Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17512g89286742130.0
Scas_707.4492978333180.0
CAGL0K02431g92478333030.0
ADL026W88878432990.0
Kwal_14.217590978332940.0
YPR019W (CDC54)93378332890.0
ADR041W8136149481e-114
Scas_590.67677289411e-114
CAGL0J06424g9725799471e-113
KLLA0E23276g8265709321e-112
Kwal_47.1896610445779281e-110
AGR276W7346909051e-109
KLLA0F10087g10035839171e-108
YGL201C (MCM6)10175849171e-108
Scas_712.4910195839111e-107
CAGL0F04939g7727368941e-107
AFR546W10055809051e-107
Kwal_56.232827617228851e-106
CAGL0M05423g8125268811e-105
Scas_721.368555238821e-105
KLLA0D09262g7466778651e-103
Kwal_27.120028335858701e-103
YLR274W (CDC46)7757748561e-102
Sklu_2098.48466048571e-101
KLLA0E22330g9315848521e-100
Sklu_1863.19545878476e-99
Scas_710.218746638401e-98
YBR202W (CDC47)8455268372e-98
YBL023C (MCM2)8686638349e-98
AFR178W8856518332e-97
Kwal_27.101749455888301e-96
KLLA0F12584g8776558261e-96
Sklu_2087.48846568192e-95
CAGL0J04444g8796568155e-95
Kwal_14.20908606528092e-94
AFR355C9435868002e-92
Scas_499.29855917971e-91
YEL032W (MCM3)9715877583e-86
CAGL0L01397g9454877255e-82
KLLA0E14278g473124712.7
CAGL0M03707g165928704.0
YHR004C (NEM1)44647677.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17512g
         (879 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17512g complement(1537707..1540385) similar to sp|P30665 S...  1627   0.0  
Scas_707.44                                                          1282   0.0  
CAGL0K02431g complement(219027..221801) highly similar to sp|P30...  1276   0.0  
ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH] complement...  1275   0.0  
Kwal_14.2175                                                         1273   0.0  
YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved i...  1271   0.0  
ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH] complement...   369   e-114
Scas_590.6                                                            367   e-114
CAGL0J06424g complement(611935..614853) highly similar to sp|P53...   369   e-113
KLLA0E23276g complement(2065845..2068325) similar to sp|P38132 S...   363   e-112
Kwal_47.18966                                                         362   e-110
AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH] complement...   353   e-109
KLLA0F10087g complement(935618..938629) similar to sp|P53091 Sac...   357   e-108
YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein in...   357   e-108
Scas_712.49                                                           355   e-107
CAGL0F04939g 503890..506208 highly similar to sp|P29496 Saccharo...   348   e-107
AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH] complement(...   353   e-107
Kwal_56.23282                                                         345   e-106
CAGL0M05423g 577097..579535 highly similar to sp|P38132 Saccharo...   343   e-105
Scas_721.36                                                           344   e-105
KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces c...   337   e-103
Kwal_27.12002                                                         339   e-103
YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/...   334   e-102
Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement        334   e-101
KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces...   332   e-100
Sklu_1863.1 YEL032W, Contig c1863 2885-5749                           330   6e-99
Scas_710.21                                                           328   1e-98
YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 fam...   327   2e-98
YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of t...   325   9e-98
AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH] complement(...   325   2e-97
Kwal_27.10174                                                         324   1e-96
KLLA0F12584g complement(1165710..1168343) similar to sp|P29469 S...   322   1e-96
Sklu_2087.4 YBL023C, Contig c2087 7202-9856                           320   2e-95
CAGL0J04444g 417656..420295 highly similar to sp|P29469 Saccharo...   318   5e-95
Kwal_14.2090                                                          316   2e-94
AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH] (1082128..1...   312   2e-92
Scas_499.2                                                            311   1e-91
YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1 f...   296   3e-86
CAGL0L01397g 152718..155555 highly similar to sp|P24279 Saccharo...   283   5e-82
KLLA0E14278g complement(1260247..1261668) similar to sp|P43635 S...    32   2.7  
CAGL0M03707g 415143..420122 similar to sp|P48563 Saccharomyces c...    32   4.0  
YHR004C (NEM1) [2289] chr8 complement(111748..113088) Protein re...    30   7.5  

>KLLA0C17512g complement(1537707..1540385) similar to sp|P30665
           Saccharomyces cerevisiae YPR019w CDC54 member of the
           CDC46P/MCM2P/MCM3P family, start by similarity
          Length = 892

 Score = 1627 bits (4213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 805/867 (92%), Positives = 805/867 (92%)

Query: 13  NLFYDPSSSPAPHGTQDSQASQDRGVGXXXXXXXXXXXNATQETARAAPXXXXXXXXXXX 72
           NLFYDPSSSPAPHGTQDSQASQDRGVG           NATQETARAAP           
Sbjct: 13  NLFYDPSSSPAPHGTQDSQASQDRGVGSSPFHYPSSSSNATQETARAAPSSSGLRSNNLR 72

Query: 73  XXXXXXXXXXXXXXXXXXXXXXXXXXINASDLSSPRRIVTFXXXXXXXXXXXXXXRPASE 132
                                     INASDLSSPRRIVTF              RPASE
Sbjct: 73  SDLLNYSSSLSSSAREGRHSRSRRGEINASDLSSPRRIVTFNNLSSSDNGFSSSSRPASE 132

Query: 133 AADQPLKIIWGTNVSIQECGNSFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLN 192
           AADQPLKIIWGTNVSIQECGNSFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLN
Sbjct: 133 AADQPLKIIWGTNVSIQECGNSFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLN 192

Query: 193 QMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIMDQTVKDCMVSLALDNGLES 252
           QMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIMDQTVKDCMVSLALDNGLES
Sbjct: 193 QMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIMDQTVKDCMVSLALDNGLES 252

Query: 253 YLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNV 312
           YLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNV
Sbjct: 253 YLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNV 312

Query: 313 CNHTVEVEIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQT 372
           CNHTVEVEIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQT
Sbjct: 313 CNHTVEVEIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQT 372

Query: 373 PHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAK 432
           PHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAK
Sbjct: 373 PHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAK 432

Query: 433 DRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYEL 492
           DRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYEL
Sbjct: 433 DRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYEL 492

Query: 493 DDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSG 552
           DDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSG
Sbjct: 493 DDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSG 552

Query: 553 KGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQT 612
           KGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQT
Sbjct: 553 KGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQT 612

Query: 613 ISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVN 672
           ISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVN
Sbjct: 613 ISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVN 672

Query: 673 EASDRELAKHLTSLYLEDRPDSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRA 732
           EASDRELAKHLTSLYLEDRPDSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRA
Sbjct: 673 EASDRELAKHLTSLYLEDRPDSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRA 732

Query: 733 YVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
           YVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI
Sbjct: 733 YVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792

Query: 793 KDYATDPKTGKIDMNLVQTGKSVVQRKLLEDLAREILKILTERTTDTISFNELSKLINEQ 852
           KDYATDPKTGKIDMNLVQTGKSVVQRKLLEDLAREILKILTERTTDTISFNELSKLINEQ
Sbjct: 793 KDYATDPKTGKIDMNLVQTGKSVVQRKLLEDLAREILKILTERTTDTISFNELSKLINEQ 852

Query: 853 SQDKVESIELSNALTRLQQEDKVVILG 879
           SQDKVESIELSNALTRLQQEDKVVILG
Sbjct: 853 SQDKVESIELSNALTRLQQEDKVVILG 879

>Scas_707.44
          Length = 929

 Score = 1282 bits (3318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/783 (77%), Positives = 701/783 (89%), Gaps = 4/783 (0%)

Query: 99  INASDLSSPRRIVTFXXXXXXXXXXXXXXRPASEAADQPLKIIWGTNVSIQECGNSFREF 158
           I+ASDLSSPRRIV F               P S+A ++PL+IIWGTNVSIQEC   FR F
Sbjct: 136 IHASDLSSPRRIVDFDSHSGVHTSSSSAV-PTSDA-NEPLRIIWGTNVSIQECATKFRNF 193

Query: 159 LMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKL 218
           LMSFK K+RK LD++E FIN TTD+ELYYV QLN+MR++G  NLNLD RNLLA+K TE+L
Sbjct: 194 LMSFKYKFRKTLDEREQFINSTTDEELYYVQQLNEMREVGNCNLNLDARNLLAFKQTEEL 253

Query: 219 FHQILYYPQEIIAIMDQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMREL 278
           ++Q+L YPQE+I+IMDQT+KDCMVSL +DN L+  L++IE+K +KVRPYNV T KGMREL
Sbjct: 254 YYQLLNYPQEVISIMDQTIKDCMVSLVVDNHLDFNLDDIETKFYKVRPYNVGTVKGMREL 313

Query: 279 NPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVVCN 338
           NPNDIDKL+S+KGLVLR+TP+IPDM VAFFKCNVC+HT+ VEIDRG+IQEP RC RV C 
Sbjct: 314 NPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNVCDHTMVVEIDRGVIQEPARCERVDCG 373

Query: 339 SPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSG 398
             NSM L+HNRC+F D+QVIKLQETPDLVPDGQTPH+VSLCVYDELVDSCRAGDRIEV+G
Sbjct: 374 EQNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHAVSLCVYDELVDSCRAGDRIEVTG 433

Query: 399 IFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDN--VEE 456
            FRSIPIR+N +QR LKSLYKTYIDVVHI+KV+  R+GVDTST+EQ+L+QN++D+  VEE
Sbjct: 434 TFRSIPIRANSRQRILKSLYKTYIDVVHIKKVSDTRLGVDTSTIEQELMQNKLDHNEVEE 493

Query: 457 IRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGR 516
           ++ ++ +DI +I++ A R D+YDVLSRSIAPSI+ELDDVKKGILLQLFGGANK FKKGGR
Sbjct: 494 VKKITDQDIAKIRDVANREDLYDVLSRSIAPSIFELDDVKKGILLQLFGGANKVFKKGGR 553

Query: 517 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLE 576
           YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY+TRDVDTKQLVLE
Sbjct: 554 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLE 613

Query: 577 SGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANP 636
           SGALVLSDGG+CCIDEFDKM+D+TRSVLHEVMEQQTISIAKAGIITTLNAR+SILASANP
Sbjct: 614 SGALVLSDGGICCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANP 673

Query: 637 INSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVS 696
           I SRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKV+E++DRELAKHLTSLYL+D+P+ VS
Sbjct: 674 IGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDESTDRELAKHLTSLYLQDKPEHVS 733

Query: 697 QGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKRITATTRQ 756
             DILPVEFLT YINYAK++IHPVI E AK ELVRAYVGMRK+GDDSRSDEKRITATTRQ
Sbjct: 734 NADILPVEFLTMYINYAKEHIHPVILEEAKIELVRAYVGMRKLGDDSRSDEKRITATTRQ 793

Query: 757 LESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVV 816
           LESMIRL+EAHAKMRLS  V+LEDV+EAVRL+KSAIKDYATDPKTGKIDMNLVQTGKSV+
Sbjct: 794 LESMIRLAEAHAKMRLSNEVQLEDVQEAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVI 853

Query: 817 QRKLLEDLAREILKILTERTTDTISFNELSKLINEQSQDKVESIELSNALTRLQQEDKVV 876
           QRKL EDL RE+L++LT  T+D++SFNEL K INE SQD+VES ++S+ L+RLQQEDKV+
Sbjct: 854 QRKLQEDLTREVLRVLTNHTSDSMSFNELIKQINEHSQDRVESSDISDVLSRLQQEDKVI 913

Query: 877 ILG 879
           +LG
Sbjct: 914 VLG 916

>CAGL0K02431g complement(219027..221801) highly similar to sp|P30665
           Saccharomyces cerevisiae YPR019w Cell division control
           protein, start by similarity
          Length = 924

 Score = 1276 bits (3303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/783 (77%), Positives = 697/783 (89%), Gaps = 3/783 (0%)

Query: 99  INASDLSSPRRIVTFXXXXXXXXXXXXXXRPASEAADQPLKIIWGTNVSIQECGNSFREF 158
           I+ASDLSSPRRIV F                 SEA  +PL+IIWGTNVSIQEC NSFR F
Sbjct: 130 IHASDLSSPRRIVDFDSRSGIQQPSSSSSSMPSEAT-EPLRIIWGTNVSIQECANSFRNF 188

Query: 159 LMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKL 218
           LMSFK KYR+ LD +    ++  ++ELYYV QLN+MR+LGTSNLNLD RNLLA+K TE+L
Sbjct: 189 LMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEMRELGTSNLNLDARNLLAFKQTEEL 248

Query: 219 FHQILYYPQEIIAIMDQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMREL 278
           ++Q+L YPQE+I+IMDQT+KDCMVSL +DN LE  L+EIESK +KVRPYNVET+KGMREL
Sbjct: 249 YYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHELDEIESKFYKVRPYNVETQKGMREL 308

Query: 279 NPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVVCN 338
           NPNDIDKL+S+KGLVLR+TP+IPDM VAFFKCN+C+HT+ VEIDRG+IQEP RC RV CN
Sbjct: 309 NPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICDHTMAVEIDRGVIQEPARCERVDCN 368

Query: 339 SPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSG 398
             NSM L+HNRC+F D+QVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEV+G
Sbjct: 369 EANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTG 428

Query: 399 IFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDN--VEE 456
            FRSIPI++N +QR LKSLYKTYIDVVH++KV+  R+GVD ST+EQ+LLQN++DN  VEE
Sbjct: 429 TFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEE 488

Query: 457 IRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGR 516
           +R +S  +I +IK+ A+R D+YD+L+RSIAPSIYELDDVKKGILLQLFGG NKTFKKGGR
Sbjct: 489 VRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYELDDVKKGILLQLFGGTNKTFKKGGR 548

Query: 517 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLE 576
           YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVD+KQLVLE
Sbjct: 549 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLE 608

Query: 577 SGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANP 636
           SGALVLSDGG+CCIDEFDKM+++TRSVLHEVMEQQTIS+AKAGIITTLNAR+SILASANP
Sbjct: 609 SGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANP 668

Query: 637 INSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVS 696
           I SRYNPNLPVTENIDLPPPLLSRFDLVY++LDKV+E++DR+LAKHLTSLYLED+P  V+
Sbjct: 669 IGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVT 728

Query: 697 QGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKRITATTRQ 756
             D+LP++FLT YINY KQN+HP++TE AK ELV+AYVGMRKMGDDSRSDEKRITATTRQ
Sbjct: 729 TDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEKRITATTRQ 788

Query: 757 LESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVV 816
           LESMIRLSEAHAKMRLS  V+LEDV EAVRL+KSAIKDYATDPKTGKIDMNLVQTGKSV+
Sbjct: 789 LESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVI 848

Query: 817 QRKLLEDLAREILKILTERTTDTISFNELSKLINEQSQDKVESIELSNALTRLQQEDKVV 876
           QRKL EDLAREI++IL E   D++SFNEL K INEQ+QD+VE  ++S+ L+RLQQEDKV+
Sbjct: 849 QRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSSTLSRLQQEDKVI 908

Query: 877 ILG 879
           ILG
Sbjct: 909 ILG 911

>ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH]
           complement(653657..656323) [2667 bp, 888 aa]
          Length = 888

 Score = 1275 bits (3299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/784 (77%), Positives = 702/784 (89%), Gaps = 9/784 (1%)

Query: 99  INASDLSSPRRIVTFXXXXXXXXXXXXXXRPASEAADQPLKIIWGTNVSIQECGNSFREF 158
           I+ASDLSSPRR+V F               P SE  D+P++IIWGTNVSIQE   +F+ F
Sbjct: 98  IHASDLSSPRRMVNFNSPSTLSSSD-----PPSEN-DEPMRIIWGTNVSIQEVACTFKNF 151

Query: 159 LMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKL 218
           LM+FK KYRK  D+QE+FINETTD+ELYYVNQL+QMRQLGT NLNLD+RNL+++  TEKL
Sbjct: 152 LMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQLGTCNLNLDVRNLISFPGTEKL 211

Query: 219 FHQILYYPQEIIAIMDQTVKDCMVSLALD-NGLESYLN--EIESKLFKVRPYNVETKKGM 275
           +HQ+L YPQE+I+IMDQ VKDCMV LA+D +G E   N  E+ESK++K+RPYN+++++GM
Sbjct: 212 YHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNENLIEVESKIYKIRPYNLDSERGM 271

Query: 276 RELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRV 335
           RELNPNDIDKLVSIKGLVLRSTP+IPDM +AFFKC+VC+HT  VEIDRGIIQEP+RCPRV
Sbjct: 272 RELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVCDHTTAVEIDRGIIQEPLRCPRV 331

Query: 336 VCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIE 395
            CN  NSM L+HNRC+F D+QVIKLQETPDLVPDGQTPHSVSLC+YDELVDSCRAGDRIE
Sbjct: 332 ACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTPHSVSLCIYDELVDSCRAGDRIE 391

Query: 396 VSGIFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVE 455
           V+GIFRSIPIR+N +QRALKSLYKTY+DVVH++KV+  R+ +DTSTVEQQ+LQNQ+DNVE
Sbjct: 392 VTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSARRLDIDTSTVEQQILQNQMDNVE 451

Query: 456 EIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGG 515
           E+R ++ EDI +I   A R DVY+VL+RSIAPSIYELDD+KKGILLQLFGG NKTF KGG
Sbjct: 452 ELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYELDDIKKGILLQLFGGTNKTFTKGG 511

Query: 516 RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVL 575
           RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY+TRD DTKQ VL
Sbjct: 512 RYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDADTKQSVL 571

Query: 576 ESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASAN 635
           ESGALVLSDGGVCCIDEFDKM+D+TRSVLHEVM+QQ IS+AKAGIITTLNARTSILASAN
Sbjct: 572 ESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQPISVAKAGIITTLNARTSILASAN 631

Query: 636 PINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSV 695
           PI SRYN NLPVTENIDLPPPLLSRFDLVYLVLDKV+E++DRELAKHLTSLYLED+P  V
Sbjct: 632 PIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKVSESTDRELAKHLTSLYLEDKPAHV 691

Query: 696 SQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKRITATTR 755
           S+ DILPV FLT YINYAKQ+IHPVITE AKTELVRAYV MR MGDDSR+DEKRITATTR
Sbjct: 692 SESDILPVHFLTMYINYAKQHIHPVITEGAKTELVRAYVNMRSMGDDSRADEKRITATTR 751

Query: 756 QLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSV 815
           QLESMIRLSEAHAK+RLS++VE+ DV+EAVRLIKSAIKDYA DPKTGKIDMNL+QTGKSV
Sbjct: 752 QLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSAIKDYAIDPKTGKIDMNLIQTGKSV 811

Query: 816 VQRKLLEDLAREILKILTERTTDTISFNELSKLINEQSQDKVESIELSNALTRLQQEDKV 875
           +QRKL EDLAREI+++LTER+ D I++NEL++L+NE SQD+++++ +S+AL RLQQEDK+
Sbjct: 812 IQRKLQEDLAREIVRLLTERSADVITYNELARLLNENSQDRLDNMTISDALNRLQQEDKI 871

Query: 876 VILG 879
           V+LG
Sbjct: 872 VVLG 875

>Kwal_14.2175
          Length = 909

 Score = 1273 bits (3294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/783 (78%), Positives = 691/783 (88%), Gaps = 7/783 (0%)

Query: 99  INASDLSSPRRIVTFXXXXXXXXXXXXXXRPASEAADQPLKIIWGTNVSIQECGNSFREF 158
           ++ASDLSSPRR+V                 P SEA  +PL+IIWGTNVSIQEC  +FR F
Sbjct: 119 LHASDLSSPRRMVDLDSQPPPNSSSD----PVSEAT-EPLRIIWGTNVSIQECATNFRNF 173

Query: 159 LMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKL 218
           LMSFK K+RK LD  E F+NET D+ELYYV +LNQMR++G+ NLNLD RNLL++K TEKL
Sbjct: 174 LMSFKYKFRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLNLDARNLLSFKATEKL 233

Query: 219 FHQILYYPQEIIAIMDQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMREL 278
           ++Q++ YPQEII+IMDQTVKDCMVSL +DN LES L+EIESK +K+RPYN+ET+KGMREL
Sbjct: 234 YYQLMSYPQEIISIMDQTVKDCMVSLVVDNNLESGLDEIESKFYKIRPYNIETQKGMREL 293

Query: 279 NPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVVCN 338
           NPNDIDKL+S+KGLVLRSTPIIPDM VAFFKCN+C+HT  VEIDRG+IQEP RCPRV CN
Sbjct: 294 NPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDRGVIQEPARCPRVACN 353

Query: 339 SPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSG 398
             NSM LVHNRC+F D+QVIKLQETPD VPDGQTPHSVSLCVYDELVDSCRAGDRIE++G
Sbjct: 354 QQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDELVDSCRAGDRIEITG 413

Query: 399 IFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQID--NVEE 456
           IFRSIPIR++  QRALKSLYKTY+DVVH++KV  DR+G DTSTVEQ+LLQN+++  +V+E
Sbjct: 414 IFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVEQELLQNEMNHSDVQE 473

Query: 457 IRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGR 516
           I  ++ E IR++   A R DVY+VL+RS+APSI+ELDD+KKGILLQLFGG NKTF KGGR
Sbjct: 474 IPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILLQLFGGTNKTFTKGGR 533

Query: 517 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLE 576
           YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY+TRD+DTKQLVLE
Sbjct: 534 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDIDTKQLVLE 593

Query: 577 SGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANP 636
           SGALVLSDGGVCCIDEFDKM+D+TRSVLHEVMEQQTISIAKAGIITTLNARTSILASANP
Sbjct: 594 SGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANP 653

Query: 637 INSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVS 696
           I SRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKV+E +DRELAKHLT+LYLED P + +
Sbjct: 654 IGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAKHLTNLYLEDAPTNET 713

Query: 697 QGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKRITATTRQ 756
            GD+LPVE LT YINYAKQ   PVI E AKTELVRAYV MRKMGDDSRSDEKRITATTRQ
Sbjct: 714 DGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGDDSRSDEKRITATTRQ 773

Query: 757 LESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVV 816
           LESMIRL+EAHAKMRLS+ VEL+DV+EAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSV+
Sbjct: 774 LESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVI 833

Query: 817 QRKLLEDLAREILKILTERTTDTISFNELSKLINEQSQDKVESIELSNALTRLQQEDKVV 876
           QRKL EDLARE++ IL  R+  TIS+NEL + INEQSQDKVE+ ++S AL RLQQEDKVV
Sbjct: 834 QRKLQEDLAREVVSILGARSNLTISYNELLRSINEQSQDKVEAADISEALVRLQQEDKVV 893

Query: 877 ILG 879
           +LG
Sbjct: 894 VLG 896

>YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved in
           DNA synthesis initiation, member of the MCM family of
           DNA-dependent ATPases required for initiation of DNA
           replication [2802 bp, 933 aa]
          Length = 933

 Score = 1271 bits (3289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/783 (76%), Positives = 696/783 (88%), Gaps = 2/783 (0%)

Query: 99  INASDLSSPRRIVTFXXXXXXXXXXXXXXRPASEAADQPLKIIWGTNVSIQECGNSFREF 158
           I+ SDLSSPRRIV F                    A +PL+IIWGTNVSIQEC  +FR F
Sbjct: 138 IHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRIIWGTNVSIQECTTNFRNF 197

Query: 159 LMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKL 218
           LMSFK K+RK LD++E FIN TTD+ELYY+ QLN+MR+LGTSNLNLD RNLLAYK TE L
Sbjct: 198 LMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDL 257

Query: 219 FHQILYYPQEIIAIMDQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMREL 278
           +HQ+L YPQE+I+IMDQT+KDCMVSL +DN L+  L+EIE+K +KVRPYNV + KGMREL
Sbjct: 258 YHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMREL 317

Query: 279 NPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVVCN 338
           NPNDIDKL+++KGLVLRSTP+IPDM VAFFKCNVC+HT+ VEIDRG+IQEP RC R+ CN
Sbjct: 318 NPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCN 377

Query: 339 SPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSG 398
            PNSM L+HNRC+F D+QVIKLQETPD VPDGQTPHS+SLCVYDELVDSCRAGDRIEV+G
Sbjct: 378 EPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTG 437

Query: 399 IFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDN--VEE 456
            FRSIPIR+N +QR LKSLYKTY+DVVH++KV+  R+ VDTST+EQ+L+QN++D+  VEE
Sbjct: 438 TFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEE 497

Query: 457 IRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGR 516
           +R ++ +D+ +I+E A R D+Y +L+RSIAPSIYEL+DVKKGILLQLFGG NKTF KGGR
Sbjct: 498 VRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGR 557

Query: 517 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLE 576
           YRGDINILLCGDPSTSKSQILQYVHKI PRGVYTSGKGSSAVGLTAY+TRDVDTKQLVLE
Sbjct: 558 YRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLE 617

Query: 577 SGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANP 636
           SGALVLSDGGVCCIDEFDKM+D+TRSVLHEVMEQQTISIAKAGIITTLNAR+SILASANP
Sbjct: 618 SGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANP 677

Query: 637 INSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVS 696
           I SRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKV+E +DRELAKHLT+LYLED+P+ +S
Sbjct: 678 IGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHIS 737

Query: 697 QGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKRITATTRQ 756
           Q D+LPVEFLT YI+YAK++IHP+ITE+AKTELVRAYVGMRKMGDDSRSDEKRITATTRQ
Sbjct: 738 QDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQ 797

Query: 757 LESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVV 816
           LESMIRL+EAHAKM+L   VELEDV+EAVRLI+SAIKDYATDPKTGKIDMNLVQTGKSV+
Sbjct: 798 LESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVI 857

Query: 817 QRKLLEDLAREILKILTERTTDTISFNELSKLINEQSQDKVESIELSNALTRLQQEDKVV 876
           QRKL EDL+REI+ +L ++ +D++SFNEL K INE SQD+VES ++  AL+RLQQEDKV+
Sbjct: 858 QRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSDIQEALSRLQQEDKVI 917

Query: 877 ILG 879
           +LG
Sbjct: 918 VLG 920

>ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH]
           complement(777754..780195) [2442 bp, 813 aa]
          Length = 813

 Score =  369 bits (948), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 228/614 (37%), Positives = 355/614 (57%), Gaps = 44/614 (7%)

Query: 276 RELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRV 335
           RE+  + + KL+++ G+V R + + P + V  + C+ C   V  E+++      + C   
Sbjct: 215 REVKGSHLGKLITVSGIVTRISDVKPAVLVTAYTCDQCGAEVFQEVNKRTFTPFLECTSR 274

Query: 336 VC--NSPNSMVLVHNRCT-FQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGD 392
            C  N     + +  R + F   Q  K+QE    VP G  P ++++ V   LV S   GD
Sbjct: 275 QCQQNQNKGQLFMSTRASKFSAFQECKIQEMSHQVPIGHIPRTLTIHVNGPLVRSMVPGD 334

Query: 393 RIEVSGIFRSIPIRSNPKQRALKS--LYKTYIDVVHIQKVAKDRVGVD-TSTVEQQLLQN 449
            ++V+GI+   P       +ALK+  L +TY++  ++++  K     + TS VE      
Sbjct: 335 IVDVTGIYLPAPYTGF---KALKAGLLTETYLEAQYVRQHKKKFSSFEITSDVE------ 385

Query: 450 QIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANK 509
                           +R+    ++ DVY  L++SIAP IY   DVKK +LL + GG +K
Sbjct: 386 ----------------KRVMSIVQQGDVYTRLAKSIAPEIYGNLDVKKALLLLMVGGVHK 429

Query: 510 TFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVD 569
           T   G + RGDINI L GDP  +KSQ+L+ + KI PRGVYT+GKGSS VGLTA V +D  
Sbjct: 430 TVGDGMKIRGDINICLMGDPGVAKSQLLKSICKITPRGVYTTGKGSSGVGLTAAVMKDPV 489

Query: 570 TKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTS 629
           T ++VLE GALVL+D G+CCIDEFDKM+++ R+ +HEVMEQQTISI+KAGI TTLNARTS
Sbjct: 490 TDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTS 549

Query: 630 ILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLE 689
           ILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  +  +D +LA+H+  +++ 
Sbjct: 550 ILAAANPVYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMPHRENDEKLAEHVAYVHMH 609

Query: 690 DRPDSVSQGDILPVE--FLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDE 747
           +R   +   D  P+E   +  +I +AK    P++T+     +V++Y+ MR+   +    +
Sbjct: 610 NRQPEL---DFEPIEPAAMREFIAFAKTK-RPIMTQEVNELVVQSYIRMRQDSKNVTDPK 665

Query: 748 KRI-TATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDM 806
           ++   AT R L ++IR+S+A AK+R S++V++EDVEEA+RLI+ +      D +T   D 
Sbjct: 666 QQFGQATPRTLLAVIRISQALAKLRFSDQVDVEDVEEALRLIQVSKDSLYNDTQTRADDE 725

Query: 807 NLVQTGKSVVQRKLLEDLAREILKILTERTTDTISFNELSKLINEQSQDK-VESIELSNA 865
                  +++++     +A E  ++      DTI+    S+   +Q  D  VE     N 
Sbjct: 726 TPTTKIFTIIKK-----MAMETARLNKNLPMDTITKIVRSRGFTQQQLDACVEEYTYLNV 780

Query: 866 LTRLQQEDKVVILG 879
             +L++E+ +  +G
Sbjct: 781 WHKLEEENALKFVG 794

>Scas_590.6
          Length = 767

 Score =  367 bits (941), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 242/728 (33%), Positives = 381/728 (52%), Gaps = 96/728 (13%)

Query: 154 SFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYK 213
           SF+ F++ F+L                 D +  Y +QL     +   +LN+++ +L+ Y 
Sbjct: 30  SFKNFILEFRL-----------------DSQFIYRDQLRNSLLVKNYSLNVNMEHLIGYN 72

Query: 214 HTEKLFHQILYYPQEIIAIMDQTVKDCMVSLAL-------DNGLESYL------NEIESK 260
             E LF ++   P ++I + +  +      + L       +NG  +        N I S 
Sbjct: 73  --EDLFKRLSDGPSDVIPLFETAITQVAKRITLLNRSSQNENGTANETDDLDTRNSISSA 130

Query: 261 L---FKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTV 317
           L   F++   +   +  +R L+   + K+V + G+++ ++ +    +     C  C HT 
Sbjct: 131 LIPNFQLILTSTANQTPLRSLDSEHVSKIVRLSGIIISASVLSSRATHLSLMCRSCRHTT 190

Query: 318 EVEIDR--GIIQEPVRCPRVVCNS----------------PNSMVLVHNRCTFQDRQVIK 359
            ++ID    I    V  P    +S                P+  +++H   TF D+Q +K
Sbjct: 191 SIKIDNFNSITGNSVTLPHACLSSVTATDTGDDSNNKNCGPDPYLIIHESSTFIDQQFLK 250

Query: 360 LQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKS--- 416
           LQE P+LVP G+ P ++++     L +    G R+ + GI+    I S+ K+R   S   
Sbjct: 251 LQEIPELVPVGEMPRNITMSCDRYLTNRVIPGTRVTIVGIY---SIYSS-KKRGYNSNND 306

Query: 417 -----LYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKET 471
                +   +I V+ IQ        V+TS++              +   S E+     + 
Sbjct: 307 GGGVAIRNPFIKVLGIQ------TDVETSSIWNS-----------VTMFSEEEEEEFLQL 349

Query: 472 ARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPST 531
           +RR D+Y+VL++SIAPSI+  +D+KK I+  L GG+ K    G R RGDIN+LL GDP T
Sbjct: 350 SRREDLYEVLTKSIAPSIFGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGT 409

Query: 532 SKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCID 591
           +KSQ+L++V K++P  VYTSGKGSSA GLTA V RD  T++  LE GA+VL+DGGV CID
Sbjct: 410 AKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVCID 469

Query: 592 EFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENI 651
           EFDKM D  R  +HE MEQQTISIAKAGI T LN+RTS+LA+ANPI  RY+      ENI
Sbjct: 470 EFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGENI 529

Query: 652 DLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRP-----DSVSQGDILPVEFL 706
           D    +LSRFD++++V D+ NEA D  +A H+ +++  +       D  + G  L +E +
Sbjct: 530 DFQTTILSRFDMIFIVKDEHNEARDISIANHVINIHTGNSTTQQDQDLENSGSELSMEKM 589

Query: 707 TAYINYAKQNIHPVITESAKTELVRAYVGMRK---MGDDSRSDEKRITATTRQLESMIRL 763
             YI Y +    P ++  A  +L   +V +RK   + +   ++   I  T RQLE++IR+
Sbjct: 590 KRYITYCRIKCAPRLSVQAAEKLSSQFVTIRKQLLINELESTERSSIPITIRQLEAIIRI 649

Query: 764 SEAHAKMRLSERVELEDVEEAVRLIKSAIKDYAT-DPKTGKIDMNLVQTGKSVVQ--RKL 820
           +E+ AK+ LS       VEEA+RL +++  D A+ DP  G   +N    G +++   R++
Sbjct: 650 TESLAKLELSPVAHERHVEEAIRLFQASTMDAASQDPIGG---LNQTGNGSNIMAEIRRI 706

Query: 821 LEDLAREI 828
             +L R +
Sbjct: 707 ESELKRRL 714

>CAGL0J06424g complement(611935..614853) highly similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6, start by
           similarity
          Length = 972

 Score =  369 bits (947), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 227/579 (39%), Positives = 322/579 (55%), Gaps = 54/579 (9%)

Query: 260 KLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEV 319
           +LF++  +N+ T   +RE+  + I  L+ I G V R++ + P++  A F C++C   V+ 
Sbjct: 248 RLFQISFFNLPTVHRIREIRSDKIGSLMCISGTVTRTSEVRPELYKASFTCDMCRAMVDN 307

Query: 320 EIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLC 379
                   EP  CP   C +     L  +R  F D Q +++QE  + +P+G  P ++ + 
Sbjct: 308 VEQSFKYTEPTFCPNPACENRAFWTLNVSRSKFLDWQKVRIQENTNEIPNGSMPRTLDVI 367

Query: 380 VYDELVDSCRAGDRIEVSGIFRSIP---------------------IRS----NPKQRAL 414
           +  + VD  + GD+ + +G+   +P                      RS    N     L
Sbjct: 368 LRGDAVDRAKPGDKCQFTGVEIVVPDVSQLMLPGVKPSSSLDTRGIARSSEGLNSGVTGL 427

Query: 415 KSL------YKTYIDVVHIQKVAKDRVGVDTSTVEQQL-----LQN-------QIDNVEE 456
           KSL      YK      H+  V  +    + S+ E  L     LQN       + D    
Sbjct: 428 KSLGVRDLTYKITFLGSHVVSVGSNMNPNENSSAETNLQFISKLQNNDIYSDREKDQEIF 487

Query: 457 IRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGR 516
           + +LS ++I  +++  +   VYD L RSIAPS++  + +KKGILLQ+ GG +KT  +G +
Sbjct: 488 LSSLSPDEINELQDMVKDDHVYDKLVRSIAPSVFGHEAIKKGILLQMLGGVHKTTVEGIK 547

Query: 517 YRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLE 576
            RGDINI + GDPSTSKSQ L+YV + APR VYTSGK SSA GLTA V RD +     +E
Sbjct: 548 LRGDINICIVGDPSTSKSQFLKYVCRFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIE 607

Query: 577 SGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANP 636
           +GAL+L+D G+CCIDEFDKM+ + +  +HE MEQQTISIAKAGI  TLNARTSILA+ANP
Sbjct: 608 AGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANP 667

Query: 637 INSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVS 696
           I  RYN    +  N+++  P++SRFDL ++VLD  NE  D ELA H+  L+++      S
Sbjct: 668 IGGRYNRKTSLRANLNMTAPIMSRFDLFFVVLDDCNEKIDTELASHIIDLHMKQDEAITS 727

Query: 697 QGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEK---RITAT 753
                  E L  YI YAK    PVI + A+  LV  Y  +RK  DD++   +   RI  T
Sbjct: 728 P---YSAEQLQRYIKYAK-TFKPVINKEARKFLVEKYKALRK--DDAQGYSRSSYRI--T 779

Query: 754 TRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
            RQLESM+RLSEA A+   S+ +  E V EA  L+K +I
Sbjct: 780 VRQLESMVRLSEAIARANCSDEITPEFVAEAYDLLKQSI 818

>KLLA0E23276g complement(2065845..2068325) similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47 cell division
           control protein, start by similarity
          Length = 826

 Score =  363 bits (932), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 225/570 (39%), Positives = 342/570 (60%), Gaps = 44/570 (7%)

Query: 263 KVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEID 322
           K++P +V      RE+  + + KL++++G++ R + + P ++V  + C+ C H V  E++
Sbjct: 212 KLKPMSV------REIKGSYLGKLITVRGIITRVSDVKPSVTVNAYTCDQCGHEVFQEVN 265

Query: 323 RGIIQEPVRCPRVVC--NSPNSMVLVHNRCT-FQDRQVIKLQETPDLVPDGQTPHSVSLC 379
           +      + CP   C  N     + +  R + F   Q  K+QE  D VP G  P ++++ 
Sbjct: 266 KRTFTPIIECPSAQCSENQTKGQLFMSTRASKFSAFQECKIQELSDQVPIGHIPRTLTIH 325

Query: 380 VYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKS--LYKTYIDVVHIQKVAKDRVGV 437
           +   L  S   GD ++V+GI+   P       RALK+  L +TY++    Q V + +   
Sbjct: 326 INGPLTRSMIPGDVVDVTGIYLPSPYTGF---RALKAGLLTETYLET---QFVYQHKKKF 379

Query: 438 DTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKK 497
            +  V+ QL +                  R+ +   + DVY+ L++SIAP IY   DVKK
Sbjct: 380 ASFQVDDQLKE------------------RVAKIVNQGDVYNRLAKSIAPEIYGNLDVKK 421

Query: 498 GILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSA 557
            +LL L GG  K    G + RGDINI L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS 
Sbjct: 422 SLLLLLVGGVEKKVGDGLKIRGDINICLMGDPGVAKSQLLKSICKISPRGVYTTGKGSSG 481

Query: 558 VGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAK 617
           VGLTA V +D  T ++VLE GALVL+D G+CCIDEFDKM+++ R+ +HEVMEQQTISI+K
Sbjct: 482 VGLTAAVMKDPVTDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISK 541

Query: 618 AGIITTLNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDR 677
           AGI TTLNAR SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  ++ +D 
Sbjct: 542 AGINTTLNARASILAAANPLYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMPSKENDE 601

Query: 678 ELAKHLTSLYLEDR-PDSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGM 736
           +LA+H+T +++ DR PD   +   +P   +  YI YAK    PV++      +V +Y  M
Sbjct: 602 KLAEHVTYVHMYDRQPDFGFEP--IPSSEMREYIAYAKTK-RPVLSADVNEHIVLSYTRM 658

Query: 737 RKMGDDSRSDEKRIT---ATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIK 793
           R+  D  ++ + + +   AT R L ++IRLS+A AK+RLS+ VE+EDV+EA+RL++ + +
Sbjct: 659 RQ--DSKKALDSKFSFGQATPRTLLAIIRLSQALAKLRLSDTVEIEDVDEALRLVEVSKE 716

Query: 794 DYATDPKTGKIDMNLVQTGKSVVQRKLLED 823
              +D K    D N      +++++   E+
Sbjct: 717 SLYSDRKNPYEDENPTTRIYTIIKKMATEN 746

>Kwal_47.18966
          Length = 1044

 Score =  362 bits (928), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 223/577 (38%), Positives = 319/577 (55%), Gaps = 52/577 (9%)

Query: 260 KLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEV 319
           ++F++  +N+ T   +R++    I  L+SI G V R++ + P++  A F C +C   V+ 
Sbjct: 278 RIFQISFFNLPTVNRIRDIRAEKIGSLMSISGTVTRTSEVRPELYKASFTCEMCRAVVDN 337

Query: 320 EIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLC 379
                   +P  CP   C +     L   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 338 VEQVFKYTQPTYCPNPSCENQAFWTLSVGRSKFLDWQKVRIQENANEIPTGSMPRTLDVV 397

Query: 380 VYDELVDSCRAGDRIEVSGIFRSIP---------------------IRS----NPKQRAL 414
           +  + V+  + GDR + +G    +P                      RS    N     L
Sbjct: 398 LRGDCVERAKPGDRCKFTGTEIVVPDITQLGLPGVKPSSTMDNRGIARSSEGLNTGVSGL 457

Query: 415 KSL------YKTYIDVVHIQKVAKDRVGVDTSTVEQ-QLLQNQIDNV-------EEI--R 458
           KSL      YK      H+    KD      +  E   LL  Q++NV       +EI   
Sbjct: 458 KSLGVRDLTYKISFLACHVTPTGKDANNNANAQDEGGDLLSMQVNNVGNDDERDQEIFLN 517

Query: 459 TLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYR 518
           +L+S++I  +KE  +   +YD L RSIAP+++  + VKKGILLQ+ GG +KT  +G   R
Sbjct: 518 SLNSQEINELKEMVKDEQIYDKLVRSIAPAVFGHNTVKKGILLQMLGGVHKTTVEGINLR 577

Query: 519 GDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESG 578
           GDINI + GDPSTSKSQ L+YV   APR VYTSGK SSA GLTA V +D +     +E+G
Sbjct: 578 GDINICIVGDPSTSKSQFLKYVCGFAPRAVYTSGKASSAAGLTAAVVKDEEAGDFTIEAG 637

Query: 579 ALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPIN 638
           AL+L+D G+CCIDEFDKM+ + +  +HE MEQQTISIAKAGI  TLNARTSILA+ANP+ 
Sbjct: 638 ALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVG 697

Query: 639 SRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVSQG 698
            RYN  L +  N+++  P++SRFDL ++VLD  NE  D ELA H+  L+++ R +++   
Sbjct: 698 GRYNRKLTLRGNLNMTAPIMSRFDLFFVVLDDCNEKIDTELAAHIVDLHMK-RDEAIDP- 755

Query: 699 DILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEK---RITATTR 755
                E L  YI YA+    PV+ E A+  LV  Y  +R+  DD++   K   RI  T R
Sbjct: 756 -PFTAEQLRRYIKYAR-TFKPVMNEEARNYLVEKYKELRR--DDAQGFSKSSYRI--TVR 809

Query: 756 QLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
           QLESMIRLSE  A+    + +    V EA  L++ +I
Sbjct: 810 QLESMIRLSEGIARANCVDEITPNFVAEAYDLLRQSI 846

>AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH]
           complement(1257348..1259552) [2205 bp, 734 aa]
          Length = 734

 Score =  353 bits (905), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 234/690 (33%), Positives = 358/690 (51%), Gaps = 78/690 (11%)

Query: 150 ECGNSFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNL 209
           E   SFR+F++ F+L                 D    Y  QL     +    L ++  +L
Sbjct: 26  EVVRSFRDFVLEFRL-----------------DARFVYREQLRNNLLVRRYALRVNTEHL 68

Query: 210 LAYKHTEKLFHQILYYPQEIIAIMDQTVKDCMVSLAL----DNG-LESYLNEIESKLFKV 264
           + Y   E L+  +   P E + + +Q V +    +A     D G L +   E++S     
Sbjct: 69  IGYN--EALYKLVRDEPVETVPLFEQAVTEIARRMARLRAEDAGALPAVQVELQS----- 121

Query: 265 RPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEID-- 322
                  +  +R+L+   + +LV + G+V+ ++ +    +     C  C HT  ++++  
Sbjct: 122 ----AAAETALRQLDSQSVSRLVRLSGIVVSTSVLTSRATHVALMCRNCRHTTALDLNNF 177

Query: 323 RGIIQEPVRCPRVVCNSPNS---------------MVLVHNRCTFQDRQVIKLQETPDLV 367
           + +    V  PR  C + +S                ++VH    F D+Q +KLQE P+ V
Sbjct: 178 QSLAGSNVALPRA-CLADHSNDDGSAAGNPCGQDPYMIVHESSRFVDQQFLKLQEVPESV 236

Query: 368 PDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKSLYKTYIDVVHI 427
           P G+ P ++ L     L +    G R+ V GI+     +         ++   Y+ V+ I
Sbjct: 237 PIGEMPRNLLLTCDRYLTNRVVPGTRVTVVGIYAIYQSKGGQGGARAVAIRNPYVKVLGI 296

Query: 428 QKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAP 487
           +  A    GV                   +   S E+       AR  ++Y + + SIAP
Sbjct: 297 EAQAGSPAGV-------------------LSMFSEEEEEEFLRLARTPNLYQLFAESIAP 337

Query: 488 SIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRG 547
           SIY  +D+KK I+  L GG+ K    G R RGDIN+LL GDP T+KSQ+L++V K++P  
Sbjct: 338 SIYGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIA 397

Query: 548 VYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEV 607
           VYTSGKGSSA GLTA V RD +T++  LE GA+VL+DGGV CIDEFDKM D  R  +HE 
Sbjct: 398 VYTSGKGSSAAGLTASVQRDPNTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEA 457

Query: 608 MEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLV 667
           MEQQTISIAKAGI T LN+RTS+LA+ANPI  RY+      ENID    +LSRFD++++V
Sbjct: 458 MEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDELKSPGENIDFQTTILSRFDMIFIV 517

Query: 668 LDKVNEASDRELAKHLTSLYLEDR--PDSVSQGD--ILPVEFLTAYINYAKQNIHPVITE 723
            D+ NE  D  +A+H+ +++      PD+ + G    +P++ +  YI Y +    P ++ 
Sbjct: 518 KDEHNEQRDMSIAQHVMNIHTGRTAVPDAGAAGADREIPIDKMRRYITYCRSKCAPRLST 577

Query: 724 SAKTELVRAYVGMRK--MGDDSRSDEK-RITATTRQLESMIRLSEAHAKMRLSERVELED 780
            A  +L   +V +RK  + ++  S EK  I  T RQLE++IR+SE+ AK+ LS   E   
Sbjct: 578 HAAEKLSSHFVTIRKQLLINELESKEKSSIPITVRQLEAIIRISESLAKLELSSVAEERH 637

Query: 781 VEEAVRLIKSAIKDYAT-DPKTGKIDMNLV 809
           V+EA+RL +++  D A+ DP  G  + N+V
Sbjct: 638 VDEAIRLFQASTMDAASQDPIGGMQNSNVV 667

>KLLA0F10087g complement(935618..938629) similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6 involved in
           replication, start by similarity
          Length = 1003

 Score =  357 bits (917), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 220/583 (37%), Positives = 320/583 (54%), Gaps = 58/583 (9%)

Query: 260 KLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEV 319
           ++ ++   N+ T   +R++  N I  L++I G V R++ I P++  A F C +C   ++ 
Sbjct: 243 RVLQISFLNLPTVHRIRDIRANKIGSLMAISGTVTRTSEIRPELYKASFTCELCRAVIDN 302

Query: 320 EIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLC 379
                   EP  CP   C + +   L  NR  F D Q +++QE  + +P G  P ++ + 
Sbjct: 303 VEQVFKYTEPTSCPNPTCENQSFWSLNVNRSKFLDWQKVRIQENSNEIPSGSMPRTLDII 362

Query: 380 VYDELVDSCRAGDRIEVSGIFRSIP-----------IRSNPKQRA--------------L 414
           +  + V+  + GDR +  G    +P             S P  R               L
Sbjct: 363 LRGDCVERAKPGDRCKFIGTEIVVPDVSQLGLPGVKASSTPDSRGISRTTEGLNSGISGL 422

Query: 415 KSL------YKTYIDVVHIQKVAKDRVGV--------DTSTVEQQLLQN--------QID 452
           KSL      YK      H++ V     G          TS  +   L+N        + D
Sbjct: 423 KSLGVRDLTYKISFLACHVENVGTSFNGSRINEEDADKTSKFDYINLRNYQNYEMAAETD 482

Query: 453 NVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFK 512
               +  L S++I  +KE  +  ++YD L +SIAP+++  + +KKGILLQ+  G +KT  
Sbjct: 483 QEIFLTRLDSDEINELKEMVKDENIYDKLVKSIAPAVFGHETIKKGILLQMLSGVHKTTV 542

Query: 513 KGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQ 572
           +G + RGDINI + GDPSTSKSQ L+YV   +PR VYTSGK SSA GLTA V +D +   
Sbjct: 543 EGIKLRGDINICIVGDPSTSKSQFLKYVCNFSPRAVYTSGKASSAAGLTAAVVKDEEGGD 602

Query: 573 LVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILA 632
             +E+GAL+L+D GVCCIDEFDKM+   +  +HE MEQQTISIAKAGI  TLNARTSILA
Sbjct: 603 FTIEAGALMLADNGVCCIDEFDKMDIADQVAIHEAMEQQTISIAKAGIHATLNARTSILA 662

Query: 633 SANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRP 692
           +ANP+  RYN  L +  N+++  P++SRFDL +++LD  NE  D ELA H+  L+++ R 
Sbjct: 663 AANPVGGRYNRKLTLRSNLNMSAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMK-RD 721

Query: 693 DSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEK---R 749
            +++       E L+ YINYAK    PV+T+ A+  LV+ Y  +RK  DD++   K   R
Sbjct: 722 SAINPP--FSAEQLSRYINYAK-TFKPVMTKEARDYLVKRYTELRK--DDAQGYSKSSYR 776

Query: 750 ITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
           I  T RQLES+IRLSEA A+    + +    V EA  L++ +I
Sbjct: 777 I--TVRQLESLIRLSEAIARANCVDEIVPSFVAEAYDLLRQSI 817

>YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein
           involved in DNA replication, member of the MCM/P1 family
           of proteins [3054 bp, 1017 aa]
          Length = 1017

 Score =  357 bits (917), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 217/584 (37%), Positives = 325/584 (55%), Gaps = 60/584 (10%)

Query: 260 KLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEV 319
           ++F++  +N+ T   +R++    I  L+SI G V R++ + P++  A F C++C   V+ 
Sbjct: 261 RVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDN 320

Query: 320 EIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLC 379
                   EP  CP   C +     L   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 321 VEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVI 380

Query: 380 VYDELVDSCRAGDRIEVSGIFRSIPIRS-------------------------NPKQRAL 414
           +  + V+  + GDR + +G+   +P  +                         N     L
Sbjct: 381 LRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGL 440

Query: 415 KSL------YKTYIDVVHIQKVAKDRVGV-------DTSTVEQQLLQN-QIDNVEE---- 456
           +SL      YK      H+  +  + +G        +    E Q+  N Q +NV +    
Sbjct: 441 RSLGVRDLTYKISFLACHVISIGSN-IGASSPDANSNNRETELQMAANLQANNVYQDNER 499

Query: 457 -----IRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTF 511
                + +LSS++I  +KE  +   +YD L RSIAP+++  + VKKGILLQ+ GG +K+ 
Sbjct: 500 DQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKST 559

Query: 512 KKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTK 571
            +G + RGDINI + GDPSTSKSQ L+YV   APR VYTSGK SSA GLTA V RD +  
Sbjct: 560 VEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGG 619

Query: 572 QLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSIL 631
              +E+GAL+L+D G+CCIDEFDKM+ + +  +HE MEQQTISIAKAGI  TLNARTSIL
Sbjct: 620 DYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSIL 679

Query: 632 ASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDR 691
           A+ANP+  RYN  L +  N+++  P++SRFDL +++LD  NE  D ELA H+  L+++ R
Sbjct: 680 AAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMK-R 738

Query: 692 PDSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEK--- 748
            +++        E L  YI YA+    P++T+ A++ LV  Y  +RK  DD++   +   
Sbjct: 739 DEAIEPP--FSAEQLRRYIKYAR-TFKPILTKEARSYLVEKYKELRK--DDAQGFSRSSY 793

Query: 749 RITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
           RI  T RQLESMIRLSEA A+    + +    + EA  L++ +I
Sbjct: 794 RI--TVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSI 835

>Scas_712.49
          Length = 1019

 Score =  355 bits (911), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 217/583 (37%), Positives = 318/583 (54%), Gaps = 54/583 (9%)

Query: 256 EIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNH 315
           E   ++F++  +N+ T   +R++    I  L+SI G V R++ + P++  A F C++C  
Sbjct: 245 EQSERIFQISFFNLPTVFRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDLCRA 304

Query: 316 TVEVEIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHS 375
            V+         EP  CP   C +     L   R  F D Q +++QE  + +P G  P +
Sbjct: 305 QVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSKFLDWQKVRIQENANEIPSGSMPRT 364

Query: 376 VSLCVYDELVDSCRAGDRIEVSGIFRSIP---------------------IRS----NPK 410
           + + +  + V+  + GDR + +G    +P                      RS    N  
Sbjct: 365 LDVILRGDCVERAKPGDRCKFTGTEIVVPDVTQLGLPGIKPTSSMDTRGIARSTEGLNNG 424

Query: 411 QRALKSL------YKTYIDVVHIQKVAKDRVGVDTSTVEQQLL-------QNQIDNVEE- 456
              L++L      YK      H+  +  +         E +L         N   + E+ 
Sbjct: 425 VSGLRALGVRDLTYKISFLACHVISIGSNTDASSNGNTENELQLAATLHGSNVYQDYEKD 484

Query: 457 ----IRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFK 512
               + +L+SE+I  +KE  +   +YD L RSIAP+++  + VKKGILLQ+ GG +K+  
Sbjct: 485 QEVFLNSLNSEEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTV 544

Query: 513 KGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQ 572
           +G + RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA V RD +   
Sbjct: 545 EGIKLRGDINICIVGDPSTSKSQFLKYVCGFVPRSVYTSGKASSAAGLTAAVVRDEEGGD 604

Query: 573 LVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILA 632
             +E+GAL+L+D G+CCIDEFDKM+ + +  +HE MEQQTISIAKAGI  TLNARTSILA
Sbjct: 605 YTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILA 664

Query: 633 SANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRP 692
           +ANPI  RYN  L +  N+++  P++SRFDL +++LD  NE  D ELA H+  L+++ R 
Sbjct: 665 AANPIGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMK-RD 723

Query: 693 DSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEK---R 749
            ++        E L  YI YA+    P++T+ A+  LV  Y  +RK  DD++   K   R
Sbjct: 724 AAIHSP--FTAEQLRRYIRYAR-TFKPILTKEARQYLVEKYKDLRK--DDAQGYSKSSYR 778

Query: 750 ITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
           I  T RQLESMIRLSEA A+    + +    + EA  L++ +I
Sbjct: 779 I--TVRQLESMIRLSEAIARANCVDEITPAFIAEAYDLLRQSI 819

>CAGL0F04939g 503890..506208 highly similar to sp|P29496
           Saccharomyces cerevisiae YLR274w CDC46 cell division
           control protein, start by similarity
          Length = 772

 Score =  348 bits (894), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 241/736 (32%), Positives = 378/736 (51%), Gaps = 107/736 (14%)

Query: 154 SFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYK 213
           +F+ F++ F+L                 D +  Y +QL     +   +L++D+ +L+ Y 
Sbjct: 30  AFKRFILEFRL-----------------DSQFLYRDQLRNSLLVKNYSLSVDLEHLIGYN 72

Query: 214 HTEKLFHQILYYPQEIIAIMD----QTVKDCMV---SLALDNGLESYLNEIESKL----- 261
             E L+ ++   P ++I + +    Q  K  M+   S   ++GL+  ++E  + L     
Sbjct: 73  --EDLYKRLSDEPSDVIPLFETAITQVAKRIMILNKSSNTNDGLDD-IDENSNDLADDED 129

Query: 262 -------FKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCN 314
                  F++   +   +  +R+LN   +  +V + G+++ ++ +    +     C  C 
Sbjct: 130 GITDIPVFQLILSSRANQVSLRQLNSEHVSNIVRLSGIIVSASVLSQRATHLSLMCRNCR 189

Query: 315 HTVEVEIDR------GIIQEPVRCPRVVCNS-----------------------PNSMVL 345
           HT+ + I+         +  P  C     NS                       P+  ++
Sbjct: 190 HTMSLNINNFNSITGNSVTLPHSCQSTNNNSTAAYIHDTGDDPTGSGAASKNCGPDPYII 249

Query: 346 VHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPI 405
           +H    F D+Q +KLQE P+LVP  + P ++++     L +    G R+ + GI+ SI  
Sbjct: 250 IHESSKFIDQQFLKLQEVPELVPVSEMPRNITMTCDRYLTNRVNPGTRVTIEGIY-SI-- 306

Query: 406 RSNPKQRALKS--------LYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEI 457
             N K+R+  +        +   YI V+ IQ           + VE   + N +      
Sbjct: 307 -YNSKKRSGAAGQSGSGVAIRTPYIKVLGIQ-----------TDVEASSIWNSM------ 348

Query: 458 RTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRY 517
              S E+     + +RR D+Y++L+ SIAPSI+   D+KK I+  L GG+ K    G R 
Sbjct: 349 TMFSEEEEEEFLQLSRRPDIYELLANSIAPSIFGNQDIKKAIVCLLMGGSKKLLPDGMRL 408

Query: 518 RGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLES 577
           RGDIN+LL GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA V RD  TK+  LE 
Sbjct: 409 RGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPITKEFFLEG 468

Query: 578 GALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPI 637
           GA+VL+DGGV CIDEFDKM D  R  +HE MEQQTISIAKAGI T LN+RTS+LA+ANPI
Sbjct: 469 GAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPI 528

Query: 638 NSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSV-S 696
             RY+      ENID    +LSRFD++++V D+ NE  D  +A H+ +++       + +
Sbjct: 529 YGRYDELKSPGENIDFQTTILSRFDMIFIVKDEHNEERDISIANHVMNIHTGHTDAQLEA 588

Query: 697 QGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRK---MGDDSRSDEKRITAT 753
            G  L +E +  YI Y K    P +T  A  +L   +V +RK   + +   ++   I  T
Sbjct: 589 NGSELSIEKMKRYITYCKSRCAPRLTPEAAEKLSSQFVTIRKQLLINELESTERSSIPIT 648

Query: 754 TRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYAT-DPKTGKIDMNLVQTG 812
            RQLE++IR++E+ AK+ LS   E   V+EA+RL +++  D A  DP  G   MN  QT 
Sbjct: 649 IRQLEAIIRITESLAKLELSPIAEERHVDEAIRLFQASTMDAAAQDPIGG---MN--QTN 703

Query: 813 KSVVQRKLLEDLAREI 828
                R++ ++L R +
Sbjct: 704 SLSDIRRVEQELKRRL 719

>AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH]
           complement(1415577..1418594) [3018 bp, 1005 aa]
          Length = 1005

 Score =  353 bits (905), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 212/580 (36%), Positives = 318/580 (54%), Gaps = 57/580 (9%)

Query: 260 KLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEV 319
           ++F++  +N+     +R++    +  L++I G V R++ + P++  A F C++C   V+ 
Sbjct: 267 RIFQISFFNIPVTNRIRDIRAEKVGTLMTISGTVTRTSEVRPELFKASFTCDMCRAVVDN 326

Query: 320 EIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLC 379
                   EP  CP   C +     L   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 327 VEQVFKFTEPTFCPNPSCENQAFWTLNIGRSRFLDWQRVRIQENSNEIPTGSMPRTLDVI 386

Query: 380 VYDELVDSCRAGDRIEVSGIFRSIP-----------IRSNPKQRA--------------L 414
           +  + V+  + GDR   +G    +P             S P  R               L
Sbjct: 387 LRGDCVERAKPGDRCRFTGTEIVMPDVTQLGLAGMKPSSAPDTRGISRTMEGLNSGVSGL 446

Query: 415 KSL------YKTYIDVVHIQKVAKD---RVGVDTSTVEQQLLQN---QIDNVEE-----I 457
           K+L      YK      H+  V  +   +  V +  ++  +LQ+    ID+ E      +
Sbjct: 447 KTLGVRDLTYKIAFLACHVMGVGNNSNPQGDVLSHELDVNMLQHLNKGIDDTERDQELFL 506

Query: 458 RTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRY 517
            +LSS++I  +KE  +   +YD L +SIAP+++  + VKKG+LLQ+ GG +KT  +G + 
Sbjct: 507 NSLSSDEINELKEMVKDERIYDKLVQSIAPAVFGHETVKKGLLLQMLGGVHKTTVEGIKL 566

Query: 518 RGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLES 577
           RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA V +D +     +E+
Sbjct: 567 RGDINICIVGDPSTSKSQFLKYVCAFVPRAVYTSGKASSAAGLTAAVVKDEEGGDFTIEA 626

Query: 578 GALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPI 637
           GAL+L+D G+CCIDEFDKM+ + +  +HE MEQQTISIAKAGI  TLNARTSILA+ANP+
Sbjct: 627 GALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPV 686

Query: 638 NSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLE-----DRP 692
             RYN  L +  N+++  P++SRFDL +++LD  N+  D ELA H+ +L+++     D P
Sbjct: 687 GGRYNRKLTLRGNLNMTAPIMSRFDLFFVILDDCNQKVDTELASHIVNLHMKCDDAIDPP 746

Query: 693 DSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKRITA 752
            ++ Q        L  YI YA+    P++TE A+  LV  Y  +RK  D     +     
Sbjct: 747 FTMDQ--------LRRYIKYAR-TFKPILTEDARQFLVEKYKELRK-NDIQGYSKSSYRI 796

Query: 753 TTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
           T RQLESMIRLSEA A+    + +    V EA  L++ +I
Sbjct: 797 TVRQLESMIRLSEAIARANCVDEITPAFVAEAYDLLRQSI 836

>Kwal_56.23282
          Length = 761

 Score =  345 bits (885), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 231/722 (31%), Positives = 368/722 (50%), Gaps = 82/722 (11%)

Query: 150 ECGNSFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNL 209
           E   SF  F++ F+L                 D    Y  QL     +   ++ +D  +L
Sbjct: 26  EIVKSFHNFVLEFRL-----------------DAHFVYREQLRSNLLVKNYSITVDTAHL 68

Query: 210 LAYKHTEKLFHQILYYPQEIIAIMDQTVKDCMVSLAL---------DNGLESYL-----N 255
           + Y   E L+ ++   P +++ + +Q V      +AL         +N LE+       N
Sbjct: 69  IGYN--EDLYKRLYDEPTDVLPLFEQAVSQVARRIALLSRDPNMDPNNQLENASTDDAPN 126

Query: 256 EIESKLFKVRPYNV-----ETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKC 310
              S  F +    V      ++  +R L   ++ K+V + G+V+ ++ +    +     C
Sbjct: 127 SGASLAFDIPTCQVMLISDSSETSLRVLGSENVSKIVRVSGIVVSASVLSSRATFLTLMC 186

Query: 311 NVCNHTVEVEIDR------GIIQEPVRC----PRVVCNSP---NSMVLVHNRCTFQDRQV 357
             C H   + ++         +  P  C     R   ++P   +  ++VH    F D+Q 
Sbjct: 187 RNCRHVTTMHLNSFGSLGGNHVSLPRNCLADHSRETGSNPCGQDPYMIVHESSRFVDQQF 246

Query: 358 IKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKSL 417
           +KLQE P+LVP G+ P ++ +     L +    G R  + GI+               S+
Sbjct: 247 LKLQEIPELVPVGEMPRNILMSCDRYLTNRIVPGTRATIVGIY---------------SI 291

Query: 418 YKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDN--VEEIRTLSSEDIRRIKETARRS 475
           Y+               V +    V+   +Q  +D   +      + E+  +    +RR 
Sbjct: 292 YQAKSRGAGTAASGGKAVAIRNPYVKILGIQTDLDGNPMSNTVVFTDEEEEQFLTLSRRP 351

Query: 476 DVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQ 535
           D+Y++ ++SIAPSIY  +D+KK I+  L GG+ K    G R RGDIN+LL GDP T+KSQ
Sbjct: 352 DLYEIFTKSIAPSIYGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQ 411

Query: 536 ILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDK 595
           +L++V K++P  VYTSGKGSSA GLTA V RD  T++  LE GA+VL+DGGV CIDEFDK
Sbjct: 412 LLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVCIDEFDK 471

Query: 596 MNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENIDLPP 655
           M D  R  +HE MEQQTISIAKAGI T LN+RTS+LA+ANPI  RY+      ENID   
Sbjct: 472 MRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGENIDFQT 531

Query: 656 PLLSRFDLVYLVLDKVNEASDRELAKHLTSLY----LEDRPDSVSQGDILPVEFLTAYIN 711
            +LSRFD++++V D  NE  D  +A H+ +++      +  +  +  + +P+E +  YI 
Sbjct: 532 TILSRFDMIFIVKDHHNEERDISIANHVMNIHTGRTATNEEEREAAANEIPIEKMKRYIT 591

Query: 712 YAKQNIHPVITESAKTELVRAYVGMRK--MGDDSRSDEK-RITATTRQLESMIRLSEAHA 768
           Y +    P ++  A  +L   +VG+RK  + ++ +S+++  I  T RQLE++IR+SE+ A
Sbjct: 592 YCRMKCAPRLSPQAAEKLSSHFVGIRKKLLINELQSEQRSSIPITVRQLEAIIRISESLA 651

Query: 769 KMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVVQ--RKLLEDLAR 826
           K+ LS       V+EA+RL +++  D A+    G +  N     + +VQ  R++ E+L R
Sbjct: 652 KLELSPVAHERHVDEAIRLFQASTMDAASQDPIGGLGQN-----QDLVQDVRRIEEELKR 706

Query: 827 EI 828
            +
Sbjct: 707 RL 708

>CAGL0M05423g 577097..579535 highly similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47, start by
           similarity
          Length = 812

 Score =  343 bits (881), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 214/526 (40%), Positives = 319/526 (60%), Gaps = 42/526 (7%)

Query: 275 MRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPR 334
           +R++    + +L++++G++ R + + P ++V  + C+ C + +  E++       V C  
Sbjct: 221 VRQIKGELLGELITVRGIITRVSDVKPAVTVIAYTCDQCGYEIFQEVNSKTFTPLVECTS 280

Query: 335 VVC--NSPNSMVLVHNRCT-FQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAG 391
             C  N     + +  R + F   Q  K+QE    VP G  P S+++ V   LV S   G
Sbjct: 281 RECSQNQTKGQLFMSTRASKFNAFQECKIQELSQQVPVGHIPRSLTIHVNGPLVRSVTPG 340

Query: 392 DRIEVSGIFRSIPIRSNPKQRALKS--LYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQN 449
           D ++++GIF   P       +ALK+  L +TY++  H+++  K            Q+   
Sbjct: 341 DIVDIAGIFLPSPYTGF---KALKAGLLTETYLEAHHVRQHKKKFASF-------QMTPQ 390

Query: 450 QIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANK 509
              NV+ +              A+  +VY+ L++SIAP IY   DVKK +LL L GG +K
Sbjct: 391 VRSNVDAL--------------AQSGNVYERLAKSIAPEIYGNLDVKKALLLLLVGGVDK 436

Query: 510 TFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVD 569
               G + RGDINI L GDP  +KSQ+L+ + KI PRGVYT+GKGSS VGLTA V +D  
Sbjct: 437 RVGDGMKIRGDINICLMGDPGVAKSQLLKAICKITPRGVYTTGKGSSGVGLTAAVMKDPV 496

Query: 570 TKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTS 629
           T +++LE GALVL+D G+CCIDEFDKM+++ R+ +HEVMEQQTISI+KAGI TTLNARTS
Sbjct: 497 TDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTS 556

Query: 630 ILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLE 689
           ILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  N  +D +LA H+  +++ 
Sbjct: 557 ILAAANPLYGRYNPRLSPLENINLPAALLSRFDVMFLLLDTPNRENDEQLANHVAYVHMY 616

Query: 690 DR-PDSVSQGDILPVE--FLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSD 746
           ++ PD     D  P+E   +  +I YA+  + PV+T      +V AY+ +R+  D  R  
Sbjct: 617 NKQPDL----DFEPIEPTMMREFIAYAR-TMRPVMTAEINDHVVSAYIRLRQ--DSKREM 669

Query: 747 EKRIT---ATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIK 789
           + + +   AT R L ++IRLS+A AK+RLSE V+++DVEEA+RLI+
Sbjct: 670 DSKFSFGQATPRTLLAIIRLSQALAKLRLSETVDIDDVEEALRLIR 715

>Scas_721.36
          Length = 855

 Score =  344 bits (882), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 212/523 (40%), Positives = 314/523 (60%), Gaps = 36/523 (6%)

Query: 275 MRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPR 334
           +RE+  + + +L++++G+V R + + P + V  + C+ C + V  E+        + C  
Sbjct: 227 VREIKGDFLGQLITVRGIVTRVSDVKPSVLVIAYTCDQCGYEVFQEVHSRTFTPLIDCTS 286

Query: 335 VVC--NSPNSMVLVHNRCT-FQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAG 391
             C  N     + +  R + F   Q +K+QE    VP G  P S+S+ V   LV S   G
Sbjct: 287 EECAQNQTKGQLFMSTRASKFSAFQEVKIQELSQQVPVGHIPRSLSIHVNGALVRSMTPG 346

Query: 392 DRIEVSGIFRSIPIRSNPKQRALKS--LYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQN 449
           D ++VSGIF   P       +ALK+  L +TY++   +++  K     D S+        
Sbjct: 347 DIVDVSGIFLPSPYTGF---KALKAGLLTETYLEAQFVRQHKKKFASFDLSS-------- 395

Query: 450 QIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANK 509
                        ED  R+ E   + DVY+ +++SIAP IY   DVKK +LL L GG +K
Sbjct: 396 -----------GMED--RVTEMIAQGDVYNRMAKSIAPEIYGNLDVKKALLLLLVGGVDK 442

Query: 510 TFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVD 569
               G + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA V +D  
Sbjct: 443 KVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPV 502

Query: 570 TKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTS 629
           T +++LE GALVL+D G+CCIDEFDKM+++ R+ +HEVMEQQTISI+KAGI TTLNAR S
Sbjct: 503 TDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARAS 562

Query: 630 ILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLE 689
           ILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  N  +D +LA+H+  +++ 
Sbjct: 563 ILAAANPLYGRYNPRLSPLENINLPAALLSRFDILFLLLDTPNRENDEKLAEHVAYVHMH 622

Query: 690 DRPDSVSQGDILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKR 749
                +    I P   +  YI +AK    PV+ E+    +++AY+ +R+  D  R  + +
Sbjct: 623 QSQPDLEFEPIEPAR-MREYIAFAKSK-RPVMNEAVNEYVIQAYIRLRQ--DSKREMDSK 678

Query: 750 IT---ATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIK 789
            +   AT R L  +IRLS+  AK+RLS+ V+++DVEEA+RL++
Sbjct: 679 FSFGQATPRTLLGIIRLSQGLAKLRLSDTVDIDDVEEALRLVR 721

>KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces
           cerevisiae YLR274w CDC46 cell division control protein,
           start by similarity
          Length = 746

 Score =  337 bits (865), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 223/677 (32%), Positives = 360/677 (53%), Gaps = 61/677 (9%)

Query: 150 ECGNSFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNL 209
           E   SF+ F++ F+L                 D    Y  QL     +    L+++  +L
Sbjct: 26  EIIKSFKSFILEFRL-----------------DSNFVYREQLRNNLLVHKYFLDVNTEHL 68

Query: 210 LAYKHTEKLFHQILYYPQEIIAIMDQTVKDC---MVSLALDNGLESYLNEIESKLFKVRP 266
           + Y   E L+ ++   P +II + +Q +      +V L+ D+ ++         L ++  
Sbjct: 69  IGY--NEDLYKKLQDEPIDIIPLFEQAITQVAKRIVLLSQDSDIDPETALSNFPLCQLIL 126

Query: 267 YNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNH--TVEVEIDRG 324
            +   +  +R L+ + + K+V I G+++ S+ +    +     C  C H  T+++   + 
Sbjct: 127 NSSSMEIPLRSLDSDHVSKIVRITGIIISSSVLTSRATQLSLMCRSCKHMTTLKLNNFQN 186

Query: 325 IIQEPVRCPR-------------VVCNSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQ 371
           +    V+ PR                  P+  ++VH    F D+Q +KLQE P+ VP G+
Sbjct: 187 LNNNNVQLPRECLADRSNETDETAASCGPDPYLIVHESSQFIDQQFLKLQELPESVPIGE 246

Query: 372 TPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVA 431
            P ++ +     L +    G R+ + GI+       +  Q   KS+  +    V I+   
Sbjct: 247 LPRNLLMTCDRYLTNQVVPGTRVTIIGIY-------SIYQSKNKSINSSGNKAVAIRNPY 299

Query: 432 KDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYE 491
              +G+      + L  N ++N   +   S  + +   E ++R D+Y++ + SIAPSIY 
Sbjct: 300 VKVIGI------KHLSNNPLNN--SLSMFSESEEQEFLELSQRPDLYELFANSIAPSIYG 351

Query: 492 LDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTS 551
             D+KK I+  L GG+ K    G R RGDIN+LL GDP T+KSQ+L++V K++P  VYTS
Sbjct: 352 NTDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPISVYTS 411

Query: 552 GKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQ 611
           GKGSSA GLTA V RD  T++  LE GA+VL+DGGV CIDEFDKM D  R  +HE MEQQ
Sbjct: 412 GKGSSAAGLTASVQRDPTTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQ 471

Query: 612 TISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKV 671
           TISIAKAGI T LN+RTS+LA+ANP+  RY+      ENID    +LSRFD++++V D  
Sbjct: 472 TISIAKAGITTVLNSRTSVLAAANPVYGRYDDLKSPGENIDFQTTILSRFDMIFIVKDDH 531

Query: 672 NEASDRELAKHLTSLYLEDRPDSVSQGDI-----LPVEFLTAYINYAKQNIHPVITESAK 726
           NEA D ++A H+ +++      +    +      +P+E +  Y++Y +    P ++  A 
Sbjct: 532 NEARDIQIANHVMNIHTGRTQQNDPNDNSNSNNEIPIETMKRYVSYCRLKCAPRLSPEAA 591

Query: 727 TELVRAYVGMRKMGDDS--RSDEK-RITATTRQLESMIRLSEAHAKMRLSERVELEDVEE 783
           T+L   ++ +RK   +S   S+E+  I  T RQLE++IR++E+ AK+ L+     + V+E
Sbjct: 592 TKLSSHFITIRKQLQESERHSNERSSIPITVRQLEAIIRITESLAKLELNPVATEKHVDE 651

Query: 784 AVRLIKSAIKDYAT-DP 799
           A+RL +++  D A+ DP
Sbjct: 652 AIRLFQASTMDAASQDP 668

>Kwal_27.12002
          Length = 833

 Score =  339 bits (870), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 224/585 (38%), Positives = 336/585 (57%), Gaps = 52/585 (8%)

Query: 247 DNGLESYLNEIESKLFK---VRPYNVETKK-------------GMRELNPNDIDKLVSIK 290
           D+ L   + E ES LF     R YN+  K               +R++  + +  L++ +
Sbjct: 173 DDELMREIAEQESDLFPPKLTRRYNLYFKPLSSAYAKKWLQPLSVRQIRGDLLGNLITAR 232

Query: 291 GLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVVC--NSPNSMVLVHN 348
           G+V R + + P + V  + C+ C + V  E++         C    C  N     + +  
Sbjct: 233 GIVTRVSDVKPSVMVNAYTCDQCGYEVFQEVNSRTFTPLAECTSEQCSQNQTKGQLFMST 292

Query: 349 RCT-FQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRS 407
           R + F   Q  K+QE  + VP G  P ++++ +   LV S   GD ++V+GI+   P   
Sbjct: 293 RASKFSAFQECKIQEMSEQVPIGHIPRTLTIHINGALVRSLTPGDVVDVTGIYMPAPYTG 352

Query: 408 NPKQRALKS--LYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDI 465
               +ALK+  L +TY++  ++ +  K       +T E                ++ E  
Sbjct: 353 F---KALKAGLLTETYLEAQYVFQHKKK-----FATFE----------------ITPETE 388

Query: 466 RRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILL 525
            R+   AR+ DVY+ L++SIAP IY   DVKK +LL L GG +K    G + RGDINI L
Sbjct: 389 ARVFNIARQGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKKVGDGMKIRGDINICL 448

Query: 526 CGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDG 585
            GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA V +D  T ++VLE GALVLSD 
Sbjct: 449 MGDPGVAKSQLLKSICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMVLEGGALVLSDN 508

Query: 586 GVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNL 645
           G+CCIDEFDKM++  R+ +HEVMEQQTISI+KAGI TTLNARTSILA+ANP+  RYNP L
Sbjct: 509 GICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRL 568

Query: 646 PVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVSQGDILPVEF 705
              ENI+LP  LLSRFD+++L+LD  N   D +LA+H+  +++ ++   +    I P + 
Sbjct: 569 SPLENINLPAALLSRFDILFLLLDTPNREDDEKLAEHVAFVHMHNKQPDLGFEPIEPSD- 627

Query: 706 LTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKRIT---ATTRQLESMIR 762
           +  +I YAK    P ++      +V++Y+ MR+  D  ++ + R +   AT R L ++IR
Sbjct: 628 MREFIAYAKTK-RPTMSSEVNEYVVQSYIRMRQ--DSKKAMDSRFSFGQATPRTLLAIIR 684

Query: 763 LSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMN 807
           LS+  AK+R S+ VE++D+EEA+RLI+ + +    + K  + D N
Sbjct: 685 LSQGLAKLRFSDIVEVDDIEEALRLIQVSKESLYQENKKSREDDN 729

>YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/P1
           family, component of the MCM complex that binds at ARS
           elements to initiate DNA replication [2328 bp, 775 aa]
          Length = 775

 Score =  334 bits (856), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 232/774 (29%), Positives = 387/774 (50%), Gaps = 105/774 (13%)

Query: 154 SFREFLMSFKLKYRKELDDQEIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYK 213
           SF+ F++ F+L                 D +  Y +QL     +   +L +++ +L+ Y 
Sbjct: 30  SFKNFILEFRL-----------------DSQFIYRDQLRNNILVKNYSLTVNMEHLIGYN 72

Query: 214 HTEKLFHQILYYPQEIIAIMDQTVKDCMVSLAL----------DNGLESYLNEIESKLFK 263
             E ++ ++   P +II + +  +      +++          D   E+   + +S L  
Sbjct: 73  --EDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDSLLLN 130

Query: 264 VRPY------NVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTV 317
             P       +   +  +R+L+   + K+V + G+++ ++ +    +     C  C HT 
Sbjct: 131 SLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTT 190

Query: 318 EVEIDR--GIIQEPVRCPRVVCNS-----------------------PNSMVLVHNRCTF 352
            + I+    I    V  PR   ++                       P+  +++H    F
Sbjct: 191 SITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKF 250

Query: 353 QDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQR 412
            D+Q +KLQE P+LVP G+ P ++++     L +    G R+ + GI+ SI    N    
Sbjct: 251 IDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIY-SIYNSKNGAGS 309

Query: 413 ALK---------SLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSE 463
                       ++   YI ++ IQ        V+TS++              +   + E
Sbjct: 310 GRSGGGNGGSGVAIRTPYIKILGIQS------DVETSSIWNS-----------VTMFTEE 352

Query: 464 DIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINI 523
           +     + +R   +Y++L+ SIAPSI+  +D+KK I+  L GG+ K    G R RGDIN+
Sbjct: 353 EEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINV 412

Query: 524 LLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLS 583
           LL GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA V RD  T++  LE GA+VL+
Sbjct: 413 LLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLA 472

Query: 584 DGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNP 643
           DGGV CIDEFDKM D  R  +HE MEQQTISIAKAGI T LN+RTS+LA+ANPI  RY+ 
Sbjct: 473 DGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDD 532

Query: 644 NLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVSQ----GD 699
                +NID    +LSRFD++++V D  NE  D  +A H+ +++  +     +Q    G 
Sbjct: 533 LKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGS 592

Query: 700 ILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRK---MGDDSRSDEKRITATTRQ 756
            + +E +  YI Y +    P ++  A  +L   +V +RK   + +   ++   I  T RQ
Sbjct: 593 EISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQ 652

Query: 757 LESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVV 816
           LE++IR++E+ AK+ LS   +   V+EA+RL +++  D A+    G ++     +G S+ 
Sbjct: 653 LEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQ---ASGTSLS 709

Query: 817 Q-RKLLEDLAREI-------LKILTERTTDTISFNELSKLINEQSQDKVESIEL 862
           + R+  ++L R +        + L     DT  F++L+      + +K E+I+L
Sbjct: 710 EIRRFEQELKRRLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQL 763

>Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement
          Length = 846

 Score =  334 bits (857), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 225/604 (37%), Positives = 340/604 (56%), Gaps = 58/604 (9%)

Query: 247 DNGLESYLNEIESKLFKVR---PYNVETKK-------------GMRELNPNDIDKLVSIK 290
           D+GL   L E ES LF  R    YN+  +               +RE+    + +L++++
Sbjct: 179 DDGLMRELAEEESNLFPARLTRRYNLYFRPLTAMYHSKYSAPLSVREIKGRYLGQLITVR 238

Query: 291 GLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVVC--NSPNSMVLVHN 348
           G++ R + + P + V  + C+ C   V  E++       + C    C  N     + +  
Sbjct: 239 GIITRVSDVKPAVLVNAYTCDQCGFEVFQEVNSRTFTPLIECTSEQCSQNQTKGQLFMST 298

Query: 349 RCT-FQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRS 407
           R + F   Q  K+QE    V  G  P ++++ V   LV S   GD ++V+GI+   P   
Sbjct: 299 RASKFSAFQECKIQELSQQVRIGHIPRTLTIHVNGSLVRSITPGDVVDVTGIYLPSPYTG 358

Query: 408 NPKQRALKS--LYKTYIDVVHIQKVAKDRVGVD-TSTVEQQLLQNQIDNVEEIRTLSSED 464
               +ALK+  L +TY+ + ++++  K     + T  VE  ++                 
Sbjct: 359 F---KALKAGLLTETYLSMQYVRQHKKKFASFEITPEVESNVM----------------- 398

Query: 465 IRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINIL 524
                E A + DVY+ L++SIAP IY   DVKK +LL L GG +K    G + RGDINI 
Sbjct: 399 -----EIASQGDVYNRLAKSIAPEIYGHLDVKKALLLLLVGGVDKKVGDGMKIRGDINIC 453

Query: 525 LCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSD 584
           L GDP  +KSQ+L+ + KI+PR VYT+GKGSS VGLTA V RD  T ++VLE GALVL+D
Sbjct: 454 LMGDPGVAKSQLLKTICKISPRSVYTTGKGSSGVGLTAAVMRDPVTDEMVLEGGALVLAD 513

Query: 585 GGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPN 644
            G+CCIDEFDKM++  R+ +HEVMEQQTISI+KAGI TTLNAR SILA+ANP+  RYNP 
Sbjct: 514 NGICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNARASILAAANPLYGRYNPR 573

Query: 645 LPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVSQGDILPVE 704
           L   +NI+LP  LLSRFD+++L+LD  N   D +LA+H+  +++ ++  ++   D  P+E
Sbjct: 574 LSPLDNINLPAALLSRFDVMFLMLDTPNREDDEKLAEHVAYVHMHNKHPTL---DFTPIE 630

Query: 705 --FLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEKRIT---ATTRQLES 759
              +  +I +AK    P + +     LV++Y+ MR+  D  R  + + +   AT R L  
Sbjct: 631 PSRMREFIAFAKTK-RPTMGQEVNEYLVQSYIRMRQ--DSKREMDSKFSFGQATPRTLLG 687

Query: 760 MIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVVQRK 819
           +IRLS+A AK+R S+ VE +DVEEA+RLI+ + +    D    K D N      +++++ 
Sbjct: 688 VIRLSQALAKLRFSDSVEADDVEEALRLIQVSKESLYQDGNKRKNDENPTTKIYTIIKKM 747

Query: 820 LLED 823
            +++
Sbjct: 748 AMDE 751

>KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces
           cerevisiae YEL032w MCM3 replication initiation protein,
           start by similarity
          Length = 931

 Score =  332 bits (852), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 215/584 (36%), Positives = 319/584 (54%), Gaps = 89/584 (15%)

Query: 276 RELNPNDIDKLVSIKGLVLRSTPIIPDM--SVAFFKCNVCNHTVEVEIDRGIIQEPVRCP 333
           R LN   ++KL+S++G+V R++ + P +  SV + +    +H  +       +   V  P
Sbjct: 148 RTLNSTHLNKLISVEGIVTRTSLVRPKLLRSVHYAQTTGHHHYRDYRDATTTLTTSVPTP 207

Query: 334 RVVC---NSPNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRA 390
            +        N +V  +  C + D Q I +QE P+  P GQ P S+ + + D+LVD  + 
Sbjct: 208 AIYPEEDQEGNKLVTEYGFCHYMDHQRITVQEMPEKAPPGQLPRSIDVILDDDLVDKTKP 267

Query: 391 GDRIEVSGIFRSIPI-------RSNPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVE 443
           GDRI + G+++S+          +N K     S ++T +            +G   +TV 
Sbjct: 268 GDRINIVGVYKSLGAGGLTGGSNNNDKGNGALSGFRTVV------------IG---NTVY 312

Query: 444 QQLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQL 503
              L  +   V  + TLS  DIR I + +   +++D LS+S+APSIY  + +KK ILL L
Sbjct: 313 P--LHARSTGVSAVETLSDNDIRNINKLSMHDNIFDTLSQSLAPSIYGHEHIKKAILLML 370

Query: 504 FGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY 563
            GG  K    G   RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA 
Sbjct: 371 MGGVEKNLPNGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIATTGRGSSGVGLTAA 430

Query: 564 VTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITT 623
           VT D +T +  LE+GA+VL+D G+ CIDEFDKM+D  R  +HEVMEQQT++IAKAGI TT
Sbjct: 431 VTTDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTT 490

Query: 624 LNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKH- 682
           LNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +N+  DR +++H 
Sbjct: 491 LNARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTDDINDIRDRAISEHV 550

Query: 683 ------LTSLYLEDRP-------------------------------------------- 692
                 L   YLE  P                                            
Sbjct: 551 LRTHRYLPPGYLEGEPVREQINLSLAVGEDIENEEEDDDEDVVFEKFNPLLHAGAKLAKN 610

Query: 693 DSVSQGDILP----VEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSDEK 748
              S G  LP    + F+  YI YAK+ I P +T+ A   ++++Y  +R   +D  + + 
Sbjct: 611 RGDSNGSELPQIVAIPFIRKYIQYAKERIIPQLTQEAVDVIIKSYSNLR---NDQNTKKS 667

Query: 749 RITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
            ITA  R LE++IRLS AHAK+RLS++VELED + A +L++ A+
Sbjct: 668 PITA--RTLETLIRLSSAHAKVRLSKKVELEDAKVATQLLRFAL 709

>Sklu_1863.1 YEL032W, Contig c1863 2885-5749
          Length = 954

 Score =  330 bits (847), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 212/587 (36%), Positives = 318/587 (54%), Gaps = 92/587 (15%)

Query: 276 RELNPNDIDKLVSIKGLVLRSTPIIPDM--SVAFFKCNVCNHTVEVEIDRGIIQEPVRCP 333
           R LN + ++KL+SI+G+V +++ + P +  SV +       H  +       +   +  P
Sbjct: 143 RTLNSHHLNKLISIEGIVTKTSLVRPKLIRSVHYADKTGRFHYRDYRDATTTLTTQIPTP 202

Query: 334 RVV-CNSP--NSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRA 390
            +     P  N +   +   T+ D Q I +QE P+  P GQ P S+ + + ++LVD  + 
Sbjct: 203 AIYPTEDPEGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPRSIDVILDEDLVDKTKP 262

Query: 391 GDRIEVSGIFRSIPI-----RSNPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQ 445
           GDRI + G+++S+        +  +Q    S ++T I    +  +     GV        
Sbjct: 263 GDRINIVGVYKSMGAGGLNGAATKEQSNALSGFRTLILGNTVYPLHARSTGVSAK----- 317

Query: 446 LLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFG 505
             QN          LS  DIR I + +++SD+++++S+S+APSIY  + +KK ILL L G
Sbjct: 318 --QN----------LSDSDIRNINKLSKKSDIFEMMSQSLAPSIYGHEQIKKAILLMLLG 365

Query: 506 GANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVT 565
           G  K  + G   RGDIN+L+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA VT
Sbjct: 366 GVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVT 425

Query: 566 RDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLN 625
            D +T +  LE+GA+VL+D G+ CIDEFDKM+D  R  +HEVMEQQT++IAKAGI TTLN
Sbjct: 426 MDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTTLN 485

Query: 626 ARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKH--- 682
           AR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +NE  DR +++H   
Sbjct: 486 ARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRAISEHVLR 545

Query: 683 ----LTSLYLEDRP-------------DSVSQ---------------------------- 697
               L   YLE  P             D + Q                            
Sbjct: 546 THRYLPPGYLEGEPIREAINLSLAVGDDDIEQMQDDEDDDEEGGKVFEKFNPLLHAGAKL 605

Query: 698 --------GDILP----VEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRS 745
                   G  +P    + FL  Y+ YAK+ I PV+T+ A   +V+ Y  +R   +DS +
Sbjct: 606 AKNRGNHHGSEIPQIVCIPFLRKYVQYAKERIAPVLTQEAIDVIVKTYSDLR---NDSNT 662

Query: 746 DEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
            +  ITA  R LE++IRLS AHAK+RLS+ VE +D   A  L++ A+
Sbjct: 663 KKSPITA--RTLETLIRLSSAHAKVRLSKIVERQDSRVAANLLRFAL 707

>Scas_710.21
          Length = 874

 Score =  328 bits (840), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 215/663 (32%), Positives = 338/663 (50%), Gaps = 73/663 (11%)

Query: 176 FINETTDQ--ELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIM 233
           F+ E TD+     Y  ++  + ++   +L ++ R+L   K    LF  +   P+E++ I 
Sbjct: 216 FLLEYTDETGRSVYGARIRTLGEMNAESLEVNYRHLAESKAILALF--LAKCPEEMLKIF 273

Query: 234 DQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLV 293
           D      +V++            I S++  VR  +  T   +REL  +++  LV + G+V
Sbjct: 274 D------LVAMEATELHYPDYARIHSEI-HVRISDFPTIHSLRELRESNLSSLVRVTGVV 326

Query: 294 LRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVV-CNSPNSMVLVHNRCTF 352
            R T + P +    F C  C   +          E ++    V C S     +   +  +
Sbjct: 327 TRRTGVFPQLKYVKFNCIKCGTILGPFFQDS--NEEIKISYCVNCKSKGPFTVNGEKTVY 384

Query: 353 QDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQR 412
           ++ Q I LQE+P  VP G+ P    + +  +LVD  + G+ +EV+GI+++    +     
Sbjct: 385 RNYQRITLQESPGTVPAGRLPRHREVILLADLVDVSKPGEEVEVTGIYKN----NYDGNL 440

Query: 413 ALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETA 472
             K+ +  +  ++    V K R G   +  E+ L         ++   + E+ R  ++ +
Sbjct: 441 NAKNGFPVFATILEANSV-KRREGNSANEGEEGL---------DVFGWTEEEEREFRKIS 490

Query: 473 RRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTS 532
           R   + D +  S+APSIY   D+K  +   LFGG  K        RGDIN+LL GDP T+
Sbjct: 491 RDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTA 550

Query: 533 KSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDE 592
           KSQIL+YV K A R V+ +G+G+SAVGLTA V +D  TK+  LE GALVL+D GVC IDE
Sbjct: 551 KSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDE 610

Query: 593 FDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENID 652
           FDKMND  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP   RYN  +P+ +N+ 
Sbjct: 611 FDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTIPLAQNVS 670

Query: 653 LPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVS---------QGD---- 699
           L  P+LSRFD++ +V D V+E +D  LA  +   +L   P+++           GD    
Sbjct: 671 LTEPILSRFDILCVVRDLVDEEADERLATFVVDSHLRSHPENIDGNLTGEGQPDGDENMD 730

Query: 700 ----------------------------ILPVEFLTAYINYAKQNIHPVITESAKTELVR 731
                                        +P E L  YI+YA+  IHP + +    ++ R
Sbjct: 731 GNNEDGVEPLSARQRRLQSQKKKEEEISPIPQELLMKYIHYARTKIHPKLHQMDMDKVSR 790

Query: 732 AYVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSA 791
            Y  +R+    + S       T R LES++R++E+ AKMRLSE V   D++ A++++  +
Sbjct: 791 VYADLRRESISTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDS 846

Query: 792 IKD 794
             D
Sbjct: 847 FVD 849

>YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 family
           of proteins involved in DNA synthesis initiation [2538
           bp, 845 aa]
          Length = 845

 Score =  327 bits (837), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 209/526 (39%), Positives = 316/526 (60%), Gaps = 42/526 (7%)

Query: 275 MRELNPNDIDKLVSIKGLVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPR 334
           +R++  + + +L++++G++ R + + P + V  + C+ C + V  E++         C  
Sbjct: 227 VRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTS 286

Query: 335 VVC--NSPNSMVLVHNRCT-FQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAG 391
             C  N     + +  R + F   Q  K+QE    VP G  P S+++ V   LV S   G
Sbjct: 287 EECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPG 346

Query: 392 DRIEVSGIFRSIPIRSNPKQRALKS--LYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQN 449
           D ++V+GIF   P       +ALK+  L +TY++   +++  K       ++        
Sbjct: 347 DIVDVTGIFLPAPYTGF---KALKAGLLTETYLEAQFVRQHKKKFASFSLTS-------- 395

Query: 450 QIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANK 509
              +VEE          R+ E     DVY+ L++SIAP IY   DVKK +LL L GG +K
Sbjct: 396 ---DVEE----------RVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDK 442

Query: 510 TFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVD 569
               G + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA V +D  
Sbjct: 443 RVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPV 502

Query: 570 TKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTS 629
           T +++LE GALVL+D G+CCIDEFDKM+++ R+ +HEVMEQQTISI+KA I T   ARTS
Sbjct: 503 TDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAVINTNPGARTS 562

Query: 630 ILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLE 689
           ILA+ANP+  R NP L   +NI+LP  LLSRFD+++L+LD  +   D +LA+H+T +++ 
Sbjct: 563 ILAAANPLYGRINPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHMH 622

Query: 690 DR-PDSVSQGDILPVE--FLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSD 746
           ++ PD     D  PVE   +  YI YAK    PV++E+    +V+AY+ +R+  D  R  
Sbjct: 623 NKQPDL----DFTPVEPSKMREYIAYAKTK-RPVMSEAVNDYVVQAYIRLRQ--DSKREM 675

Query: 747 EKRIT---ATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIK 789
           + + +   AT R L  +IRLS+A AK+RL++ V+++DVEEA+RL++
Sbjct: 676 DSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVR 721

>YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of the
           MCM/P1 family that acts as a complex at ARS sequences to
           initiate DNA replication [2607 bp, 868 aa]
          Length = 868

 Score =  325 bits (834), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 214/663 (32%), Positives = 340/663 (51%), Gaps = 73/663 (11%)

Query: 176 FINETTDQ--ELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIM 233
           F+ E TD+     Y  ++  + ++ + +L ++ R+L   K    LF  +   P+E++ I 
Sbjct: 214 FLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALF--LAKCPEEMLKIF 271

Query: 234 DQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLV 293
           D      +V++            I S++  VR  +  T   +REL  +++  LV + G+V
Sbjct: 272 D------LVAMEATELHYPDYARIHSEI-HVRISDFPTIYSLRELRESNLSSLVRVTGVV 324

Query: 294 LRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVV-CNSPNSMVLVHNRCTF 352
            R T + P +    F C  C   +          E +R      C S     +   +  +
Sbjct: 325 TRRTGVFPQLKYVKFNCLKCGSILGPFFQDS--NEEIRISFCTNCKSKGPFRVNGEKTVY 382

Query: 353 QDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQR 412
           ++ Q + LQE P  VP G+ P    + +  +LVD  + G+ +EV+GI+++     N   +
Sbjct: 383 RNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKN-NYDGNLNAK 441

Query: 413 ALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETA 472
               ++ T I+   I++    R G   +  E+ L         ++ + + E+ R  ++ +
Sbjct: 442 NGFPVFATIIEANSIKR----REGNTANEGEEGL---------DVFSWTEEEEREFRKIS 488

Query: 473 RRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTS 532
           R   + D +  S+APSIY   D+K  +   LFGG  K        RGDIN+LL GDP T+
Sbjct: 489 RDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTA 548

Query: 533 KSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDE 592
           KSQIL+YV K A R V+ +G+G+SAVGLTA V +D  TK+  LE GALVL+D GVC IDE
Sbjct: 549 KSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDE 608

Query: 593 FDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENID 652
           FDKMND  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP   RYN  LP+ +N+ 
Sbjct: 609 FDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVS 668

Query: 653 LPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPD----------------SVS 696
           L  P+LSRFD++ +V D V+E +D  LA  +   ++   P+                ++ 
Sbjct: 669 LTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIE 728

Query: 697 QGD-------------------------ILPVEFLTAYINYAKQNIHPVITESAKTELVR 731
           QG+                          +P E L  YI+YA+  I+P + +    ++ R
Sbjct: 729 QGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSR 788

Query: 732 AYVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSA 791
            Y  +R+    + S       T R LES++R++E+ AKMRLSE V   D++ A++++  +
Sbjct: 789 VYADLRRESISTGS----FPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDS 844

Query: 792 IKD 794
             D
Sbjct: 845 FVD 847

>AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH]
           complement(763632..766289) [2658 bp, 885 aa]
          Length = 885

 Score =  325 bits (833), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 213/651 (32%), Positives = 339/651 (52%), Gaps = 67/651 (10%)

Query: 176 FINETTDQ--ELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIM 233
           F+ E TD+  +  Y  ++  + +L + +L ++ R+L   K    LF  +   P+E++ I 
Sbjct: 233 FLLEYTDEYGKSVYGARIRTLGELNSESLEVNYRHLAESKAILALF--LARCPEEMLKIF 290

Query: 234 DQTVKDCMVSLALDNGLESY--LNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKG 291
           D        ++A++     Y     I S++  VR  +  T   +REL   +++ LV + G
Sbjct: 291 D--------TVAMEATQLHYPEYTRIHSEI-HVRISDFPTIHNLRELREANLNSLVRVTG 341

Query: 292 LVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVV-CNSPNSMVLVHNRC 350
           +V R T + P +    F C  C   +          E ++      C S         + 
Sbjct: 342 VVTRRTGVFPQLKYVKFNCLKCGSILGPYYQDS--NEEIKISFCTNCRSKGPFRTNMEKT 399

Query: 351 TFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPK 410
            +++ Q + LQE+P  VP G+ P    + +  +LVD  + G+ +EV+GI+++     N  
Sbjct: 400 LYRNYQRLTLQESPGTVPAGRLPRHREVILLWDLVDVAKPGEEVEVTGIYKNT-YDGNLN 458

Query: 411 QRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKE 470
            R   + +  +  V+    + +   G+ +         +  D   ++   + E+ R  ++
Sbjct: 459 AR---NGFPVFATVLEANSIKRREGGLHSG-------DDAGDEGLDVFGWTEEEEREFRK 508

Query: 471 TARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPS 530
            +R   + D +  SIAPSIY   D+K  +   LFGG  K        RGDIN+LL GDP 
Sbjct: 509 MSRDRGIIDKIISSIAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPG 568

Query: 531 TSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCI 590
           T+KSQIL+YV K A R V+ +G+G+SAVGLTA V +D  TK+  LE GALVL+D GVC I
Sbjct: 569 TAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLI 628

Query: 591 DEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTEN 650
           DEFDKMND  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP   RYN  LP+++N
Sbjct: 629 DEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLSQN 688

Query: 651 IDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDS---------------- 694
           +DL  P+LSRFD++ +V D V+E SD  LA  +   ++   P+S                
Sbjct: 689 VDLTEPILSRFDILCVVRDLVDEESDERLATFVVDSHIRSHPESDIHQEPADEDMEEADA 748

Query: 695 ----------------VSQGDILPV--EFLTAYINYAKQNIHPVITESAKTELVRAYVGM 736
                             +G+I P+  E L  YI+YA+  ++P + +    ++ + Y  +
Sbjct: 749 GTAALSNRQKKLKRHRDKEGEISPIPQEVLMKYIHYARTKVNPKLHQMDMGKVSKVYADL 808

Query: 737 RKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRL 787
           R+    + S       T R LES++R++E+ AKMRLSE V   D++ A+++
Sbjct: 809 RRESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKV 855

>Kwal_27.10174
          Length = 945

 Score =  324 bits (830), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 207/588 (35%), Positives = 310/588 (52%), Gaps = 94/588 (15%)

Query: 276 RELNPNDIDKLVSIKGLVLRSTPIIPDM--SVAFFKCNVCNHTVEVEIDRGIIQEPVRCP 333
           R LN + ++KL+SI+G+V + + + P +  SV + +     H  +       +   +  P
Sbjct: 137 RTLNSHYLNKLLSIEGIVTKVSLVRPKLLRSVHYAEKTGRFHYRDYRDATTTLITQIPTP 196

Query: 334 RVV-CNSP--NSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRA 390
            +     P  N +   +   T+ D Q I +QE P+  P GQ P S+ + + ++LVD  + 
Sbjct: 197 AIYPTEDPEGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPRSIDVIMDEDLVDKTKP 256

Query: 391 GDRIEVSGIFRSIPIRSNPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQN- 449
           GDRI + GI                  YK+          + +  G   S     +L N 
Sbjct: 257 GDRINIVGI------------------YKSLGGGGLSSSGSSNDQGSSLSGFRTMVLANT 298

Query: 450 ------QIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQL 503
                 +   V   + L+  DIR I + +++ D++D+LS+S+APSIY  D +KK ILL L
Sbjct: 299 AYPLHARSTGVAARQALTDSDIRNINKLSKKDDIFDLLSQSLAPSIYGHDHIKKAILLML 358

Query: 504 FGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY 563
            GG  K  + G   RGDIN+L+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA 
Sbjct: 359 MGGVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAA 418

Query: 564 VTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITT 623
           VT D +T +  LE+GA+VL+D G+ CIDEFDKM+D  R  +HEVMEQQT++IAKAGI TT
Sbjct: 419 VTMDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTT 478

Query: 624 LNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKH- 682
           LNAR S++A+ANP+  +Y+ N     NI LP  LLSRFDL+++V D +NE +DR +++H 
Sbjct: 479 LNARCSVIAAANPVFGQYDLNKDPHYNIALPDSLLSRFDLLFVVTDDINENTDRAISEHV 538

Query: 683 ------LTSLYLEDRPD------SVSQGD------------------------------- 699
                 L   YLE  P       S+S GD                               
Sbjct: 539 LRTHRYLPPGYLEGEPIGEAINLSLSVGDDNGFANEEEDDDDDEGKVFEKFNPLLHAGAK 598

Query: 700 ---------------ILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSR 744
                          I+ + FL  Y+ YAK+ + P++++ A   +VR Y  +R     + 
Sbjct: 599 LARNKGNRQGTELPQIVSIPFLRKYVQYAKERVVPMLSQEAVNIVVRTYTELR-----ND 653

Query: 745 SDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
            + K+   T R LE++IRL+ AHAK+RLS+ V+ ED   A  L++ A+
Sbjct: 654 QNTKKSPITPRTLETLIRLASAHAKVRLSKTVDREDARVAAHLLRFAL 701

>KLLA0F12584g complement(1165710..1168343) similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2 member of the
           MCM2P, MCM3P, CDC46P family, start by similarity
          Length = 877

 Score =  322 bits (826), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 214/655 (32%), Positives = 338/655 (51%), Gaps = 73/655 (11%)

Query: 176 FINETTDQ--ELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIM 233
           F+ E TD+  +  Y  ++  + ++ + +L ++ R+L+  K    LF  +   P+E++ I 
Sbjct: 224 FLLEYTDESGKSVYGARIRTLGEMNSESLEVNYRHLVESKAILALF--LAKSPEEMLKIF 281

Query: 234 DQTVKDCMVSLALDNGLESY--LNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKG 291
           D        ++A++     Y     I S++  VR  +  +   +R L    ++ LV + G
Sbjct: 282 D--------TVAMEATQLHYPDYTRIHSEI-HVRISDFPSILNLRALRETHLNSLVRVSG 332

Query: 292 LVLRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVV-CNSPNSMVLVHNRC 350
           +V R T + P +    F C  C  T+          E ++      C S     +   + 
Sbjct: 333 VVTRRTGVFPQLKYVKFNCLKCGATLGPYYQDS--NEEIKISFCTNCRSKGPFRINMEKT 390

Query: 351 TFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPK 410
            +++ Q I +QE+P  VP G+ P    + +  +LVD  + G+ +EV+GI+++    +   
Sbjct: 391 LYRNYQRITIQESPGSVPAGRLPRHREVILLWDLVDIAKPGEEVEVTGIYKN----TYDG 446

Query: 411 QRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKE 470
               K+ +  +  V+    V +   G+      + L         +  + + ++ R  ++
Sbjct: 447 NLNAKNGFPVFATVLEANSVKRREGGLHDGDEHEGL---------DAFSWTEDEEREFRK 497

Query: 471 TARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPS 530
            +R   + D +  S+APSIY   D+K  I   LFGG  K        RGDINILL GDP 
Sbjct: 498 MSRDRGIIDKIISSMAPSIYGHRDIKTAIACSLFGGVPKNINGKHSIRGDINILLLGDPG 557

Query: 531 TSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCI 590
           T+KSQIL+YV K A R V+ +G+G+SAVGLTA V +D  TK+  LE GALVL+D GVC I
Sbjct: 558 TAKSQILKYVEKTANRAVFATGQGASAVGLTASVRKDQITKEWTLEGGALVLADKGVCLI 617

Query: 591 DEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTEN 650
           DEFDKMND  R+ +HE MEQQ+ISI+KAGI+TTL AR SILA+ANPI  RYN  LP+++N
Sbjct: 618 DEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSILAAANPIGGRYNSTLPLSQN 677

Query: 651 IDLPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSV--------------- 695
           ++L  P+LSRFD++ +V D V+E SD  LA  +   ++   PD                 
Sbjct: 678 VNLTEPILSRFDILCVVRDLVDEESDNRLASFVVDSHIRSHPDKDLDDFDDGNVPTENPN 737

Query: 696 SQGD---------------------ILPV--EFLTAYINYAKQNIHPVITESAKTELVRA 732
            +GD                     I P+    L  YI+YA+  ++P + +    ++ R 
Sbjct: 738 GEGDEETPLSAKQRRLQNLRKREEEISPISQHMLMKYIHYARTKVYPKLHQMDMDKVSRV 797

Query: 733 YVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRL 787
           Y  +R+    + S       T R LES++R++EA AKMRLSE V   D++ A+++
Sbjct: 798 YADLRRESVTTGS----FPITVRHLESILRIAEAFAKMRLSEFVSSWDLDRAIKV 848

>Sklu_2087.4 YBL023C, Contig c2087 7202-9856
          Length = 884

 Score =  320 bits (819), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 213/656 (32%), Positives = 340/656 (51%), Gaps = 69/656 (10%)

Query: 176 FINETTDQ--ELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIM 233
           F+ E TD+  +  Y  ++  + ++ + +L ++ R+L   K    LF  +   P+E++ I 
Sbjct: 222 FLLEYTDESGKSVYGARIRTLGEVNSESLEVNYRHLAESKAILALF--LAKCPEEMLKIF 279

Query: 234 DQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLV 293
           D      +V++          + I S++  VR  +  T   +REL  ++++ LV + G+V
Sbjct: 280 D------LVAMEATELHYPDYSRIHSEI-HVRISDFPTVHNLRELRESNLNSLVRVTGVV 332

Query: 294 LRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVV-CNSPNSMVLVHNRCTF 352
            R T + P +    F C  C   +          E V+      C S         +  +
Sbjct: 333 TRRTGVFPQLKYVKFNCLKCGSILGPFFQDS--NEEVKISFCTNCRSKGPFRTNAEKTLY 390

Query: 353 QDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQR 412
           ++ Q I LQE P  VP G+ P    + +  +LVD  + G+ +EV+G++++     N   +
Sbjct: 391 RNYQRITLQEAPGTVPAGRLPRHREVILLWDLVDVAKPGEEVEVTGVYKNT-YDGNLNAK 449

Query: 413 ALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETA 472
               ++ T I+   I++    R+  ++   E+ L         +  + + E+ R  +  +
Sbjct: 450 NGFPVFATVIEANSIKRREGGRISNESIEDEEGL---------DPFSWTEEEEREFRRMS 500

Query: 473 RRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTS 532
           R   + D +  S+APSIY   D+K  +   LFGG  K        RGDIN+LL GDP T+
Sbjct: 501 RDRAIIDKIISSMAPSIYGHKDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTA 560

Query: 533 KSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDE 592
           KSQIL+Y+ K A R V+ +G+G+SAVGLTA V +D  T++  LE GALVL+D GVC IDE
Sbjct: 561 KSQILKYIEKTAHRAVFATGQGASAVGLTASVRKDPITREWTLEGGALVLADKGVCLIDE 620

Query: 593 FDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENID 652
           FDKMND  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP   RYN  LP+ +N+D
Sbjct: 621 FDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVD 680

Query: 653 LPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDS------------------ 694
           L  P+LSRFD++ +V D V+E +D  LA  + S ++   PDS                  
Sbjct: 681 LTEPILSRFDILCVVRDLVDEEADERLATFVVSSHVRSHPDSDRLREDPQDDDLDQQTED 740

Query: 695 ---------------------VSQGDILPV--EFLTAYINYAKQNIHPVITESAKTELVR 731
                                  +G+I P+  + L  YI+YA+  I+P + +    ++ R
Sbjct: 741 EREDDEPAPMSARQKRLQRQREKEGEISPIPQDTLMKYIHYARIKIYPKLHQMDMDKVSR 800

Query: 732 AYVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRL 787
            Y  +R+    + S       T R LES++R++E+ AKMRLSE V   D++ A+++
Sbjct: 801 VYADLRRESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKV 852

>CAGL0J04444g 417656..420295 highly similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2, start by
           similarity
          Length = 879

 Score =  318 bits (815), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 210/656 (32%), Positives = 339/656 (51%), Gaps = 66/656 (10%)

Query: 176 FINETTDQ--ELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIM 233
           F+ E TD+     Y  ++  + ++ + +L ++ R+L   K    LF  +   P+E++ I 
Sbjct: 231 FLLEYTDETGRSVYGARIRVLGEMNSESLEVNFRHLAESKAILALF--LAKCPEEMLKIF 288

Query: 234 DQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLV 293
           D      +V++          + I S++  VR  +  T   +REL  +++  LV + G+V
Sbjct: 289 D------LVAMEATELHYPDYSRIHSEI-HVRISDFPTIHNLRELRQSNLSTLVRVTGVV 341

Query: 294 LRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVV-CNSPNSMVLVHNRCTF 352
            R T + P +    F C  C   +          E ++      C S     +   +  +
Sbjct: 342 TRRTGVFPQLKYVKFNCLKCGSILGPFFQDS--NEEIKISFCTNCKSKGPFSINGEKTVY 399

Query: 353 QDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQR 412
           ++ Q I LQE P  VP G+ P    + +  +LVD  + G+ IEV+GI+++     N   +
Sbjct: 400 RNYQRITLQEAPGTVPAGRLPRHREVILLADLVDVSKPGEEIEVTGIYKN-NYDGNLNAK 458

Query: 413 ALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETA 472
               ++ T I+   +++              +  L N+ +    + + + E+ R  ++ +
Sbjct: 459 NGFPVFATIIEANAVRR-------------REGNLANENEEGLNVFSWTEEEEREFRKLS 505

Query: 473 RRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTS 532
           +   + D +  S+APSIY   D+K  +   LF G  K        RGDIN+L+ GDP T+
Sbjct: 506 KDRGIVDKIIASMAPSIYGHKDIKTAVACSLFSGVPKNINGKHAIRGDINVLVLGDPGTA 565

Query: 533 KSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDE 592
           KSQIL+YV K A R V+ +G+G+SAVGLTA V +D  TK+  LE GALVL+D GVC IDE
Sbjct: 566 KSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDE 625

Query: 593 FDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENID 652
           FDKMND  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP   RYN  LP+++N+ 
Sbjct: 626 FDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLSQNVS 685

Query: 653 LPPPLLSRFDLVYLVLDKVNEASDRELAKHLTSLYLEDRP--DSV-----------SQGD 699
           L  P+LSRFD++ +V D V+E SD  LA  +   ++   P  DS+           +  D
Sbjct: 686 LTEPILSRFDILCVVRDVVDEESDERLASFVVDSHVRSHPGYDSIDDEEGKDGEQKNDDD 745

Query: 700 I---------------------LPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRK 738
           I                     +P E L  YI+YA+  ++P + +    ++ + Y  +R+
Sbjct: 746 IQLSNRQKRAERQRKKEEEISPIPQELLIKYIHYARTKVYPRLHQMDMDKVSKVYADLRR 805

Query: 739 MGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAIKD 794
               + S       T R LES++R++E+ AKMRLSE V   D++ A++++  +  D
Sbjct: 806 ESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFVD 857

>Kwal_14.2090
          Length = 860

 Score =  316 bits (809), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 219/652 (33%), Positives = 329/652 (50%), Gaps = 68/652 (10%)

Query: 176 FINETTDQ--ELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIM 233
           F+ E TD+     Y  ++  + +L + +L ++ R+L   K    LF  +   P+E++ I 
Sbjct: 204 FLLEYTDEWGRSVYGARIRTLGELNSESLEVNYRHLAESKAILALF--LAKCPEEMLKIF 261

Query: 234 DQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLV 293
           D    D       D         I +++  VR  +  T   +REL  ++++ LV + G+V
Sbjct: 262 DIVAMDATQLHYPDYA------RIHAEI-HVRISDFPTVLNLRELRESNLNSLVRVTGVV 314

Query: 294 LRSTPIIPDMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVV-CNSPNSMVLVHNRCTF 352
            R T + P +    F C  C   +          E ++      C S         +  +
Sbjct: 315 TRRTGVFPQLKYVKFNCLKCGAVLGPYFQDS--NEEIKISFCTNCRSKGPFRTNAEKTLY 372

Query: 353 QDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQR 412
           ++ Q + LQE P  VP G+ P    + +  +LVD  + G+ IEV+GI+++     N   R
Sbjct: 373 RNYQRLTLQEAPGTVPAGRLPRHREVILLWDLVDIAKPGEEIEVTGIYKNT-YDGNLNAR 431

Query: 413 ALKSLYKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDNVEEIRTLSSEDIRRIKETA 472
               ++ T I+   +++    R   D    E+ L         ++   + E+ R  ++ +
Sbjct: 432 NGFPVFATIIEANAVRRREGGRRSGDD---EEGL---------DVFGWTEEEEREFRKLS 479

Query: 473 RRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTS 532
           R   + D +  SIAPSIY   D+K  +   LF G  K        RGDIN+LL GDP T+
Sbjct: 480 RDRGIIDKVISSIAPSIYGHKDIKTAVACALFSGVPKNVNGKHSIRGDINVLLLGDPGTA 539

Query: 533 KSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDE 592
           KSQIL+YV K A R V+ +G+G+SAVGLTA V +D  T++  LE GALVL+D GVC IDE
Sbjct: 540 KSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITREWTLEGGALVLADKGVCLIDE 599

Query: 593 FDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENID 652
           FDKMND  R+ +HE MEQQ ISI+KAGI+T+L AR SI+A+ANP   RYN  LP+ +N+D
Sbjct: 600 FDKMNDQDRTSIHEAMEQQNISISKAGIVTSLQARCSIIAAANPNGGRYNSALPLAQNVD 659

Query: 653 LPPPLLSRFDLVYLVLDKVNEASDRELAK-----HLTSLYLEDR---------------- 691
           L  P+LSRFD++ +V D V+E  D  LA+     HL S  L DR                
Sbjct: 660 LTEPILSRFDILCVVRDLVDEVKDERLARFVVDSHLRSHPLHDRLDDGDDDDGDNDAMNE 719

Query: 692 ----PDSVSQG------------DILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVG 735
               P S  Q               +P E L  YI YA+  + P + +    ++ R Y  
Sbjct: 720 DANEPLSARQRRQQKDREREEEISPIPQETLMKYIQYARTRVFPKLHQMDMDKVSRVYAD 779

Query: 736 MRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRL 787
           +R+    + S       T R LES++R+SE+ AKMRLSE V   D++ A+++
Sbjct: 780 LRRESITTGS----FPITVRHLESILRISESFAKMRLSEFVSSWDLDRAIKV 827

>AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH]
           (1082128..1084959) [2832 bp, 943 aa]
          Length = 943

 Score =  312 bits (800), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 211/586 (36%), Positives = 314/586 (53%), Gaps = 91/586 (15%)

Query: 276 RELNPNDIDKLVSIKGLVLRSTPIIPDM--SVAFFKCNVCNHTVEVEIDRGIIQEPVRCP 333
           R L    +++LVSI+G+V R++ + P +  SV   K    ++  +       +   V  P
Sbjct: 138 RTLMATHLNQLVSIEGIVTRTSIVRPKLLRSVHLSKNTGAHYYRDYRDATTTLVTEVPTP 197

Query: 334 RVVCNS---PNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRA 390
            +   +    N +   +   T+ D Q + +QE P+  P GQ P SV + + D+LVD  + 
Sbjct: 198 AIYPEADPEGNPLNTEYGYSTYMDHQRVTVQEMPEKAPPGQLPRSVDVILDDDLVDKTKP 257

Query: 391 GDRIEVSGIFRSIPIRSNPKQRALK------SLYKTYIDVVHIQKVAKDRVGVDTSTVEQ 444
           GDR+ + G+F+SI         +        + +KT I    +  +     GV  S    
Sbjct: 258 GDRVNIVGVFKSIGAGGMSGGSSSDHGNNGLAGFKTLIIGNTVYPLHARSTGVAAS---- 313

Query: 445 QLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLF 504
                          LS  DIR I + A+ +DV+D+L++S+APSIY  + +KK +LL L 
Sbjct: 314 -------------ERLSDTDIRNINKLAKSADVFDLLAQSLAPSIYGHEHIKKAVLLMLM 360

Query: 505 GGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYV 564
           GG  K  + G   RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA V
Sbjct: 361 GGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIATTGRGSSGVGLTAAV 420

Query: 565 TRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTL 624
           T D +T +  LE+GA+VL+D G+ CIDEFDKM+D  R  +HEVMEQQT++IAKAGI TTL
Sbjct: 421 TMDRETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTTL 480

Query: 625 NARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKH-- 682
           NAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +N+  DR +++H  
Sbjct: 481 NARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTDDINDVRDRAISEHVL 540

Query: 683 -----LTSLYLEDRP-------------DSVS---------------------------- 696
                L   Y+E  P             D VS                            
Sbjct: 541 RTHRYLPPGYMEGEPIREAINLSLSVGTDGVSIDPDADDDTTDKVFEKYDPLLHAGAKLA 600

Query: 697 --QGD--------ILPVEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGDDSRSD 746
             +GD        ++ + F+  Y+ YAK+ I PV+T+ A   +V+ Y  +R   +D  + 
Sbjct: 601 KNRGDHRGAELPKVVSIPFIRKYVQYAKERIVPVLTQDAVNIIVKTYCDLR---NDQNTK 657

Query: 747 EKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
           +  ITA  R LE++IRLS AHAK+RLS+ VE  D   A +L++ A+
Sbjct: 658 KSPITA--RTLETLIRLSNAHAKVRLSKLVEARDANVAAQLLRFAL 701

>Scas_499.2
          Length = 985

 Score =  311 bits (797), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 209/591 (35%), Positives = 311/591 (52%), Gaps = 96/591 (16%)

Query: 276 RELNPNDIDKLVSIKGLVLRSTPIIPDM--SVAFFKCNVCNHTVEVEIDRGIIQEPVRCP 333
           R LN   ++KL+SI+G+V R++ + P +  SV + +     H  +       +   +  P
Sbjct: 177 RTLNSQFLNKLISIEGIVTRTSLVRPKLIRSVHYAEKTGRFHYRDYTDATTTLTTKIPTP 236

Query: 334 RVVCNS---PNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRA 390
            +        N ++  +   TF D Q I +QE P++ P GQ P S+ + + D+LVD  + 
Sbjct: 237 AIYPTEDTDGNKLITEYGYSTFVDHQRITIQEMPEMAPAGQLPRSIDVILDDDLVDKTKP 296

Query: 391 GDRIEVSGIFRSIPIRSNPKQR--------ALKSLYKTYIDVVHIQKVAKDRVGVDTSTV 442
           GDR+ V G+F+S+                 A  S ++T I    +  +     GV     
Sbjct: 297 GDRVNVIGVFKSLGAGGLNNGGNGGGADSGASMSGFRTLIIGNTVYPLHARSTGVSAR-- 354

Query: 443 EQQLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQ 502
                          +TL+  DIR I + +++ D++DVL++S+APSIY  + +K+ ILL 
Sbjct: 355 ---------------QTLTDFDIRNINKLSKKKDIFDVLAQSLAPSIYGHEHIKRAILLM 399

Query: 503 LFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTA 562
           L GG  K  + G   RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA
Sbjct: 400 LMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTA 459

Query: 563 YVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIIT 622
            VT D +T +  LE+GA+VL+D GV CIDEFDKM D  R  +HEVMEQQT++IAKAGI T
Sbjct: 460 AVTNDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHT 519

Query: 623 TLNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELA-- 680
           TLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +NE  DR ++  
Sbjct: 520 TLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEH 579

Query: 681 -----KHLTSLYL------------------------------EDRPDSVSQ-------- 697
                ++L   YL                              ED  D V +        
Sbjct: 580 VLRTHRYLPPGYLEGEPIRERLNLSLAVGVDDNINEENKDGGEEDEEDQVFEKFNPLLQA 639

Query: 698 ------------GDILP----VEFLTAYINYAKQNIHPVITESAKTELVRAYVGMRKMGD 741
                       G  +P    + FL  Y+ YAK+ + P +T+ A   +V+ Y  +R   +
Sbjct: 640 GAKLAKNKGNHNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQQAIDVIVKNYADLR---N 696

Query: 742 DSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
           D  + +  ITA  R LE++IRL+ AHAK+RLS+ V   D   A  L++ A+
Sbjct: 697 DENTKKSPITA--RTLETLIRLATAHAKVRLSKTVNKRDANVAAGLLRYAL 745

>YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1
           family, part of the MCM complex that assembles at ARS
           elements to initiate replication [2916 bp, 971 aa]
          Length = 971

 Score =  296 bits (758), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 211/587 (35%), Positives = 311/587 (52%), Gaps = 88/587 (14%)

Query: 276 RELNPNDIDKLVSIKGLVLRSTPIIPDM--SVAFFKCNVCNHTVEVEIDRGIIQEPVRCP 333
           R L    ++KLVS++G+V +++ + P +  SV +       H  +       +   +  P
Sbjct: 169 RTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTP 228

Query: 334 RVVCNS---PNSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDELVDSCRA 390
            +        N +   +   TF D Q I +QE P++ P GQ P S+ + + D+LVD  + 
Sbjct: 229 AIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKP 288

Query: 391 GDRIEVSGIFRSIPIRSNPKQRALKSL--YKTYIDVVHIQKVAKDRVGVDTSTVEQQLLQ 448
           GDR+ V G+F+S+       Q    +L  +KT I    +  +     GV      +Q+  
Sbjct: 289 GDRVNVVGVFKSLGA-GGMNQSNSNTLIGFKTLILGNTVYPLHARSTGV----AARQM-- 341

Query: 449 NQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQLFGGAN 508
                      L+  DIR I + +++ D++D+LS+S+APSIY  D +KK ILL L GG  
Sbjct: 342 -----------LTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVE 390

Query: 509 KTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDV 568
           K  + G   RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA VT D 
Sbjct: 391 KNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDR 450

Query: 569 DTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITTLNART 628
           +T +  LE+GA+VL+D GV CIDEFDKM D  R  +HEVMEQQT++IAKAGI TTLNAR 
Sbjct: 451 ETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARC 510

Query: 629 SILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKH------ 682
           S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +NE  DR +++H      
Sbjct: 511 SVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHR 570

Query: 683 -LTSLYLEDRPD------SVSQG---DILPVEFLTAYI----------NYAKQNIHPVIT 722
            L   YLE  P       S++ G   DI P E   +            ++  +  +P++ 
Sbjct: 571 YLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLLQ 630

Query: 723 ESAK----------TEL--------VRAYVGMRKMG-----------------DDSRSDE 747
             AK          TE+        +R YV   K                    D R+D+
Sbjct: 631 AGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDD 690

Query: 748 --KRITATTRQLESMIRLSEAHAKMRLSERVELEDVEEAVRLIKSAI 792
             K+   T R LE++IRL+ AHAK+RLS+ V   D + A  L++ A+
Sbjct: 691 NTKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFAL 737

>CAGL0L01397g 152718..155555 highly similar to sp|P24279
           Saccharomyces cerevisiae YEL032w MCM3 replication
           initiation protein, hypothetical start
          Length = 945

 Score =  283 bits (725), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 179/487 (36%), Positives = 279/487 (57%), Gaps = 38/487 (7%)

Query: 217 KLFHQILYYPQEIIAIMDQTVKDCMVSLALDNGLESYLNEIESKLFKVRPYNVETKK--G 274
           K +  +L  P   I   ++ + +  ++ ALD+   + ++ + +K    RP+ +  K   G
Sbjct: 102 KFWRGVLNEPAYYIPPAERALSE--IATALDDSPRNTVDAVSAK----RPWRLSFKGSFG 155

Query: 275 MRELNPNDID-----KLVSIKGLVLRSTPIIPDM--SVAFFKCNVCNHTVEVEIDRGIIQ 327
              L+P  ++     KLVSI+G+V +++ + P +  SV + +     H  +       + 
Sbjct: 156 SHTLSPGTLNAMYLNKLVSIEGIVTKTSLVRPKLMRSVHYAEKTGRFHYRDYTDSTTSLT 215

Query: 328 EPVRCPRVV-CNSP--NSMVLVHNRCTFQDRQVIKLQETPDLVPDGQTPHSVSLCVYDEL 384
             V  P +     P  N +   +   T+ D Q I +QE P++   G  P SV + + D+L
Sbjct: 216 TRVPTPAIYPTEDPDGNKLTTEYGFSTYIDHQRITVQEMPEMAQVGPVPRSVDIILDDDL 275

Query: 385 VDSCRAGDRIEVSGIFRSIPIRS-NPKQRALKSLYKTYIDVVHIQKVAKDRVGVDTSTVE 443
           VD  + GDRI V G+F+S+     N  +    + ++T I    +  +     GV      
Sbjct: 276 VDKTKPGDRINVVGVFKSVGAGGLNQGESNTLNGFRTLIIGNSVYPLHARSTGVSAK--- 332

Query: 444 QQLLQNQIDNVEEIRTLSSEDIRRIKETARRSDVYDVLSRSIAPSIYELDDVKKGILLQL 503
                          TL+  DIR I + ++R D++++L++S+APSIY  +++K+ +LL L
Sbjct: 333 --------------ETLNDLDIRNINKLSKRGDIFEILAQSLAPSIYGHENIKRAVLLML 378

Query: 504 FGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAY 563
           FGG  K  + G   RGDINIL+ GDPST+KSQ+L++V   A   + T+G+GSS VGLTA 
Sbjct: 379 FGGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTASLAIATTGRGSSGVGLTAA 438

Query: 564 VTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDNTRSVLHEVMEQQTISIAKAGIITT 623
           VT D +T +  LE+GA+VL+D G+ CIDEFDKM D  R  +HEVMEQQT++IAKAGI TT
Sbjct: 439 VTTDRETGERRLEAGAMVLADRGIVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTT 498

Query: 624 LNARTSILASANPINSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVNEASDRELAKHL 683
           LN+R S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +NEA DR +++H+
Sbjct: 499 LNSRCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEARDRSISEHV 558

Query: 684 --TSLYL 688
             T  YL
Sbjct: 559 LRTHRYL 565

>KLLA0E14278g complement(1260247..1261668) similar to sp|P43635
           Saccharomyces cerevisiae YPR001w CIT3 citrate
           (si)-synthase, mitochondrial, start by similarity
          Length = 473

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 60/124 (48%), Gaps = 11/124 (8%)

Query: 747 EKRITATTRQLESMIRLSEAHAKMR----LSERVE---LEDVEEAVRLIKSAIKDYATDP 799
           EK +T+  R +  M +L+ A A M      +E+ +   +  ++    + +  +   A  P
Sbjct: 144 EKLLTSLPRDMHPMTQLAIALASMNKGSIFAEKYQEGSIGKMDYWEYVYEDVLNLIAALP 203

Query: 800 K-TGKIDMNLVQTGKSVVQRKLLEDLAREILKILTERTTDTISFNELSKLINEQSQDKVE 858
           K TGKI  N+V  G+ +    + +D +  I  +L    +D+++ + L++   E+S D V 
Sbjct: 204 KITGKIYSNIVNDGEPLGHYNVEKDWSYNIASLLGMTVSDSVNMHSLTQ---ERSNDFVN 260

Query: 859 SIEL 862
            + L
Sbjct: 261 LVRL 264

>CAGL0M03707g 415143..420122 similar to sp|P48563 Saccharomyces
            cerevisiae YNL297c MON2, hypothetical start
          Length = 1659

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 2/28 (7%)

Query: 475  SDVYDVLSRSI--APSIYELDDVKKGIL 500
            SD YD+L R+I  A  IYE DD++K IL
Sbjct: 1465 SDHYDLLVRNIWDASLIYEFDDIQKAIL 1492

>YHR004C (NEM1) [2289] chr8 complement(111748..113088) Protein
           required for nuclear morphology [1341 bp, 446 aa]
          Length = 446

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 174 EIFINETTDQELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFH 220
           E +I++ TD +L     LN +  L     + D+RN+LA KH EK F+
Sbjct: 403 EGWISDPTDTDL-----LNLLPFLEAMRYSTDVRNILALKHGEKAFN 444

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,888,264
Number of extensions: 1057209
Number of successful extensions: 4211
Number of sequences better than 10.0: 75
Number of HSP's gapped: 4245
Number of HSP's successfully gapped: 90
Length of query: 879
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 769
Effective length of database: 12,788,129
Effective search space: 9834071201
Effective search space used: 9834071201
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)