           MVWKIFCPRF+FA+L LIV+QLV+TFITI F
Sbjct: 968 MVWKIFCPRFMFAALSLIVTQLVLTFITIAF 998

>CAGL0G04015g 379330..382389 highly similar to tr|Q07830 Saccharomyces
            cerevisiae YLL031c GPI13, start by similarity
          Length = 1019

 Score = 1277 bits (3304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/1008 (62%), Positives = 761/1008 (75%), Gaps = 29/1008 (2%)

Query: 7    DERDRAERIRLSIMGPQTRSSRM-SYRISRFKSTHTXXXXXXXXXXXXQFISIAFFAKGF 65
            DER     +R +++   +   R+   R+ +F  +H             QF++IAFFAKGF
Sbjct: 2    DER----VVRQAVLSTSSDEKRIYRSRMQKFSKSHALYVILLGALAFLQFVAIAFFAKGF 57

Query: 66   LLTRTVLDNVAEL-DPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYNPNYHNNLKV 124
            LL+RTVLDNV+   D  L  + K+DKMVLL+VDALRFDFV+PV  +H  YN N+HNNL V
Sbjct: 58   LLSRTVLDNVSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNENFHNNLDV 117

Query: 125  LYET-----------AHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGD 173
            LY T             NS  S+LLKF+ADPPTTTLQRLKGLTTGSLPTFIDAGSNF+G 
Sbjct: 118  LYNTWLSTRHGGRGGYSNSGSSILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGS 177

Query: 174  VIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISYL 233
            VI+EDNLIKQL+L NK + F GDDTWDALF+P+LA  S PY SLNVWDLDTVDNGVISY 
Sbjct: 178  VIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWDLDTVDNGVISYF 237

Query: 234  EEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTADDNTL 293
            + +  ++     +DIL+GHMLGVDHVGHKYGPNHFTM+EKQ QV+  +++II + D++TL
Sbjct: 238  KSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESIDNDTL 297

Query: 294  YVVMGDHGMDHTGNHGGDSQDELESVLWLYAKNAN-WSKDYDSYNTTDLGTSYKQMNQID 352
             VVMGDHGMDHTGNHGGDSQDELES L+ Y K  N W     +Y+  +L  +Y  +NQID
Sbjct: 298  LVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWKNQNGNYDIENLAQNYHSVNQID 357

Query: 353  LVPTLSLLLGIPIPFNNLGWPLDE-IANDPEELTLYHNICRNQLEKYLSVSNII------ 405
            LVPTLSLLL IP+PFNNLGWP+ E   N+ EEL    N+   QL++Y  V  +       
Sbjct: 358  LVPTLSLLLDIPVPFNNLGWPISEAFENEKEELAC-DNVVLQQLKRYADVMQLTYTEELE 416

Query: 406  --GATARRDALISVENHPEFQQMFLEICKDLWARFDFTSICVGIALMAFSXXXXXXXXXX 463
               +   R++   V    ++QQ FLE+CKD WARFD+ SI  G  L+  S          
Sbjct: 417  ETMSALWRNSTADVFAASQYQQKFLEVCKDKWARFDYWSIASGTILLTISLILLLSITKL 476

Query: 464  XPSIVVGQMVGDFVGCVVVISAISNVSFQGIYQVLHQPAFLDNSLWCSAFATSVGIILGV 523
             PSIVV QMV +FV  ++++S ISNV F GI+ V HQP FLDN  WC+ FA++VGII G 
Sbjct: 477  IPSIVVNQMVPEFVPWIIIMSLISNVCFHGIFYVFHQPVFLDNVWWCTLFASAVGIITGC 536

Query: 524  FIPIFDRYSVQWLCLRLVEELSDYWSRIATLFITLHALLFTSNSFTIWEDRIVAFLLTTF 583
             I IFDRYS  WL +++VE LSDYWSRI  +F+ +HA+LFTSNSFTIWEDRIVA +L TF
Sbjct: 537  SISIFDRYSFVWLVMKMVEILSDYWSRIGAMFVVIHAMLFTSNSFTIWEDRIVAIMLITF 596

Query: 584  GMLTLYEFAFLPQRHSTAAILSGA-GEKQGTLSGKSVGESNSDSLPLGRFARILGGYHSI 642
            GMLTLYEF FLP R ST+A+L+ A GEKQGT SG S   +NS++LPL RFAR+LG YHSI
Sbjct: 597  GMLTLYEFTFLPTRQSTSALLTAAIGEKQGTTSGVSQSTANSNNLPLTRFARLLGSYHSI 656

Query: 643  VLVLCTRLSSMITICREEQGPYCTPTFTISNNYSYYTMLGCLFLIPAIPSCIKGYYNVCS 702
            VL++ TR++S+ITICREEQG YCTPTFT  NNY+++ +  CL ++  +P CIKGYYN+ S
Sbjct: 657  VLIVSTRVASVITICREEQGEYCTPTFTTKNNYAWWCLGLCLLIVILLPICIKGYYNLSS 716

Query: 703  SYQAAAPIWIGLILKGSLFASFTYWSLLTIENKFEDLAWDLTIWKYTISRIIVGISLIAC 762
            SYQAAAPIW+ + LKG+LF +F YWS+  +EN  E L WD    K TI+RII G SLIA 
Sbjct: 717  SYQAAAPIWVDMFLKGALFVNFLYWSITAVENSTESLEWDTKTVKITIARIIAGFSLIAT 776

Query: 763  NIGWMKGPLCVKLNIHNTDLKSQQATILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLS 822
            N+GWM GPLC+KLN+ N DLKS QATILGY+N+YGS++FLLVIN LMAIMLFNKPL QLS
Sbjct: 777  NVGWMMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQLS 836

Query: 823  IFLMCNQLLSIIEICDLLKVKESLIGPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTE 882
            +FLM NQ+LSI EI DLLK+KE+++GP+ALGL+AYQQFFSTGHQATIPSVQWD+GFIL++
Sbjct: 837  LFLMVNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILSD 896

Query: 883  KIIFPWTHLGIVLNTFGPFILVALSVALLTLWKQPPSVLQPQTILARIVSNSGTLLIYNS 942
            KIIFP+THLGI+LNTFGP I+V+LSVALLTLW QPP VL+PQT+L RIVSN G LL YN+
Sbjct: 897  KIIFPFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGVLLTYNT 956

Query: 943  VLCLSSFVWVTHFRRHLMVWKIFCPRFLFASLCLIVSQLVVTFITIGF 990
            VLCLSSF+WVTHFRRHLMVWKIFCPRF+FA L LIV QLV+TF TIGF
Sbjct: 957  VLCLSSFIWVTHFRRHLMVWKIFCPRFIFACLSLIVMQLVITFGTIGF 1004

>Scas_604.6
          Length = 1011

 Score = 1226 bits (3173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1002 (60%), Positives = 766/1002 (76%), Gaps = 25/1002 (2%)

Query: 7   DERDRAERIRLSIMGPQTRSSRM-SYRISRFKSTHTXXXXXXXXXXXXQFISIAFFAKGF 65
           DER     I+ SI+       R+   RI +F+ +HT            QFI+IAFF KGF
Sbjct: 2   DER----VIKQSILSTSADEKRIYRSRIQKFRKSHTLYVLLLGSLAALQFIAIAFFLKGF 57

Query: 66  LLTRTVLDNVAELDPQLPFE--AKYDKMVLLIVDALRFDFVIPVDENHAKYNPNYHNNLK 123
           LLTR VLDNVA L      E   K++K V+L+VDALRFDFVIPV++++  YN  YHNNLK
Sbjct: 58  LLTRNVLDNVATLADYQSIENYGKFNKSVILVVDALRFDFVIPVNQSNPDYNDYYHNNLK 117

Query: 124 VLYETAHNSTDSVLL--KFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGDVIDEDNLI 181
           VLYE   + + S  L  KF+ADPPTTTLQRLKGLTTGSLPTFIDAGSNF+G VI+EDN+I
Sbjct: 118 VLYEKFEDQSSSSSLLLKFMADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGSVIEEDNII 177

Query: 182 KQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISYLEEYYFNEE 241
           KQ++L++K++ F GDDTWDALFNP+L+P S P+ESLNVWDLDTVDNGVIS+  ++     
Sbjct: 178 KQMFLNDKQVLFVGDDTWDALFNPFLSPMSQPFESLNVWDLDTVDNGVISFFNDHLLENT 237

Query: 242 KRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTADDNTLYVVMGDHG 301
               +++LIGHMLG+DHVGHK+GPNHFTMK+KQLQ+D+ +R+I+ + DD+TL V+MGDHG
Sbjct: 238 NDQSWNVLIGHMLGMDHVGHKFGPNHFTMKQKQLQIDKFIREIMDSIDDDTLLVIMGDHG 297

Query: 302 MDHTGNHGGDSQDELESVLWLYAKNAN-WS-KDYDSYNTTDLGTSYKQMNQIDLVPTLSL 359
           MDHTGNHGGDS+DELES L+LY+K  N W+ +D  +Y+T + G  Y+ +NQIDLV TLS 
Sbjct: 298 MDHTGNHGGDSKDELESTLFLYSKRNNAWNLQDTSNYDTRNQGDRYRSVNQIDLVSTLSF 357

Query: 360 LLGIPIPFNNLGWPLDEIANDPEELTLYHNICRNQLEKYLSVSNIIGATARRDAL----- 414
           LLG+PIPFNNLGWP++EI    +E + + N    QL  Y   +  IG     ++L     
Sbjct: 358 LLGLPIPFNNLGWPINEIFCTEKEASSFTNAALKQLRTY---TEAIGIKINNESLLEELY 414

Query: 415 -ISVENHP---EFQQMFLEICKDLWARFDFTSICVGIALMAFSXXXXXXXXXXXPSIVVG 470
            I + NH    ++Q   L+I K LW  FD+ SI  G+ L+  S           PSIVV 
Sbjct: 415 QIGLANHERAQKYQIQLLQIFKTLWTNFDYYSIATGVCLLTVSVILLISVTNLIPSIVVN 474

Query: 471 QMVGDFVGCVVVISAISNVSFQGIYQVLHQPAFLDNSLWCSAFATSVGIILGVFIPIFDR 530
           QMV +F   +V++S  +NV F G Y V HQP F++N +WC+ FAT++GII+G  IPIFDR
Sbjct: 475 QMVPEFAPWIVIMSLTTNVCFHGFYYVFHQPLFINNWIWCTLFATAIGIIIGCCIPIFDR 534

Query: 531 YSVQWLCLRLVEEL-SDYWSRIATLFITLHALLFTSNSFTIWEDRIVAFLLTTFGMLTLY 589
           Y+++WL  R+ ++L SDYWSR+  LF+ LH+LLFTSNSFTIWED+IV FLL TFG+LTLY
Sbjct: 535 YTLKWLISRVFQDLLSDYWSRVGALFLILHSLLFTSNSFTIWEDKIVTFLLITFGVLTLY 594

Query: 590 EFAFLPQRHSTAAILSGA-GEKQGTLSGKSVGESNSDSLPLGRFARILGGYHSIVLVLCT 648
           EF FLP R  T+ +L+    E +GT SG +   +NS+SLPL RFAR+LGGYHSI+L++CT
Sbjct: 595 EFVFLPNRQYTSRLLTATISENEGTTSGVNSSTANSNSLPLTRFARLLGGYHSIMLIVCT 654

Query: 649 RLSSMITICREEQGPYCTPTFTISNNYSYYTMLGCLFLIPAIPSCIKGYYNVCSSYQAAA 708
           RL+S+ITICREEQG YCTPTFT  NNYS + +  C  LI  IP+CIKGYYN+ SSYQAAA
Sbjct: 655 RLASLITICREEQGDYCTPTFTTKNNYSLWCLSICFLLIFMIPACIKGYYNLSSSYQAAA 714

Query: 709 PIWIGLILKGSLFASFTYWSLLTIENKFEDLAWDLTIWKYTISRIIVGISLIACNIGWMK 768
           PIWI + LKG LF +F YW+  ++EN   + ++DLTI+K+TI+RI+ G SLIA N+GW+ 
Sbjct: 715 PIWIDIFLKGVLFINFAYWTATSLENTLPEWSYDLTIFKFTIARIVTGFSLIASNVGWLM 774

Query: 769 GPLCVKLNIHNTDLKSQQATILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLSIFLMCN 828
           GPLC+KLNIHNTD+KS QATILGY+N+YGS+YFLLVIN++M+I++F KPL Q+SIFLMCN
Sbjct: 775 GPLCIKLNIHNTDVKSHQATILGYTNIYGSEYFLLVINWIMSIIIFMKPLAQISIFLMCN 834

Query: 829 QLLSIIEICDLLKVKESLIGPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTEKIIFPW 888
           Q+LSI+EI DLLK+KE++IGP+ L LL+YQQ+FSTGHQATIPS+QWD+GFIL++KI FP 
Sbjct: 835 QILSILEIIDLLKLKENIIGPIVLALLSYQQYFSTGHQATIPSIQWDVGFILSDKITFPL 894

Query: 889 THLGIVLNTFGPFILVALSVALLTLWKQPPSVLQPQTILARIVSNSGTLLIYNSVLCLSS 948
           TH+ + LNTFGP IL+ALSVALLTLWKQPP VL+PQTIL RIVSN G L++YNS+LCLSS
Sbjct: 895 THISLALNTFGPQILIALSVALLTLWKQPPDVLKPQTILGRIVSNCGVLILYNSILCLSS 954

Query: 949 FVWVTHFRRHLMVWKIFCPRFLFASLCLIVSQLVVTFITIGF 990
           F+WVTHFRRHLMVWKIFCPRFLFA + LIV+Q++VTF+TI F
Sbjct: 955 FIWVTHFRRHLMVWKIFCPRFLFACMSLIVTQIIVTFVTIAF 996

>YLL031C (GPI13) [3389] chr12 complement(77151..80204) Protein
            involved in glycosylphosphatidylinositol biosynthesis,
            probably responsible for adding phosphoethanolamine to
            the third mannose [3054 bp, 1017 aa]
          Length = 1017

 Score = 1202 bits (3111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/983 (59%), Positives = 747/983 (75%), Gaps = 28/983 (2%)

Query: 32   RISRFKSTHTXXXXXXXXXXXXQFISIAFFAKGFLLTRTVLDNVAELDPQLPFEAKYDKM 91
            RI +F+  H             QFISIAFF +GFLL+R VLDN++  +       +++K 
Sbjct: 24   RIKKFQKNHKFYIILLVFIAILQFISIAFFTRGFLLSRHVLDNISSQNETSKLPPRFNKA 83

Query: 92   VLLIVDALRFDFVIPVDENHAKYNPNYHNNLKVLYETAHNSTD--SVLLKFLADPPTTTL 149
            V+L++DALRFDF IPV+E+H+ YN NYHNN+  LY++  +  D  S+LLKF+ADPPTTTL
Sbjct: 84   VILVIDALRFDFAIPVNESHSNYNLNYHNNILSLYDSFASDKDASSLLLKFIADPPTTTL 143

Query: 150  QRLKGLTTGSLPTFIDAGSNFNGDVIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAP 209
            QRLKGLTTGSLPTFIDAGSNF+G VI+EDN +KQL+L NK + FAGDDTW ALF+P+L+ 
Sbjct: 144  QRLKGLTTGSLPTFIDAGSNFDGTVIEEDNFLKQLHLANKTVKFAGDDTWMALFHPFLSN 203

Query: 210  ESVPYESLNVWDLDTVDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFT 269
            +S P ESLNVWDLDTVDNGV+ Y  ++    ++  E+D++IGHMLG+DHVGHKYGP+HFT
Sbjct: 204  DSFPLESLNVWDLDTVDNGVMDYFHDHL---QQDKEWDVMIGHMLGIDHVGHKYGPDHFT 260

Query: 270  MKEKQLQVDELLRKIISTADDNTLYVVMGDHGMDHTGNHGGDSQDELESVLWLYAKNAN- 328
            M+EKQ+QVD+ +  I+ + DD+TL V++GDHGMDHTGNHGGDS DELES L+LY+K  + 
Sbjct: 261  MREKQIQVDQFIDWILKSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPDM 320

Query: 329  WS-KDYDSYNTTDLGTSYKQMNQIDLVPTLSLLLGIPIPFNNLGWPLDEIANDPEELTLY 387
            W  K+  +YN  +LG  Y+ + QIDLV +L+LL+G PIPFNNLGWP+DEIA +  E + +
Sbjct: 321  WRLKETSNYNIDNLGHDYRSVRQIDLVSSLALLMGQPIPFNNLGWPIDEIARNDREWSQF 380

Query: 388  HNICRNQLEKYLS---------------VSNIIGATARRDALISVENHPEFQQMFLEICK 432
             N   +QL+ Y                   NI       D    V+   ++Q++FL+ C+
Sbjct: 381  VNSAISQLQLYKDTMQIHHGNDEILEPLAKNISNTPPTSDPEKFVKLGHKYQKVFLQTCE 440

Query: 433  DLWARFDFTSICVGIALMAFSXXXXXXXXXXXPSIVVGQMVGDFVGCVVVISAISNVSFQ 492
            +LWA+FD+ SI  GI L+A S           PSIVV QMV +FV  ++++  ++N+ F 
Sbjct: 441  ELWAKFDYYSIATGITLLATSLVLLISITKLIPSIVVNQMVPEFVPGIIIMVLVTNLCFH 500

Query: 493  GIYQVLHQPAFLDNSLWCSAFATSVGIILGVFIPIFDRYSVQWLCLRLVEELSDYWSRIA 552
            GI+ V  QP+F+D   W +  AT++GII+G +I IFDRY+  W+ +RL E L+DYWSRIA
Sbjct: 501  GIFYVYQQPSFVDQ-FWGTLLATAIGIIIGCYITIFDRYNFIWIAMRLGETLADYWSRIA 559

Query: 553  TLFITLHALLFTSNSFTIWEDRIVAFLLTTFGMLTLYEFAFLPQRHSTAAILSGA-GEKQ 611
             +F+ +HALLFTSNSFTIWEDRIVAFLL+TFGMLTLYEF FLP+R ST A+L+    EK+
Sbjct: 560  VMFMIIHALLFTSNSFTIWEDRIVAFLLSTFGMLTLYEFVFLPKRQSTTALLTATISEKE 619

Query: 612  GTLSGKSVGESNSDSLPLGRFARILGGYHSIVLVLCTRLSSMITICREEQGPYCTPTFTI 671
            GT SG +   +NS+ LPL RFAR+LGGYHS VL++ TRL+SMITICREEQG YC PTF  
Sbjct: 620  GTTSGVNPSTANSNYLPLTRFARLLGGYHSAVLIIFTRLASMITICREEQGEYCIPTFNN 679

Query: 672  SNNYSYYTMLGCLFLIPAIPSCIKGYYNVCSSYQAAAPIWIGLILKGSLFASFTYWSLLT 731
             NN S++ +  C  +I  +P+CI GYYN+ SSYQAAAPIWI + LKG L  +F YWSL +
Sbjct: 680  QNNSSWWVLGLCFLMIFILPACITGYYNLTSSYQAAAPIWINVFLKGILGLNFVYWSLTS 739

Query: 732  IENKFEDLA----WDLTIWKYTISRIIVGISLIACNIGWMKGPLCVKLNIHNTDLKSQQA 787
            +EN    +A     D+TI+K+T++RII G SLIA N+GW+ GPLC+KLNIHNTD+KS +A
Sbjct: 740  LENNSAVIAIPFLRDVTIFKFTLARIIAGFSLIASNVGWLMGPLCIKLNIHNTDVKSHEA 799

Query: 788  TILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLSIFLMCNQLLSIIEICDLLKVKESLI 847
            TILGY+N+YGS++FLLVIN L++I+LFNKPL QLS FLMCNQLLSI+EI DLLK+KE++I
Sbjct: 800  TILGYTNIYGSEFFLLVINVLISILLFNKPLAQLSYFLMCNQLLSILEIIDLLKLKENII 859

Query: 848  GPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTEKIIFPWTHLGIVLNTFGPFILVALS 907
            GP+ALGLL+YQ FF+TGHQATIPSVQWD+GF+L+EK+ FP+T + I+LNTFGP ILV+LS
Sbjct: 860  GPIALGLLSYQHFFTTGHQATIPSVQWDIGFMLSEKVTFPFTQIAIILNTFGPHILVSLS 919

Query: 908  VALLTLWKQPPSVLQPQTILARIVSNSGTLLIYNSVLCLSSFVWVTHFRRHLMVWKIFCP 967
            VALLTLW QPP VL+PQT+L RIVSN G LL YN++LCLSSF+WVTHFRRHLMVWKIFCP
Sbjct: 920  VALLTLWSQPPDVLKPQTLLGRIVSNCGILLTYNTILCLSSFIWVTHFRRHLMVWKIFCP 979

Query: 968  RFLFASLCLIVSQLVVTFITIGF 990
            RF+FASL LIV+QLVVTF TI F
Sbjct: 980  RFIFASLSLIVTQLVVTFGTIAF 1002

>Kwal_55.20664
          Length = 179

 Score =  292 bits (748), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 158/167 (94%)

Query: 767 MKGPLCVKLNIHNTDLKSQQATILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLSIFLM 826
           M GPLCVKLNI N D+KSQQATILGY+NVYGSQ+FLLVINFLM IMLFNKP+ Q+S+FLM
Sbjct: 1   MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM 60

Query: 827 CNQLLSIIEICDLLKVKESLIGPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTEKIIF 886
           CNQLLS++EI DLLK+KE+LIGPVA+GLLAYQQFFSTGHQATIP+VQWD+GF+LTE+I F
Sbjct: 61  CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF 120

Query: 887 PWTHLGIVLNTFGPFILVALSVALLTLWKQPPSVLQPQTILARIVSN 933
           P+THLGIV+NTFGP ILVALSVALLTLWKQPPSVL+PQT+LARIVS 
Sbjct: 121 PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVST 167

>KLLA0F01705g complement(159469..161832) similar to sp|P40367
           Saccharomyces cerevisiae YJL062w LAS21 required for
           addition of a side chain to the
           glycosylphospatidylinositol (GPI) core structure, start
           by similarity
          Length = 787

 Score =  193 bits (491), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 186/347 (53%), Gaps = 43/347 (12%)

Query: 54  QFISIAFFAKGFLLTRTVLDNVAE--LDPQLPFEAK--YDKMVLLIVDALRFDFVIPVDE 109
           Q +++  F  GF   + VL N ++  ++P++   +K  + K+VL+++DALR DF+   D 
Sbjct: 13  QLVAVFLFCGGFFPQKVVLKNDSKFIVNPEVQLASKPVFKKLVLVVIDALRSDFLFQKDS 72

Query: 110 NHAKYNPNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSN 169
           +  ++     N+ +    TA+           ++PPT TL RLKG+TTGS P F+DA  N
Sbjct: 73  SDFEFLHGLLNSGEAWGYTAY-----------SNPPTVTLPRLKGITTGSAPNFLDAILN 121

Query: 170 FNGD-----VIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDT 224
              D     + ++D+L+KQ + H+ K+ F GDDTW  LF      E     S  V D + 
Sbjct: 122 VAEDDTSSNLKEQDSLLKQFHTHHYKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFEE 181

Query: 225 VDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKI 284
           VD  V  ++    +  E +  +D+LI H LG+DH+GHK G     M  K  ++D ++++I
Sbjct: 182 VDFNVTRHVP---YQMEHQKNWDVLILHYLGLDHIGHKGGSKSHFMPSKHREMDSVIKQI 238

Query: 285 ISTADDNTLYVVMGDHGMDHTGNHGGDSQDELESVLWLYAKNANWSKDYDSYNTTDLGTS 344
               D +TL VV+GDHGM+  GNHGG S  E  + L      A  SK    Y ++D+  S
Sbjct: 239 YEKIDGDTLMVVLGDHGMNDLGNHGGSSSGETSAAL------AFLSKRLKKYQSSDIQQS 292

Query: 345 --------------YKQMNQIDLVPTLSLLLGIPIPFNNLGWPLDEI 377
                          K++ QID+VPTLS+L  +PIP N++G  +DE+
Sbjct: 293 SNVPVEDAHPDYKYLKEVEQIDIVPTLSMLFNLPIPKNSMGVIIDEL 339

>Kwal_14.2587
          Length = 808

 Score =  190 bits (482), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 125/372 (33%), Positives = 197/372 (52%), Gaps = 39/372 (10%)

Query: 54  QFISIAFFAKGFLLTRTVLDNVAEL----DPQLPFEAKYDKMVLLIVDALRFDFVIPVDE 109
           Q ++I  F+ GF   ++VL   AE     D Q     K++K+VL+++DALR DFV   D 
Sbjct: 12  QLVAILTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDM 71

Query: 110 NHAKYNPNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSN 169
           ++ ++     N  +    TA+           ++PPT TL RLKG+TTGS P F+DA  N
Sbjct: 72  SNFEFVHGLLNRGQAWGYTAY-----------SNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 170 FNGD-----VIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDT 224
              D     + ++D+ ++Q +++NK+I F GDDTW  LF      E+    S  V D + 
Sbjct: 121 VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE 180

Query: 225 VDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKI 284
           VD  V  +L +    ++    +D+LI H LG+DH+GHK G     M  KQ ++DE++ ++
Sbjct: 181 VDFNVTRHLPKQLATQD---SWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQV 237

Query: 285 ISTADDNTLYVVMGDHGMDHTGNHGGDSQDE-------LESVLWLYAKNANWSKDYDSYN 337
            ++  ++TL  VMGDHGM+  GNHGG S  E       +  +L  Y K    + +     
Sbjct: 238 YNSVGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIK 297

Query: 338 TTDLGTSY-KQMNQIDLVPTLSLLLGIPIPFNNLGWPLDEIAN--DPEELTLYHNICRNQ 394
           T +   SY  ++NQIDLVP++S L   PIP N++G  + ++     P++  L        
Sbjct: 298 TKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQL------KL 351

Query: 395 LEKYLSVSNIIG 406
           ++ YL ++ I G
Sbjct: 352 MDNYLQLTTISG 363

>AEL166C [2340] [Homologous to ScYJL062W (LAS21) - SH]
           (322853..325273) [2421 bp, 806 aa]
          Length = 806

 Score =  189 bits (479), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 169/334 (50%), Gaps = 31/334 (9%)

Query: 54  QFISIAFFAKGFLLTRTVLDNVAEL----DPQLPFEAKYDKMVLLIVDALRFDFVIPVDE 109
           Q +++  FA GF   + VL   A+     + Q   E  +DK+VL+++DALR DF+   + 
Sbjct: 12  QLLAVLIFAAGFFPQKKVLKGDAQFQYMAETQRALEPAFDKLVLVVIDALRADFLFQQNV 71

Query: 110 NHAKYNPNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSN 169
           +H  +     N  +    TA+           ++PPT TL RLKG+TTGS P F+DA  N
Sbjct: 72  SHFDFVHELLNRGEAWGFTAY-----------SNPPTVTLPRLKGITTGSAPNFLDAILN 120

Query: 170 FNGD-----VIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDT 224
              D     + D+D+ I Q   H KKI F GDDTW  LF      +     S  V D + 
Sbjct: 121 VAEDDSSSNLKDQDSWISQFAKHGKKIHFFGDDTWLKLFPEEFFQKHDGTNSFFVSDFEE 180

Query: 225 VDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKI 284
           VD  V  +L     +E +  ++D+LI H LG+DH+GHK G     M  K  ++D ++R+I
Sbjct: 181 VDTNVTRHLP----HELQHKDWDVLILHYLGLDHIGHKGGAASQFMPPKHREMDAVIRQI 236

Query: 285 ISTADDNTLYVVMGDHGMDHTGNHGGDSQDE-------LESVLWLYAKNANWSKDYDSYN 337
               D+ TL  VMGDHGM+  GNHGG S  E       +  +L  Y + A          
Sbjct: 237 YDQVDNRTLLCVMGDHGMNDLGNHGGSSAGETSAGMVFISKMLSSYPRPAAQDGVSSPVT 296

Query: 338 TTDLGTSYKQMNQIDLVPTLSLLLGIPIPFNNLG 371
             +    + ++ Q+D VPT++ L  IPIP N+LG
Sbjct: 297 AAEDYQFFTRIQQVDFVPTIASLFNIPIPKNSLG 330

>Scas_711.50
          Length = 831

 Score =  183 bits (465), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 170/328 (51%), Gaps = 32/328 (9%)

Query: 62  AKGFLLTRTVLDNVAEL----DPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYNPN 117
           A GF   + VL  +A+     + Q   +  + K+VL+++DALR DF+     +H  +  +
Sbjct: 21  AIGFFPQKNVLKGLADFHYNSEQQRETKPVFQKLVLVVIDALRSDFLFDETNSHFHFIHS 80

Query: 118 YHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGDVI-- 175
             N       TA+           ++PPT TL RLKG+TTGS P F+DA  N   D +  
Sbjct: 81  QLNEGTAWGFTAY-----------SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVST 129

Query: 176 ---DEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISY 232
              D+D+L+ Q +L NKKI F GDDTW  LF      E     S  V D + VD  V  +
Sbjct: 130 TLADQDSLLAQFHLQNKKINFFGDDTWLKLFPRDWFNEVEGTNSFFVSDFEVVDTNVSRH 189

Query: 233 LEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTADDNT 292
           L +     +   ++D+LI H LG+DH+GHK G +   M EK +++D ++R++    DD+T
Sbjct: 190 LTK---QLKHNHDWDVLIMHYLGLDHIGHKDGASSKFMPEKHIEMDNIVRQVYENIDDDT 246

Query: 293 LYVVMGDHGMDHTGNHGGDSQDELESVLWLYAKNANWSK--------DYDSYNTTDLGTS 344
           L VVMGDHGM+  GNHGG S  E  + L   +      +        +      TD    
Sbjct: 247 LLVVMGDHGMNEVGNHGGSSAGETSAGLVFLSNKLKKGELPLKQRHLNLPIKRQTDENFQ 306

Query: 345 Y-KQMNQIDLVPTLSLLLGIPIPFNNLG 371
           +   + QIDLVPTL+ L  IPIP NN+G
Sbjct: 307 FLTSVQQIDLVPTLATLFNIPIPKNNVG 334

>YJL062W (LAS21) [2849] chr10 (317200..319692) Protein required for
           addition of a side chain to the
           glycosylphosphatidylinositol (GPI) core structure [2493
           bp, 830 aa]
          Length = 830

 Score =  181 bits (458), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 175/341 (51%), Gaps = 36/341 (10%)

Query: 54  QFISIAFFAKGFLLTRTVLDNVAELDPQ----LPFEAKYDKMVLLIVDALRFDFVIPVDE 109
           Q ++I  F   F   + VL  +++ DP     L  +  + K+V +I+DALR DF+   D 
Sbjct: 13  QLLAILLFIFAFFPRKIVLTGISKQDPDQDRDLQRDRPFQKLVFVIIDALRSDFLF--DS 70

Query: 110 NHAKYNPNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSN 169
             + +N N H  L       + S         A+PPT TL RLK +TTGS P+FID   N
Sbjct: 71  QISHFN-NVHQWLNTGEAWGYTS--------FANPPTVTLPRLKSITTGSTPSFIDLLLN 121

Query: 170 F-----NGDVIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDT 224
                 + D+ + D+ ++Q   HN  I F GDDTW  LF       + P  S  V D   
Sbjct: 122 VAQDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQ 181

Query: 225 VDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKI 284
           VDN V   L    F E   +++D+ I H LG+DH+GHK GP+   M  K  ++D +L+ I
Sbjct: 182 VDNNVTRNLPGKLFQE--WAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSI 239

Query: 285 ISTA-----DDNTLYVVMGDHGMDHTGNHGGDSQDELES-VLWLYAKNANWSKDYDSYNT 338
                    DD+TL  V+GDHGM+  GNHGG S  E  + +L+L  K A +++     N 
Sbjct: 240 YDEVLEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNY 299

Query: 339 T-------DLGTSY-KQMNQIDLVPTLSLLLGIPIPFNNLG 371
           T       D    Y + + QID+VPT++ L G+PIP N++G
Sbjct: 300 TLPINASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVG 340

>CAGL0J05236g complement(502420..504948) similar to sp|P40367
           Saccharomyces cerevisiae YJL062w LAS21, hypothetical
           start
          Length = 842

 Score =  162 bits (411), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 129/373 (34%), Positives = 185/373 (49%), Gaps = 47/373 (12%)

Query: 56  ISIAFFAKGFLLTRTVLDNVAELDPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYN 115
           I++  F  GF   + VLD  A LD     +  +DK+V+++VDA+R DF+     +   + 
Sbjct: 11  IAVLIFGCGFFPQKKVLDGHAALDGTHARDPVFDKLVVVVVDAMRSDFLFDASISKFHFI 70

Query: 116 PNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGDVI 175
                +      TAH           ++PPT TL RLKG+TTGS P F+DA  N   D  
Sbjct: 71  HEKLADGSAWGFTAH-----------SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDT 119

Query: 176 DEDNLIKQLYL------HNKKIFFAGDDTWDALFNPYLAPESV-----PYESLN---VWD 221
               L +  +L        K+I F GDDTW  LF P  A E        YE  N   V D
Sbjct: 120 SSSLLAQDSWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQTMFDEYEGTNSFFVSD 179

Query: 222 LDTVDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELL 281
              VD  V  +++       + SE+D+LI H LG+DH+GHK GP    M  K  ++D ++
Sbjct: 180 FTQVDLNVTRHIDR---QLRETSEWDVLILHYLGLDHIGHKDGPYSRFMGPKHEEMDSII 236

Query: 282 RKIISTAD-DNTLYVVMGDHGMDHTGNHGGDSQDE-------LESVLWLY--AKNANWSK 331
           RK+    D  +TL V+MGDHGM+  GNHGG S  E       L   L  Y  +K  + +K
Sbjct: 237 RKLYDELDMQSTLLVLMGDHGMNDLGNHGGSSAGETSAGMVFLSDKLAAYKPSKEQSSAK 296

Query: 332 DY----DSYNTTDLGTSY--KQMNQIDLVPTLSLLLGIPIPFNNLGWPLDEIANDPEELT 385
           ++     S N  +  T +  K++ QID+VPT+S L  + IP NN+G  + E     ++++
Sbjct: 297 EFPMKIPSLNAGEEKTFHYLKKIQQIDVVPTISSLFNVAIPKNNVGVIIPEFLQLFKDVS 356

Query: 386 LYHNICR---NQL 395
           L   I +   NQL
Sbjct: 357 LQKAIVKENWNQL 369

>Scas_689.28
          Length = 924

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 80/176 (45%), Gaps = 16/176 (9%)

Query: 239 NEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIIST-----ADDNTL 293
           + E R E ++   H+LG D  GH Y P      +    +DE +  ++        DD+T 
Sbjct: 206 DHEIRQEGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSILVDKVHTFFGDDDTA 265

Query: 294 YVVMGDHGMDHTGNHGGDSQDELES--VLWLYAKN---ANWSKDYDSYNTTDLGTSYKQ- 347
           ++   DHGM   G+HG    +   +  V W    N    N    YD+Y  +      K+ 
Sbjct: 266 FIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVKNEVPIYDNYTESWKLADIKRN 325

Query: 348 -MNQIDLVPTLSLLLGIPIPFNNLG-WPLDEIANDPE--ELTLYHNICRNQLEKYL 399
            + Q D+   +S L+G   P N++G  PL  I ND E  +L   +N  R+ LE+YL
Sbjct: 326 DVKQADITSLMSYLIGTNYPANSVGELPLAYI-NDEESQKLEALYNNARSILEQYL 380

>Kwal_33.13856
          Length = 922

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 81/179 (45%), Gaps = 18/179 (10%)

Query: 239 NEEKRSEY----DILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIIST-----AD 289
           NE  R E     ++   H+LG D  GH Y P      +    +D+ L K++        D
Sbjct: 202 NETLRQEITQSGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDQELSKLVVKVRDYFGD 261

Query: 290 DNTLYVVMGDHGMDHTGNHGGDSQDELESVLWLYAKNANWSKD-----YDSYNTT-DLGT 343
           D+T ++   DHGM   G+HG    +   + L  +    N         YD+Y    DL T
Sbjct: 262 DDTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVKNPVPIYDNYTEGWDLAT 321

Query: 344 SYKQ-MNQIDLVPTLSLLLGIPIPFNNLG-WPLDEI-ANDPEELTLYHNICRNQLEKYL 399
             +  + Q D+   +S L+G   P N++G  PL  I A++  +L   ++  R+ LE+Y+
Sbjct: 322 IQRNDVKQADIASLMSYLIGANYPANSVGELPLSYINASEETKLKALYSNARSILEQYV 380

>YKL165C (MCD4) [3105] chr11 complement(137937..140696) Protein
           required for glycosylphosphatidylinositol (GPI) anchor
           synthesis, has a role in modulating aminophospholipid
           metabolism [2760 bp, 919 aa]
          Length = 919

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 88/197 (44%), Gaps = 22/197 (11%)

Query: 225 VDNGVISYLEEYYFNE--------EKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQ 276
           +D  V  +L++ + N         E R + ++   H+LG D  GH Y P      +    
Sbjct: 184 LDAFVFRHLDQLFHNSTLNSTLDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKY 243

Query: 277 VDELLRKIIST-----ADDNTLYVVMGDHGMDHTGNHGGDSQDELES--VLWLYAKNANW 329
           +D+ +  +I       ADD T ++   DHGM   G+HG    +   +  V W    N   
Sbjct: 244 IDDQIPILIDKVNKFFADDKTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPV 303

Query: 330 SKDY---DSYNTTDLGTSYKQ--MNQIDLVPTLSLLLGIPIPFNNLG-WPLDEI-ANDPE 382
              +   D+Y      +S K+  + Q D+   +S L+G+  P N++G  P+  I   + +
Sbjct: 304 HNPFPVSDNYTENWELSSIKRNDVKQADIASLMSYLIGVNYPKNSVGELPIAYIDGKESD 363

Query: 383 ELTLYHNICRNQLEKYL 399
           +L   +N  R+ LE+YL
Sbjct: 364 KLAALYNNARSILEQYL 380

>AEL113C [2393] [Homologous to ScYKL165C (MCD4) - SH]
           (409096..411873) [2778 bp, 925 aa]
          Length = 925

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 87/200 (43%), Gaps = 19/200 (9%)

Query: 240 EEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIIST-----ADDNTLY 294
            E   + ++   H+LG D  GH Y P      +    +D  L +++        DD+T +
Sbjct: 207 HEMMQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDSQLERLVPKVREFFGDDDTAF 266

Query: 295 VVMGDHGMDHTGNHGGDSQDELES--VLWLYAKNANWSKD---YDSYNTT-DLGTSYKQ- 347
           V   DHGM   G+HG    +   +  V W    N     D   YD+Y    DL    +  
Sbjct: 267 VFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNRPVLNDVPVYDNYTENWDLAHVRRND 326

Query: 348 MNQIDLVPTLSLLLGIPIPFNNLG-WPLDEI-ANDPEELTLYHNICRNQLEKYLSVSNII 405
           +NQ D+   +S L+G+  P N++G  PL  +  ++  +L   +    + LE+YL     +
Sbjct: 327 VNQADIASLMSYLIGLNYPTNSVGELPLAYVNGSERTKLNALYKNALSILEQYL-----V 381

Query: 406 GATARRDALISVENHPEFQQ 425
             T    + +  + +P+F Q
Sbjct: 382 KETEMIQSQLVYKEYPKFAQ 401

>KLLA0B07249g complement(630336..633095) similar to sp|P36051
           Saccharomyces cerevisiae YKL165c MCD4 sporulation
           protein singleton, start by similarity
          Length = 919

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 92/206 (44%), Gaps = 22/206 (10%)

Query: 241 EKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIISTA-----DDNTLYV 295
           E + + ++   H+LG D  GH Y P      +    +D+ ++ ++        D++T ++
Sbjct: 207 EIKQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKEVKLLVEKVHEFFDDEDTAFI 266

Query: 296 VMGDHGMDHTGNHGGDSQDELES--VLWLYAKN---ANWSKDYDSY----NTTDLGTSYK 346
              DHGM   G+HG    +   +  V W    N    N +  +D+Y    N  D+  +  
Sbjct: 267 FTADHGMSAFGSHGDGHPNNTRTPLVAWGAGINKPVKNQAPIFDNYTENWNLADIKRN-- 324

Query: 347 QMNQIDLVPTLSLLLGIPIPFNNLG-WPLDEI-ANDPEELTLYHNICRNQLEKYLSVSNI 404
            +NQ D+   +S L+G   P N++G  PL+ I A + ++L    N  +  LE+YL     
Sbjct: 325 DVNQADIASLMSYLIGANYPVNSVGELPLNFIDAPEDKKLNALFNNAKAILEQYLVKEQE 384

Query: 405 IGAT----ARRDALISVENHPEFQQM 426
           I A+       +A + +      QQ+
Sbjct: 385 IIASQFVYKEYEAFVEIPYQEYLQQI 410

>CAGL0M08448g complement(841439..844204) highly similar to sp|P36051
           Saccharomyces cerevisiae YKL165c sporulation protein,
           start by similarity
          Length = 921

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 84/201 (41%), Gaps = 22/201 (10%)

Query: 225 VDNGVISYLEEYYFNEEKRSEYDILIG--------HMLGVDHVGHKYGPNHFTMKEKQLQ 276
           +D  V  +L++ + N     E D  I         H+LG D  GH Y P      +  + 
Sbjct: 184 LDAYVFRHLDQLFKNSSTDKELDKQIRQDGNAFFLHLLGCDTAGHSYRPYSAEYYDNVIY 243

Query: 277 VDELLRKIIST-----ADDNTLYVVMGDHGMDHTGNHGGDSQDELESVLWLYAKNANW-- 329
           +D+ + K++        D++T ++   DHGM   G+HG    +   + L  +    N   
Sbjct: 244 IDKQVEKLVKQVEEFFGDNDTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNRPV 303

Query: 330 ---SKDYDSY--NTTDLGTSYKQMNQIDLVPTLSLLLGIPIPFNNLG-WPLDEI-ANDPE 382
              + ++D Y  N          + Q D+   +S L+G   P N++G  PL  I  ++ +
Sbjct: 304 RLDTPEFDEYTENWNLANIKRNDVKQADIAALMSYLIGTNYPANSVGELPLAYIEGSEGQ 363

Query: 383 ELTLYHNICRNQLEKYLSVSN 403
           +L    N   + LE+Y    N
Sbjct: 364 KLEALLNNAESILEQYRVKEN 384

>KLLA0A11374g complement(985471..987336) some similarities with
           sp|P25353 Saccharomyces cerevisiae YCR026c, hypothetical
           start
          Length = 621

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 256 VDHVGHKYGPNHFTMKEKQL-QVDELLRKIISTADDNTLYVVMGDHGM 302
           VD +GHKYG    +   K L +VD+ L ++ +  D+N   +V+ DHGM
Sbjct: 303 VDTMGHKYGNLIDSGHSKVLKEVDDFLEQLFADVDENVNILVISDHGM 350

>KLLA0F11935g 1095626..1097038 similar to sgd|S0002512 Saccharomyces
           cerevisiae YDR105c, start by similarity
          Length = 470

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 641 SIVLVLCTRLSSMITICREEQGPYCTPTFTISNNYSYYTMLGCLFLIPAI 690
           S+V V CT L+ M  +  E    +C P    SN   + T+LG LF   AI
Sbjct: 260 SMVSVYCTYLT-MSAMASEPDDKFCNPLVRTSNTRKFSTVLGALFTFIAI 308

>AEL259W [2247] [Homologous to ScYPR167C (MET16) - SH]
           complement(151093..151890) [798 bp, 265 aa]
          Length = 265

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 566 NSFTIWE-DRIVAFLLTT---FGMLTLYEFAFLPQRHSTAAILSGAGEKQGTLSGKSVGE 621
           N F  W  D++ +++L     +  L  Y +  +   HST  ++ GAGE+ G   GK+  E
Sbjct: 189 NPFVTWSFDQVWSYILDNRIPYNELLNYGYKSIGDYHSTLPVVDGAGERSGRWKGKAKTE 248

Query: 622 SNSDSLPLGRFARIL 636
               +    ++AR L
Sbjct: 249 CGLHT--ASKYARYL 261

>Kwal_14.2574
          Length = 443

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 51/112 (45%), Gaps = 14/112 (12%)

Query: 181 IKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISYLEEYYFNE 240
           ++Q Y++  KIF      +D L  PY  PE   +  ++   +   DN        Y F E
Sbjct: 328 MRQEYINKFKIF---TRVFDELGLPYTEPEGTYFVLVDFSKVKIPDN--------YPFPE 376

Query: 241 EKRSE-YDILIGHMLGVDHVGH-KYGPNHFTMKEKQLQVDELLRKIISTADD 290
           E RS+  D  I + L V+ +G     P  F +KE +   + LLR  +  +D+
Sbjct: 377 ELRSKGKDFRISYWL-VNELGVVAIPPTEFYIKEHEKVAENLLRFAVCKSDE 427

>AFR307C [3499] [Homologous to ScYGR128C - SH] (997175..999127)
           [1953 bp, 650 aa]
          Length = 650

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 58/138 (42%), Gaps = 10/138 (7%)

Query: 318 SVLWLYAKNANWSKDYD----SYNTTDLGTSYKQMNQIDLVPTLSLLLGIPIPFNNLGWP 373
           S L  YA+  ++ +  D    + NT  +G S   ++Q  + PT  L+  IPIP  N+   
Sbjct: 17  SSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTPKLVYNIPIPSTNVVTG 76

Query: 374 LDEIA-NDPEELTLYHNICRNQLEKYLSVSNIIGATARRDALISVENHPEFQQMFLEICK 432
            D +A +D  EL  Y      ++    +V    GA  +   L + E+     + F +  K
Sbjct: 77  CDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDASED-----EHFKQTLK 131

Query: 433 DLWARFDFTSICVGIALM 450
               R    S C  I ++
Sbjct: 132 GRVVRVRILSACKRIMVV 149

>Kwal_27.10945
          Length = 935

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 13/83 (15%)

Query: 794 NVYGSQYFLLVINFLMAIMLFNKPLGQLSIFLMCNQLLSIIEICDLLKVKESLIGPVALG 853
           N Y S+   L+I     IML   P  + +I+ + + L      C +LKVK  L     LG
Sbjct: 335 NNYSSKLINLII-----IMLAENPNLRPNIYQVMDNL------CSILKVKNPLEDKYQLG 383

Query: 854 LLAYQQFFSTGHQATIPSVQWDM 876
             +++++  + +QA +  VQ+ M
Sbjct: 384 SYSFEKY--SQYQAKLQKVQYQM 404

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.140    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 32,624,971
Number of extensions: 1470415
Number of successful extensions: 4746
Number of sequences better than 10.0: 30
Number of HSP's gapped: 4823
Number of HSP's successfully gapped: 30
Length of query: 990
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 879
Effective length of database: 12,753,511
Effective search space: 11210336169
Effective search space used: 11210336169
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)