Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C17490g45244523270.0
Sklu_1960.448743214080.0
Kwal_56.2313149642613890.0
Sklu_2175.249542313660.0
Scas_633.749642313580.0
YBR139W50844113530.0
KLLA0E17897g49142013510.0
AER022W52443313410.0
AGL328C56342711431e-152
KLLA0A09977g53545011151e-148
Scas_684.2153443111111e-148
Sklu_2263.552842611081e-147
YMR297W (PRC1)53242710911e-145
Kwal_26.945552542010561e-140
CAGL0M13651g50842410441e-138
AFR549W5994163825e-40
Scas_712.477034323793e-39
Kwal_47.189937034083661e-37
KLLA0F09999g6424283572e-36
YGL203C (KEX1)7294283502e-35
CAGL0G01232g7304013352e-33
AEL056W654104720.85
CAGL0E01573g90449711.1
Sklu_1897.430783682.1
YJR132W (NMD5)104862683.1
Scas_645.435135663.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C17490g
         (445 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C17490g 1536197..1537555 similar to sp|P38109 Saccharomyces...   900   0.0  
Sklu_1960.4 , Contig c1960 4905-6368                                  546   0.0  
Kwal_56.23131                                                         539   0.0  
Sklu_2175.2 YBR139W, Contig c2175 1128-2615 reverse complement        530   0.0  
Scas_633.7                                                            527   0.0  
YBR139W (YBR139W) [325] chr2 (515620..517146) Protein with simil...   525   0.0  
KLLA0E17897g 1581075..1582550 similar to sp|P38109 Saccharomyces...   525   0.0  
AER022W [2527] [Homologous to ScYBR139W - SH] complement(669446....   521   0.0  
AGL328C [3984] [Homologous to ScYMR297W (PRC1) - SH] (95027..967...   444   e-152
KLLA0A09977g 876594..878201 similar to sp|P00729 Saccharomyces c...   434   e-148
Scas_684.21                                                           432   e-148
Sklu_2263.5 YMR297W, Contig c2263 5721-7307                           431   e-147
YMR297W (PRC1) [4251] chr13 (861921..863519) Carboxypeptidase Y ...   424   e-145
Kwal_26.9455                                                          411   e-140
CAGL0M13651g 1339781..1341307 similar to sp|P00729 Saccharomyces...   406   e-138
AFR549W [3741] [Homologous to ScYGL203C (KEX1) - SH] complement(...   151   5e-40
Scas_712.47                                                           150   3e-39
Kwal_47.18993                                                         145   1e-37
KLLA0F09999g complement(923413..925341) similar to sp|P09620 Sac...   142   2e-36
YGL203C (KEX1) [1792] chr7 complement(112477..114666) Carboxypep...   139   2e-35
CAGL0G01232g complement(114924..117116) similar to sp|P09620 Sac...   133   2e-33
AEL056W [2450] [Homologous to NOHBY] complement(531590..533554) ...    32   0.85 
CAGL0E01573g complement(148847..151561) similar to sp|P42842 Sac...    32   1.1  
Sklu_1897.4 YAL009W, Contig c1897 4338-5261                            31   2.1  
YJR132W (NMD5) [3023] chr10 (669437..672583) Member of the karyo...    31   3.1  
Scas_645.4                                                             30   3.9  

>KLLA0C17490g 1536197..1537555 similar to sp|P38109 Saccharomyces
           cerevisiae YBR139w, hypothetical start
          Length = 452

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/445 (97%), Positives = 433/445 (97%)

Query: 1   MKWIYTFIAAVSATVTFHPENVEYSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWF 60
           MKWIYTFIAAVSATVTFHPENVEYSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWF
Sbjct: 1   MKWIYTFIAAVSATVTFHPENVEYSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWF 60

Query: 61  FESRNDPANDPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLD 120
           FESRNDPANDPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLD
Sbjct: 61  FESRNDPANDPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLD 120

Query: 121 QPVNVGFSYSEERVKTTNDAARDVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAH 180
           QPVNVGFSYSEERVKTTNDAARDVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAH
Sbjct: 121 QPVNVGFSYSEERVKTTNDAARDVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAH 180

Query: 181 EIVSVHKDDTKFNLSSIVIGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNL 240
           EIVSVHKDDTKFNLSSIVIGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNL
Sbjct: 181 EIVSVHKDDTKFNLSSIVIGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNL 240

Query: 241 ACKGXXXXXXXXXXXXACVSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLG 300
           ACKG            ACVSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLG
Sbjct: 241 ACKGLTSLCSKTKLTLACVSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLG 300

Query: 301 YIRSYLNQEFVQDALGTKVSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIY 360
           YIRSYLNQEFVQDALGTKVSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIY
Sbjct: 301 YIRSYLNQEFVQDALGTKVSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIY 360

Query: 361 AGDTDYICNWLGNMAWTDALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVF 420
           AGDTDYICNWLGNMAWTDALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVF
Sbjct: 361 AGDTDYICNWLGNMAWTDALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVF 420

Query: 421 EAGHTVPYYQPLATMEMINRWISGD 445
           EAGHTVPYYQPLATMEMINRWISGD
Sbjct: 421 EAGHTVPYYQPLATMEMINRWISGD 445

>Sklu_1960.4 , Contig c1960 4905-6368
          Length = 487

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/432 (58%), Positives = 319/432 (73%)

Query: 14  TVTFHPENVEYSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWFFESRNDPANDPVI 73
           T   HPEN +Y++  K++DPA LGID VNQWSGYLDY+D KH FYWFFESRNDPANDPVI
Sbjct: 50  TTLSHPENSDYAIRIKKVDPAKLGIDKVNQWSGYLDYKDSKHFFYWFFESRNDPANDPVI 109

Query: 74  LYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSEER 133
           L+LNGGPGCSS+  LFFE GP+SIG D+KP+H PYSWNNNASIIFL+QP+ VGFSY +++
Sbjct: 110 LWLNGGPGCSSLTGLFFELGPSSIGSDVKPVHKPYSWNNNASIIFLEQPLGVGFSYGDDK 169

Query: 134 VKTTNDAARDVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSVHKDDTKFN 193
           + +T  AA+DVY FL+LFF KFP+   N+FHIAGESYAGHYIP+IAHEIV  H     FN
Sbjct: 170 ITSTELAAKDVYVFLELFFQKFPHWIRNSFHIAGESYAGHYIPQIAHEIVVNHDGIAPFN 229

Query: 194 LSSIVIGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXX 253
           LSS++IGNG+TDPL+Q  Y+  MACGEGGY ++L P KC+ M  +   C           
Sbjct: 230 LSSVLIGNGITDPLIQFSYYPKMACGEGGYHSVLTPEKCQQMKDTLPRCIELAKACYATR 289

Query: 254 XXXACVSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEFVQD 313
               C++AST+C   +  P  ++ +N  DIR  CE  ++GLC+K L Y+  +LNQ +VQ+
Sbjct: 290 QNFICIAASTYCTSKMYGPYKETGLNVYDIRTTCEASDAGLCYKGLDYVSEFLNQPYVQE 349

Query: 314 ALGTKVSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGN 373
           ALG++V SY GCN  V + F LTGD+S+PFQQ+V EL D +IPVL+Y+GD DYICNWLGN
Sbjct: 350 ALGSEVQSYVGCNRDVSAGFSLTGDHSKPFQQFVGELADRDIPVLLYSGDKDYICNWLGN 409

Query: 374 MAWTDALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLA 433
            AW+D L WK    ++  PL P+ S       GEVKN+GP TFLRV++AGH VPY QP  
Sbjct: 410 HAWSDELDWKFKDQFQISPLKPFLSKETGEVAGEVKNYGPLTFLRVYDAGHMVPYDQPER 469

Query: 434 TMEMINRWISGD 445
           ++EM+NRWISGD
Sbjct: 470 SLEMVNRWISGD 481

>Kwal_56.23131
          Length = 496

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/426 (57%), Positives = 308/426 (72%)

Query: 20  ENVEYSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWFFESRNDPANDPVILYLNGG 79
            +  YS+  K++DP+ LG+D+VNQ+SGYLDY+D KH FYW FESRNDP NDP+IL+LNGG
Sbjct: 66  RDASYSMRMKKVDPSKLGVDSVNQYSGYLDYEDSKHFFYWMFESRNDPRNDPIILWLNGG 125

Query: 80  PGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSEERVKTTND 139
           PGCSS   LFFE GP+SIGP+LKP+HNPYSWNNNA++IFL+QP+ VGFSY +E+V +TN 
Sbjct: 126 PGCSSFTGLFFELGPSSIGPELKPVHNPYSWNNNATVIFLEQPLGVGFSYGDEKVASTNA 185

Query: 140 AARDVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSIVI 199
           A +DVY FL+LF+ +FP+L +N FHIAGESYAGHYIP IAH+I  VH+ D  FNL+SI+I
Sbjct: 186 AGKDVYIFLELFYQEFPHLRSNDFHIAGESYAGHYIPEIAHQIAVVHEHDKTFNLTSIMI 245

Query: 200 GNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXACV 259
           GNG+TD LVQ  Y++PMACG GGY A+++   C  M      C              AC+
Sbjct: 246 GNGITDSLVQYDYYEPMACGRGGYRAVISEKDCANMRSDMPVCANLNRACYSSSSTFACI 305

Query: 260 SASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEFVQDALGTKV 319
           +A  +C    +     + +N  DIR PCE  E GLC+  L Y+  YLNQ  VQ A+G+ V
Sbjct: 306 AAGAYCENMAMSAYTKTGLNVYDIRSPCETEEGGLCYSGLSYVEDYLNQPEVQAAVGSDV 365

Query: 320 SSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDA 379
           S + GC+  VG  F LTGDN+RPFQQYV EL++ NIPVL+YAGD DYICNWLGN+AW + 
Sbjct: 366 SHFTGCSNDVGLAFMLTGDNNRPFQQYVAELVNRNIPVLLYAGDKDYICNWLGNLAWAEE 425

Query: 380 LTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMIN 439
           L WK+   +  LPL PW S       G+VK++  FTFLRVF+AGH VPY QP A++EM+N
Sbjct: 426 LEWKNKDVFSRLPLAPWRSEKTGEHMGQVKSYSSFTFLRVFDAGHMVPYNQPEASLEMVN 485

Query: 440 RWISGD 445
           RWI+GD
Sbjct: 486 RWIAGD 491

>Sklu_2175.2 YBR139W, Contig c2175 1128-2615 reverse complement
          Length = 495

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 305/423 (72%)

Query: 23  EYSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWFFESRNDPANDPVILYLNGGPGC 82
           +YS+  K +DP+ LGIDTV QWSGYLDY+  KH FYWFFESRNDP+NDPVIL+LNGGPGC
Sbjct: 68  DYSIRVKSVDPSKLGIDTVKQWSGYLDYRQTKHFFYWFFESRNDPSNDPVILWLNGGPGC 127

Query: 83  SSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSEERVKTTNDAAR 142
           SS+  LFFE GP+SI  +LKP+HNPYSWN NAS+IFL+QP+ VGFSY +E+V +T+ A +
Sbjct: 128 SSLTGLFFELGPSSIDENLKPVHNPYSWNTNASVIFLEQPLGVGFSYGKEKVSSTHIAGK 187

Query: 143 DVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSIVIGNG 202
           DVY FL+LFF KFP+L  N FHIAGESYAGHYIP+IAHEI  VH+ D  FNL+S +IGNG
Sbjct: 188 DVYIFLELFFQKFPHLRRNDFHIAGESYAGHYIPQIAHEIAVVHEHDATFNLTSAMIGNG 247

Query: 203 LTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXACVSAS 262
           +TD LVQ  Y++PMACGEGGYPA+L+  +C  M      C+             +CV+A 
Sbjct: 248 ITDSLVQYDYYEPMACGEGGYPAVLSQEECDKMEKEAPRCRALNKGCYLTGSAISCVAAG 307

Query: 263 TFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEFVQDALGTKVSSY 322
            +C    +     + +N  DIR PCED E GLC+K L Y+  Y+N   VQ A+G+ V+ Y
Sbjct: 308 AYCESMAMNAYQKTGLNVYDIRSPCEDAEGGLCYKGLDYVEKYMNLPEVQAAVGSDVNHY 367

Query: 323 NGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDALTW 382
            GC+  V   F LTGD ++PFQQYV ELLD +IPVLIYAGD DYICNWLGN AW++ L W
Sbjct: 368 TGCDNDVFLRFILTGDGNKPFQQYVAELLDKDIPVLIYAGDKDYICNWLGNHAWSNQLEW 427

Query: 383 KDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMINRWI 442
                +E LP   W +       GEVKN+GPFTFLRV++AGH VPY QP  +++MINRWI
Sbjct: 428 THKKEFEYLPFKSWVNEATGEAAGEVKNYGPFTFLRVYDAGHMVPYDQPENSLDMINRWI 487

Query: 443 SGD 445
           SG+
Sbjct: 488 SGE 490

>Scas_633.7
          Length = 496

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 309/423 (73%), Gaps = 2/423 (0%)

Query: 23  EYSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWFFESRNDPANDPVILYLNGGPGC 82
           +YSL  + +DPA LGID+V QWSGYLDY+D KH FYWFFESRNDP NDP+IL+LNGGPGC
Sbjct: 70  DYSLRLRTVDPAKLGIDSVKQWSGYLDYKDSKHFFYWFFESRNDPKNDPIILWLNGGPGC 129

Query: 83  SSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSEERVKTTNDAAR 142
           SS   LFFE GP+SIG D++PIHN YSWNNNASIIFL+QP+ VGFSY +++V +T  A +
Sbjct: 130 SSFTGLFFELGPSSIGKDMRPIHNLYSWNNNASIIFLEQPLGVGFSYGDDKVSSTKMAGK 189

Query: 143 DVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSIVIGNG 202
           D Y FL+LFF  FPNL +N FHIAGESYAGHYIP+IAHEIV  + D T FNL+SI+IGNG
Sbjct: 190 DAYIFLELFFEAFPNLRSNDFHIAGESYAGHYIPQIAHEIVIANPDRT-FNLTSIMIGNG 248

Query: 203 LTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXACVSAS 262
           +TD LVQ  Y++PMACG+GGYP IL+   C  M  S   C               C+ +S
Sbjct: 249 ITDALVQADYYQPMACGKGGYPPILSERNCEKMKGSTSRCHSLNELCYKSKSSLPCIVSS 308

Query: 263 TFCWKSLIQPAFDSAVNPCDIRGPCED-PESGLCWKTLGYIRSYLNQEFVQDALGTKVSS 321
           T+C  +L +P  ++ +NP DIRGPCED  + G+C+  + YI  Y+N   VQ+ LG+ + S
Sbjct: 309 TYCDAALFKPFEETGLNPYDIRGPCEDTSKDGMCYFAMKYIEQYMNFPEVQEVLGSDIES 368

Query: 322 YNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDALT 381
           Y+GC+  V + F  TGD S+PFQQYV ELL+ NIPVLIYAGD D+ICNWLGN AWT+AL 
Sbjct: 369 YSGCSEDVFARFGFTGDGSKPFQQYVAELLNENIPVLIYAGDKDFICNWLGNYAWTNALD 428

Query: 382 WKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMINRW 441
           WKD  SY   PL  W       + G++K++  FTFLR+++AGH VPY QP A++EM+NRW
Sbjct: 429 WKDKFSYRNSPLKKWTHSESGEELGQLKSYNNFTFLRIYDAGHMVPYDQPEASLEMVNRW 488

Query: 442 ISG 444
           +SG
Sbjct: 489 LSG 491

>YBR139W (YBR139W) [325] chr2 (515620..517146) Protein with
           similarity to serine-type carboxypeptidases [1527 bp,
           508 aa]
          Length = 508

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/441 (55%), Positives = 319/441 (72%), Gaps = 11/441 (2%)

Query: 6   TFIAAVSATVTFHPENVEYSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWFFESRN 65
           TFI++V         + +YSL  + +DP+ LGIDTV QWSGY+DY+D KH FYWFFESRN
Sbjct: 65  TFISSV---------DTDYSLRLRTVDPSKLGIDTVKQWSGYMDYKDSKHFFYWFFESRN 115

Query: 66  DPANDPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNV 125
           DPANDP+IL+LNGGPGCSS   L FE GP+SIG D+KPIHNPYSWNNNAS+IFL+QP+ V
Sbjct: 116 DPANDPIILWLNGGPGCSSFTGLLFELGPSSIGADMKPIHNPYSWNNNASMIFLEQPLGV 175

Query: 126 GFSYSEERVKTTNDAARDVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSV 185
           GFSY +E+V +T  A +D Y FL+LFF  FP+L +N FHIAGESYAGHYIP+IAHEIV V
Sbjct: 176 GFSYGDEKVSSTKLAGKDAYIFLELFFEAFPHLRSNDFHIAGESYAGHYIPQIAHEIV-V 234

Query: 186 HKDDTKFNLSSIVIGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGX 245
              +  FNL+S++IGNG+TDPL+Q  Y++PMACG+GGY  +L+  +C  MS +   C+  
Sbjct: 235 KNPERTFNLTSVMIGNGITDPLIQADYYEPMACGKGGYHPVLSSEECEKMSKAAGRCRRL 294

Query: 246 XXXXXXXXXXXACVSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPES-GLCWKTLGYIRS 304
                       C+ A+ +C  +L++P  ++ +N  DIRGPCED  + G+C+  L Y+  
Sbjct: 295 NKLCYASKSSLPCIVATAYCDSALLEPYINTGLNVYDIRGPCEDNSTDGMCYTGLRYVDQ 354

Query: 305 YLNQEFVQDALGTKVSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDT 364
           Y+N   VQ+ LG+ V +Y+GC+  V + F  TGD S+PFQQY+ ELL+ NIPVLIYAGD 
Sbjct: 355 YMNFPEVQETLGSDVHNYSGCDNDVFTGFLFTGDGSKPFQQYIAELLNHNIPVLIYAGDK 414

Query: 365 DYICNWLGNMAWTDALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGH 424
           DYICNWLGN AW++ L W +   Y+   L PW S     + G+VKN+GPFTFLR+++AGH
Sbjct: 415 DYICNWLGNHAWSNELEWINKRRYQRRMLRPWVSKETGEELGQVKNYGPFTFLRIYDAGH 474

Query: 425 TVPYYQPLATMEMINRWISGD 445
            VPY QP A++EM+N WISG+
Sbjct: 475 MVPYDQPEASLEMVNSWISGN 495

>KLLA0E17897g 1581075..1582550 similar to sp|P38109 Saccharomyces
           cerevisiae YBR139w, hypothetical start
          Length = 491

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/420 (59%), Positives = 302/420 (71%), Gaps = 1/420 (0%)

Query: 24  YSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWFFESRNDPANDPVILYLNGGPGCS 83
           YSL  K LDP SLG+DTV QWSGYLDYQD KH FYWFFESRNDP NDPVIL+LNGGPGCS
Sbjct: 63  YSLRIKPLDPKSLGVDTVKQWSGYLDYQDSKHFFYWFFESRNDPENDPVILWLNGGPGCS 122

Query: 84  SMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSEERVKTTNDAARD 143
           S   LFFE GP+SIG DLKPI+NPYSWN+NAS+IFLDQPV VGFSY + +V TT+DAA+D
Sbjct: 123 SFVGLFFELGPSSIGADLKPIYNPYSWNSNASVIFLDQPVGVGFSYGDSKVSTTDDAAKD 182

Query: 144 VYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSIVIGNGL 203
           VY FLDLFF +FP+L  N FHI+GESYAGHY+P+IAHEI  VH +D+ FNLSS++IGNG 
Sbjct: 183 VYIFLDLFFERFPHLRNNDFHISGESYAGHYLPKIAHEIAVVHAEDSSFNLSSVLIGNGF 242

Query: 204 TDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXACVSAST 263
           TDPL Q QY++PMACGEGGYPA+L P  C  M+ +   C              +CV A  
Sbjct: 243 TDPLTQYQYYEPMACGEGGYPAVLEPEDCLDMNRNLPLCLSLVDRCYKSHSVFSCVLADR 302

Query: 264 FCWKSLIQPAFDSAVNPCDIRGPCE-DPESGLCWKTLGYIRSYLNQEFVQDALGTKVSSY 322
           +C + +      S  NP DIR  CE + +SG C++   YI  YLNQE VQ ALGT VSS+
Sbjct: 303 YCEQQITGVYEKSGRNPYDIRSKCEAEDDSGACYQEEIYISDYLNQEEVQRALGTDVSSF 362

Query: 323 NGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDALTW 382
            GC++ VG  F  TGD   PF QYV ELLD +I VLIYAGD DYICNWLGN+AWT+ L W
Sbjct: 363 QGCSSDVGIGFAFTGDGPSPFHQYVAELLDQDINVLIYAGDKDYICNWLGNLAWTEKLEW 422

Query: 383 KDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMINRWI 442
           + +  Y+   L  W S       GE K++GP T+LR+++AGH VP+ QP  +++M+N WI
Sbjct: 423 RYNEEYKKQVLRTWKSEETDETIGETKSYGPLTYLRIYDAGHMVPHDQPENSLQMVNSWI 482

>AER022W [2527] [Homologous to ScYBR139W - SH]
           complement(669446..671020) [1575 bp, 524 aa]
          Length = 524

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/433 (55%), Positives = 313/433 (72%), Gaps = 5/433 (1%)

Query: 15  VTFHPENVEYSLSAKELDPASLGIDTVNQWSGYLDYQDKKHSFYWFFESRNDPANDPVIL 74
           V  H  N +Y+L  K+ DPA LG+DTV QWSGYLDY+D+KH FYWFFESRNDPANDPV+L
Sbjct: 84  VMRHKSNPDYALRVKKQDPAKLGVDTVKQWSGYLDYKDEKHFFYWFFESRNDPANDPVML 143

Query: 75  YLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSEERV 134
           +LNGGPGCSS   L FE GPASIG DLKP+HNP+SWNNNAS+IFL+QPV VGFSY +  V
Sbjct: 144 WLNGGPGCSSFTGLLFELGPASIGKDLKPVHNPHSWNNNASVIFLEQPVGVGFSYGDS-V 202

Query: 135 KTTNDAARDVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSVHKDDTK--- 191
            +T  A  DVY FL LFF KFP+L  N FHIAGESYAGHYIP+IAHEI++  +++++   
Sbjct: 203 DSTAVAGADVYAFLRLFFQKFPHLAKNDFHIAGESYAGHYIPQIAHEIITSKEENSEEIP 262

Query: 192 -FNLSSIVIGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXX 250
            FNL+S++IGNG TDP  Q +Y++PMACG+GG PA+LN  +C  M+ S+  C        
Sbjct: 263 NFNLTSVLIGNGFTDPRTQYKYYEPMACGKGGVPAVLNEDQCSRMNASSSRCDRLMNLCY 322

Query: 251 XXXXXXACVSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEF 310
                  C++A+ +C + + Q   ++ +N  D+R  CE P+S LC++ L Y++ Y+NQ+ 
Sbjct: 323 LTNRAIPCLAATVYCERYITQVYEETGLNYYDMRRKCESPDSDLCYRGLDYVQQYMNQKE 382

Query: 311 VQDALGTKVSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNW 370
           VQ+ALG++V  Y GCN  VG+ F L+GD+ +PFQQYV++LLD  IPVLIYAGD DYICNW
Sbjct: 383 VQEALGSEVELYEGCNKRVGARFALSGDHGKPFQQYVSQLLDRAIPVLIYAGDKDYICNW 442

Query: 371 LGNMAWTDALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQ 430
           LGN AW+D + W+    Y TLPL PW + N     GEVK+ G  TFLRV++AGH VPY Q
Sbjct: 443 LGNKAWSDEVGWRHTYKYRTLPLKPWVNKNTGKTAGEVKSFGALTFLRVYDAGHMVPYDQ 502

Query: 431 PLATMEMINRWIS 443
           P ++  MI  W++
Sbjct: 503 PESSAYMIESWLN 515

>AGL328C [3984] [Homologous to ScYMR297W (PRC1) - SH] (95027..96718)
           [1692 bp, 563 aa]
          Length = 563

 Score =  444 bits (1143), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 282/427 (66%), Gaps = 8/427 (1%)

Query: 23  EYSLSAKEL-DPASLGID-TVNQWSGYLDYQ-DKKHSFYWFFESRNDPANDPVILYLNGG 79
           +Y L  +++ DPA LG+D  V Q+SGYLD + + KH FYWFFESRNDP NDP++L+LNGG
Sbjct: 134 DYQLRVRKVSDPAGLGVDPDVKQYSGYLDVEAEDKHFFYWFFESRNDPKNDPIVLWLNGG 193

Query: 80  PGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSEERVKTTND 139
           PGCSSM  LFFE GP+SI   LKP+ NPYSWN NAS+IFLDQPVN G+SYS   V  T  
Sbjct: 194 PGCSSMTGLFFELGPSSIDQKLKPVRNPYSWNTNASVIFLDQPVNAGYSYSSNSVANTVA 253

Query: 140 AARDVYNFLDLFFTKFPNLTA-NAFHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSIV 198
           A++DVY FL+LFF +FP   A   FHIAGESYAGHYIP IA EI+S   ++  F LSS++
Sbjct: 254 ASKDVYAFLELFFRQFPEYQAGQKFHIAGESYAGHYIPAIAAEILSHPDEERSFKLSSVL 313

Query: 199 IGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXAC 258
           IGNGLTDPL Q  Y++ MACG GG PAIL P +C  M+ +   C              +C
Sbjct: 314 IGNGLTDPLTQYPYYERMACGGGGEPAILGPEQCSAMNETLPRCLRLIRTCYTLQNVWSC 373

Query: 259 VSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEFVQDALGTK 318
           V AS +C  + + P   +  N  D+R  C   E  LC+  + Y   YLN   V  A+G +
Sbjct: 374 VPASLYCNGNQLTPFQRTGKNVYDVRKEC---EGQLCYDDMKYSEEYLNTPEVIKAVGAE 430

Query: 319 VSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTD 378
           V S+  CN  V  +F L GD  +P+Q++VTE+LD  +PVLIYAGD D+ICNWLGN AWTD
Sbjct: 431 VDSFTSCNFDVNRNFLLNGDWMKPYQRHVTEILDKGLPVLIYAGDKDFICNWLGNRAWTD 490

Query: 379 ALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMI 438
            L WK H  +   P+ PW   +G  Q GEVKN+  FT+LRVF AGH VPY  P  +++M+
Sbjct: 491 ELPWKHHDDFTKQPIKPWNGPSGD-QAGEVKNYKHFTYLRVFGAGHMVPYDVPENSLDML 549

Query: 439 NRWISGD 445
           N W+ GD
Sbjct: 550 NTWLQGD 556

>KLLA0A09977g 876594..878201 similar to sp|P00729 Saccharomyces
           cerevisiae YMR297w PRC1 carboxypeptidase y, serine-type
           protease, start by similarity
          Length = 535

 Score =  434 bits (1115), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 222/450 (49%), Positives = 298/450 (66%), Gaps = 11/450 (2%)

Query: 2   KWIYTFI-AAVSATVTFHPENV-EYSLSAKEL-DPASLGID-TVNQWSGYLDYQDK-KHS 56
           KW Y     +  +T   + +NV  Y L  K++ DP  LG+D  V Q+SGYLD +D+ KH 
Sbjct: 84  KWDYVVKPESFVSTANVNNDNVGNYQLRVKKIKDPKVLGVDPDVKQYSGYLDVEDEDKHF 143

Query: 57  FYWFFESRNDPANDPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASI 116
           FYWFFESRNDP NDP+IL+LNGGPGCSS+  LFFE GP+S+G ++KPI+NP+SWN+NAS+
Sbjct: 144 FYWFFESRNDPKNDPIILWLNGGPGCSSLTGLFFELGPSSVGEEIKPIYNPHSWNSNASV 203

Query: 117 IFLDQPVNVGFSY-SEERVKTTNDAARDVYNFLDLFFTKFPNLTANA-FHIAGESYAGHY 174
           IFLDQPVNVG+SY S E V  T  A +DVY FL LFF +FP   +   FHIAGESYAGHY
Sbjct: 204 IFLDQPVNVGYSYSSSEGVSNTVAAGKDVYAFLQLFFQQFPEYASGQDFHIAGESYAGHY 263

Query: 175 IPRIAHEIVSVHKDDTKFNLSSIVIGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRT 234
           IP  A EI+S   ++  FNL+S++IGNGLTDPL Q  Y++PMACGEGG P++L P +C  
Sbjct: 264 IPVFATEILSHPTEERSFNLTSVLIGNGLTDPLSQYPYYEPMACGEGGEPSVLEPEQCDN 323

Query: 235 MSVSNLACKGXXXXXXXXXXXXACVSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGL 294
           M  +   C              +CV AS +C  + + P   +  N  DIR  C   +  L
Sbjct: 324 MLETLPRCLNLIQSCYEYESVWSCVPASIYCNNAQMGPYQSTGKNVYDIRKEC---QGEL 380

Query: 295 CWKTLGYIRSYLNQEFVQDALGTKVSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLN 354
           C+  + Y+  YLN +FV++A+G +V +Y  CN  +  +F   GD  +P+ ++VTELL+ +
Sbjct: 381 CYDEMKYMDEYLNLDFVKEAVGAEVDNYESCNFDINRNFLFAGDWMKPYHKHVTELLEQD 440

Query: 355 IPVLIYAGDTDYICNWLGNMAWTDALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPF 414
           +PVLIYAGD D+ICNWLGN AWT+ L +KD   +   P+  W +  G  + G+VKN   F
Sbjct: 441 LPVLIYAGDKDFICNWLGNQAWTNLLPYKDAEEFAKQPVKNWVTSVGK-KAGKVKNFDKF 499

Query: 415 TFLRVFEAGHTVPYYQPLATMEMINRWISG 444
           TFLRV+ AGH VP+ QP   ++M+N W++G
Sbjct: 500 TFLRVYGAGHMVPFDQPENALDMVNDWVNG 529

>Scas_684.21
          Length = 534

 Score =  432 bits (1111), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 218/431 (50%), Positives = 283/431 (65%), Gaps = 7/431 (1%)

Query: 20  ENVEYSLSAKEL-DPASLGID-TVNQWSGYLDYQ-DKKHSFYWFFESRNDPANDPVILYL 76
           E  +Y L   ++ DP  LG+D  V Q++GYLD + D KH F+WFFESRNDP NDPVIL+L
Sbjct: 103 EVSDYQLRVNKIQDPKILGVDPNVTQYTGYLDVEEDDKHFFFWFFESRNDPKNDPVILWL 162

Query: 77  NGGPGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSEER-VK 135
           +GGPGCSSM  LFFE GP+S+G  LKPIHNPYSWN+NAS+IFLDQPVNVGFSYS  + V 
Sbjct: 163 SGGPGCSSMTGLFFELGPSSLGKKLKPIHNPYSWNSNASVIFLDQPVNVGFSYSGSKGVS 222

Query: 136 TTNDAARDVYNFLDLFFTKFPNLTANA-FHIAGESYAGHYIPRIAHEIVSVHKDDTKFNL 194
            T  A +DVY FL LFF +FP   ++  FHIAGESYAGHYIP  A EI+S   ++  FNL
Sbjct: 223 NTVAAGKDVYAFLQLFFQQFPEYASDQDFHIAGESYAGHYIPVFAAEILSHDVEERNFNL 282

Query: 195 SSIVIGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXX 254
           +S++IGNGLTDPLVQ +Y++PMACG+GG PA+L   +C+ M+ S   C G          
Sbjct: 283 TSVMIGNGLTDPLVQYEYYEPMACGKGGEPAVLKAEECKAMNDSLDRCLGLIDSCYESES 342

Query: 255 XXACVSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEFVQDA 314
             +CV AS +C  + + P   +  N  DIR  CE     LC+  L YI  YLN + V+ A
Sbjct: 343 VWSCVPASIYCNNAQLGPYQRTGKNVYDIRKKCEG--GNLCYPALQYIDDYLNLDEVKKA 400

Query: 315 LGTKVSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNM 374
           +G +V  +  CN  +  +F   GD  +P+Q+ VT +L+ ++PVL+YAGD D+ICNWLGN 
Sbjct: 401 VGAEVDHFETCNFDINRNFLFNGDWMKPYQKAVTSILNQDLPVLVYAGDKDFICNWLGNR 460

Query: 375 AWTDALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLAT 434
           AWTD L WKD   +   P+  W +       GEVK+ G  T+LRV   GH VPY  P  +
Sbjct: 461 AWTDVLPWKDSEEFAKQPIRNWTAKATGEVAGEVKSFGRLTYLRVLGGGHMVPYDVPENS 520

Query: 435 MEMINRWISGD 445
           +  +N WI+G+
Sbjct: 521 LSFVNEWINGN 531

>Sklu_2263.5 YMR297W, Contig c2263 5721-7307
          Length = 528

 Score =  431 bits (1108), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 220/426 (51%), Positives = 278/426 (65%), Gaps = 8/426 (1%)

Query: 24  YSLSAKEL-DPASLGID-TVNQWSGYLDYQDK-KHSFYWFFESRNDPANDPVILYLNGGP 80
           Y L   ++ DP  LGID  V Q+SGYLD +D+ KH FYWFFESRNDP NDP++L+LNGGP
Sbjct: 102 YQLRVNKIKDPKILGIDPDVKQYSGYLDVEDEDKHFFYWFFESRNDPKNDPIVLWLNGGP 161

Query: 81  GCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSE-ERVKTTND 139
           GCSS+  LFFE G +SIGPDLKPI+NPYSWN+NAS+IFLDQPVNVG+SYS  E V  T  
Sbjct: 162 GCSSLTGLFFELGSSSIGPDLKPIYNPYSWNSNASVIFLDQPVNVGYSYSSSEGVSDTVA 221

Query: 140 AARDVYNFLDLFFTKFPNLTANA-FHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSIV 198
           A +DVY FL LFF +FP   +   FHIAGESYAGHYIP  A EI+S    +  FNL+S++
Sbjct: 222 AGKDVYAFLQLFFRQFPEYASGQDFHIAGESYAGHYIPVFASEILSHPTSERNFNLTSVL 281

Query: 199 IGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXAC 258
           IGNGLTD L Q   ++PMACGEGG PA+L P +C  M  S   C              +C
Sbjct: 282 IGNGLTDALSQYPLYEPMACGEGGEPAVLEPEQCDGMLDSLPRCLSLIKSCYDYESVWSC 341

Query: 259 VSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEFVQDALGTK 318
           V A+ +C  + + P   +  N  DIR  CE     LC+  + Y+  YLN ++V++A+G +
Sbjct: 342 VPAAIYCNNAQMGPYQRTGKNVYDIRKECE---GELCYSEMQYLNEYLNLDYVKEAVGAE 398

Query: 319 VSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTD 378
           V  Y  CN  +  +F   GD  +P+ + VT+LL+  +PVLIYAGD D+ICNWLGN AWTD
Sbjct: 399 VEKYESCNFDINRNFLFAGDWMKPYHKAVTDLLNQGLPVLIYAGDKDFICNWLGNQAWTD 458

Query: 379 ALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMI 438
            L WK    +   P+  W S + S + GEVKN+  FTFLRV+  GH VPY  P   + M+
Sbjct: 459 VLPWKYAEEFAKQPIRDWVSSSTSDKAGEVKNYKHFTFLRVYGGGHMVPYDVPENALSML 518

Query: 439 NRWISG 444
           N WI G
Sbjct: 519 NDWIQG 524

>YMR297W (PRC1) [4251] chr13 (861921..863519) Carboxypeptidase Y
           (CPY/yscY), a vacuolar serine protease [1599 bp, 532 aa]
          Length = 532

 Score =  424 bits (1091), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 220/427 (51%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 24  YSLSAKEL-DPASLGID-TVNQWSGYLDYQDK-KHSFYWFFESRNDPANDPVILYLNGGP 80
           Y L   ++ DP  LGID  V Q++GYLD +D+ KH F+W FESRNDPA DPVIL+LNGGP
Sbjct: 106 YQLRVNKIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGP 165

Query: 81  GCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYS-EERVKTTND 139
           GCSS+  LFFE GP+SIGPDLKPI NPYSWN+NA++IFLDQPVNVGFSYS    V  T  
Sbjct: 166 GCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVA 225

Query: 140 AARDVYNFLDLFFTKFPNLT--ANAFHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSI 197
           A +DVYNFL+LFF +FP        FHIAGESYAGHYIP  A EI+S HKD   FNL+S+
Sbjct: 226 AGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILS-HKD-RNFNLTSV 283

Query: 198 VIGNGLTDPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXA 257
           +IGNGLTDPL Q  Y++PMACGEGG P++L   +C  M  S   C G            +
Sbjct: 284 LIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWS 343

Query: 258 CVSASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEFVQDALGT 317
           CV A+ +C  + + P   +  N  DIR  CE     LC+ TL  I  YLNQ++V++A+G 
Sbjct: 344 CVPATIYCNNAQLAPYQRTGRNVYDIRKDCEG--GNLCYPTLQDIDDYLNQDYVKEAVGA 401

Query: 318 KVSSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWT 377
           +V  Y  CN  +  +F   GD  +P+   VT+LL+ ++P+L+YAGD D+ICNWLGN AWT
Sbjct: 402 EVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWT 461

Query: 378 DALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEM 437
           D L WK    + +  +  W +       GEVK++  FT+LRVF  GH VP+  P   + M
Sbjct: 462 DVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSM 521

Query: 438 INRWISG 444
           +N WI G
Sbjct: 522 VNEWIHG 528

>Kwal_26.9455
          Length = 525

 Score =  411 bits (1056), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 210/420 (50%), Positives = 275/420 (65%), Gaps = 7/420 (1%)

Query: 29  KELDPASLGIDT-VNQWSGYLDYQDK-KHSFYWFFESRNDPANDPVILYLNGGPGCSSMD 86
           K  DP  LG+D  V Q++GYLD +++ KH FYWFFESRNDP NDPVIL+LNGGPGCSS+ 
Sbjct: 104 KVKDPQVLGVDPGVKQYTGYLDVEEEDKHFFYWFFESRNDPKNDPVILWLNGGPGCSSLT 163

Query: 87  NLFFETGPASIGPDLKPIHNPYSWNNNASIIFLDQPVNVGFSYSEERVK-TTNDAARDVY 145
             FFE GP+SIGP+LKPI+NPYSWN+NAS+IFLDQPVNVG+SYS       T  A +DVY
Sbjct: 164 GQFFELGPSSIGPELKPIYNPYSWNSNASVIFLDQPVNVGYSYSGSSGVSNTVAAGKDVY 223

Query: 146 NFLDLFFTKFPNLTANA-FHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSIVIGNGLT 204
            FL LFF +FP   +   FHIAGESYAGHYIP  A EI+S  +++  FNL+S++IGNGLT
Sbjct: 224 AFLQLFFQQFPEYASGQDFHIAGESYAGHYIPVFASEILSHPENERNFNLTSVLIGNGLT 283

Query: 205 DPLVQNQYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXACVSASTF 264
           DPL Q  Y++PMACGEGG P++L P +C  M  +   C              +CV A+ +
Sbjct: 284 DPLTQYPYYEPMACGEGGEPSVLAPEECEGMLDTLPRCLSLIEACYDSESVWSCVPAAIY 343

Query: 265 CWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEFVQDALGTKVSSYNG 324
           C  + + P   +  N  DIR  C      LC+  + Y+  YLN + V++A+G +V  Y  
Sbjct: 344 CNNAQMGPYQKTGKNVYDIRKECN---GQLCYAEMSYVEDYLNLDVVKNAVGAEVEKYES 400

Query: 325 CNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDALTWKD 384
           CN  +  +F   GD  +P+ + VT+LL+  +PVLIYAGD D+ICNWLGN AW++ L WK 
Sbjct: 401 CNFDINRNFLFAGDWMKPYHKAVTDLLNQGLPVLIYAGDKDFICNWLGNEAWSNVLPWKH 460

Query: 385 HISYETLPLNPWYSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMINRWISG 444
              ++  P+  W +       G+VKN+  FTFLRV+  GH VPY QP  ++ M+N WI G
Sbjct: 461 GDKFQDAPVKDWTASTTGETAGKVKNYKNFTFLRVYGGGHMVPYDQPENSLAMVNDWIQG 520

>CAGL0M13651g 1339781..1341307 similar to sp|P00729 Saccharomyces
           cerevisiae YMR297w PRC1 carboxypeptidase Y, hypothetical
           start
          Length = 508

 Score =  406 bits (1044), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 212/424 (50%), Positives = 273/424 (64%), Gaps = 13/424 (3%)

Query: 29  KELDPASLGID-TVNQWSGYLDYQ-DKKHSFYWFFESRNDPANDPVILYLNGGPGCSSMD 86
           K ++P  LG+D  V Q +GYLD + + KH F+WFFESRNDP NDPVIL+LNGGPGCSS+ 
Sbjct: 83  KIVNPKKLGVDPHVKQLTGYLDNELEDKHFFFWFFESRNDPKNDPVILWLNGGPGCSSLT 142

Query: 87  NLFFETGPASI-GPDLKPIHNPYSWNNNASIIFLDQPVNVGFSY----SEERVKTTNDAA 141
            LFFE GP+SI G  LKP+ NP+SWN+NAS+IFLDQPVNVGFSY    S   V  T  A 
Sbjct: 143 GLFFELGPSSIDGQKLKPVKNPFSWNSNASVIFLDQPVNVGFSYAGSNSNGGVSNTVAAG 202

Query: 142 RDVYNFLDLFFTKFPNLT-ANAFHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSIVIG 200
           +DVY FL LFF +FP       FHIAGESYAGHYIP  A EI++  + +  FNL+S++IG
Sbjct: 203 KDVYAFLQLFFKQFPQYADGQDFHIAGESYAGHYIPVFASEILAHPQKERHFNLTSVLIG 262

Query: 201 NGLTDPLVQNQYFKPMACGEG-GYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXACV 259
           NGLTDPL Q +Y+KPMACGEG G   +L+P +C  M  S   C              ACV
Sbjct: 263 NGLTDPLTQYRYYKPMACGEGSGADPVLSPEECSAMEDSLDRCLSLIDACYQSESVWACV 322

Query: 260 SASTFCWKSLIQPAFDSAVNPCDIRGPCEDPESGLCWKTLGYIRSYLNQEFVQDALGTKV 319
            AS +C  + + P   +  N  D+R  CE     LC+  L  I  YLN ++V++A+G +V
Sbjct: 323 PASIYCNNAQLAPYQRTGRNVYDVRKDCEG--GSLCYPELQNIDDYLNMDYVREAVGAEV 380

Query: 320 SSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDA 379
             Y  CN  +  +F   GD  +P+ + V E+L+  +PVLIYAGD D+ICNW+GN AWTD 
Sbjct: 381 DHYESCNFDINRNFLFNGDWMKPYHKQVIEILEKGLPVLIYAGDKDFICNWMGNRAWTDE 440

Query: 380 LTWKDHISYETLPLNPW-YSLNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMI 438
           L WK    +   P+  W  S+ G V  GEVK++   TFLR+F+ GH VPY QP +++ M+
Sbjct: 441 LQWKYSSGFAQEPVRNWTASITGEVA-GEVKSYENLTFLRLFDGGHMVPYDQPESSLSML 499

Query: 439 NRWI 442
           N WI
Sbjct: 500 NEWI 503

>AFR549W [3741] [Homologous to ScYGL203C (KEX1) - SH]
           complement(1423666..1425465) [1800 bp, 599 aa]
          Length = 599

 Score =  151 bits (382), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 116/416 (27%), Positives = 183/416 (43%), Gaps = 39/416 (9%)

Query: 51  QDKKHSFYWFF-ESRNDPANDPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPYS 109
           +D +  F+W   E      ++ +I++LNGGPGCSSMD    ETG   +  D K   N  S
Sbjct: 57  EDGRALFFWRMGEQCGKRCSNELIVWLNGGPGCSSMDGALMETGAFRVAEDGKLYLNSGS 116

Query: 110 WNNNASIIFLDQPVNVGFSY--SEERVKTT-NDAARDVYNFLDLFFTKFPNLTANAFHIA 166
           W+   +++F+DQPV  GFS    + R++T  +  A D   F++ ++  FP        +A
Sbjct: 117 WHTRGTMLFVDQPVGTGFSRPGRDGRLRTELSQLADDFLLFMERYYAVFPEDRRRTLVLA 176

Query: 167 GESYAGHYIPRIAHEIVSVHKD---DTKFNLSSIVIGNGLTDPLVQNQYFKPMACGEG-- 221
           GESYAG Y+P  A  +V  + +   + ++ L +++IGNG  DP +Q+  + P     G  
Sbjct: 177 GESYAGQYLPYFADAVVRRNAERAPEERYKLQNVMIGNGWVDPDLQSLSYVPFVSSRGLF 236

Query: 222 -----GYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXACVSASTFCWKSLIQPAFDS 276
                 +  IL   +    ++++   KG             C         S+  P  D 
Sbjct: 237 GPETRNFQDILRDQEACQNAINHGPAKG--------FSHPECEGILPKLLSSI--PGPDR 286

Query: 277 AVNPC----DIRGPCEDPESGLCWKT-LGYIRSYLNQEFVQDALGTK---VSSYNGCNTS 328
            V  C    DIR     P  G+ W   L  +  +     V +AL         +  C ++
Sbjct: 287 PVQQCINMYDIRLRDVFPSCGMNWPADLPNVHKFFGTPGVLEALHVDPQVAGPWVECKSA 346

Query: 329 VGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDALTWKDHISY 388
           V     L   +SRP    +  L++  +  + + GD D ICN +G       L W+ H+ +
Sbjct: 347 VSE--ALVNAHSRPSVHLIPGLIEAGVKFVFFNGDQDVICNNMGVEMLIAELRWRGHMGF 404

Query: 389 ETLPLN-PWYSLNGS----VQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMIN 439
                N  WY  +      V  G VK  GP TF+ VF A H VP+  P  +  +I+
Sbjct: 405 SNATENFDWYHSDADAKTLVAAGVVKRDGPVTFISVFNASHMVPFDVPRISRGIID 460

>Scas_712.47
          Length = 703

 Score =  150 bits (379), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 117/432 (27%), Positives = 185/432 (42%), Gaps = 42/432 (9%)

Query: 49  DYQDKKHSFYWFFESRNDPANDPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPY 108
           D  D K+ F+ F E+  D  +D +IL+LNGGPGCSS+D    E GP  I  + K   N  
Sbjct: 64  DTNDSKYFFWRFHENNKD--HDTLILWLNGGPGCSSIDGALVEAGPLRIDSEGKAYLNNG 121

Query: 109 SWNNNASIIFLDQPVNVGFSYSEERVKTT--------NDAARDVYNFLDLFFTKFPNLTA 160
           SW+    ++F+DQP+  GFS  ++  + +        ND       FL+ +F  FP    
Sbjct: 122 SWHTRGDLVFVDQPLGTGFSTLDKNKEQSDNSFDIDLNDVTNHFMQFLENYFQVFPEDLP 181

Query: 161 NAFHIAGESYAGHYIPRIAHEIVSVHK-------DDTKFNLSSIVIGNGLTDPLVQNQYF 213
               +AGESYAG YIP  A  I+  +        DD ++NL  ++IGNG  DP VQ+  +
Sbjct: 182 KKLLLAGESYAGQYIPYFAKGILDHNAKLEHDAIDDYEYNLEGLLIGNGWIDPSVQSLSY 241

Query: 214 KPMACGEG-------GYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXACVSASTFCW 266
            P A            +  +LN  +     +++    G              +       
Sbjct: 242 LPFAVENKLIDETNPNFKNLLNAHELCQKKINSQKTDGNSQFSFDECDKIINLLLQYTKD 301

Query: 267 KSLIQPAFDSAVNPCDIRGPCEDPESGLCW-KTLGYIRSYLNQEFVQDAL---GTKVSSY 322
           +S   PA    +N  D +     P+ G+ W   + Y+  + N   V +AL       S +
Sbjct: 302 ESPNTPANQVCLNVYDFQLRDSFPQCGMNWPADISYVSKFFNTPGVLEALNLDSDTTSPW 361

Query: 323 NGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDALTW 382
             CNT V     L   +S+P    +  +++  + +L++ GD D ICN +G     D L W
Sbjct: 362 QECNTKVQDK--LINPSSKPSINLLPSIMESGVEILLFNGDKDLICNTMGLQNTIDNLKW 419

Query: 383 KDHISY-ETLPLNPWYSLN-----------GSVQFGEVKNHGPFTFLRVFEAGHTVPYYQ 430
                + E L    W   N             +  G VK     T + V+ A H VP+ +
Sbjct: 420 GGSTGFSEQLESYQWSYRNQYDSNSDSNADNEITVGSVKYDKNLTLVNVYNASHMVPHDK 479

Query: 431 PLATMEMINRWI 442
            L +  +++ ++
Sbjct: 480 GLVSRGIVDIFL 491

>Kwal_47.18993
          Length = 703

 Score =  145 bits (366), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/408 (29%), Positives = 180/408 (44%), Gaps = 32/408 (7%)

Query: 48  LDYQDKKHS---FYWFFESRND----PANDPVILYLNGGPGCSSMDNLFFETGPASIGPD 100
           LD  + +H+   F+W F  ++      A D +I +LNGGPGCSSMD    E+G   I   
Sbjct: 59  LDSSEDEHTKNYFFWKFHDKSGRASPEAQDTLIFWLNGGPGCSSMDGALMESGALRIDSS 118

Query: 101 LKPIHNPYSWNNNASIIFLDQPVNVGFSYSEERVKTTND---AARDVYNFLDLFFTKFPN 157
            K   N   W+    I+F+DQP   GFS      +  ND    A+    FL  +FT FP 
Sbjct: 119 GKAYLNEGGWHTRGDIVFVDQPAGTGFSTVGSDQEYDNDLEVVAQHFLAFLRNYFTIFPE 178

Query: 158 LTANAFHIAGESYAGHYIPRIAHEIVSVHKDDTKFNLSSIVIGNGLTDPLVQNQYFKPMA 217
             +    +AGESYAG +IP  A  I+   +D    +L  ++IGNG  DP  Q+ Y+ P A
Sbjct: 179 DLSKQVILAGESYAGQFIPFFARAILD--QDAIDIDLQVLLIGNGWIDPNHQSLYYIPFA 236

Query: 218 CGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXAC---------VSASTFCWKS 268
             E G  A  NP     ++   +                 C         ++  T   + 
Sbjct: 237 I-EKGLLANDNPKLPSLLAQQEVCQNKINADGNEQFSFKECEDLLSQLLEITRRTQDSEG 295

Query: 269 LIQPAFDSAVNPCDIRGPCEDPESGLCW-KTLGYIRSYLNQEFVQDALG---TKVSSYNG 324
              PA +  +N  D+R     P  G+ W + L  +  +     V DAL      V +++ 
Sbjct: 296 KKVPANEQCINMYDLRLKDSYPSCGMNWPEDLPNLSKFFGTPGVVDALHLDPEHVPNWHE 355

Query: 325 CNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDALTWKD 384
           C+ SV  +  L   NSRP    +  LL+  + V+++ GD D ICN +G  +    L+W  
Sbjct: 356 CDDSVSRN--LKNPNSRPSANLLPALLESGLQVILFNGDQDIICNNMGVESLISELSWGG 413

Query: 385 HISY-ETLPLNPW-YSLNGS--VQFGEVKNHGPFTFLRVFEAGHTVPY 428
              + + +    W Y  +G+     G VK     TF+ V+ A H VP+
Sbjct: 414 EKGFSDQVQYYDWVYQPDGADGTPAGFVKYDRNLTFISVYNASHMVPF 461

>KLLA0F09999g complement(923413..925341) similar to sp|P09620
           Saccharomyces cerevisiae YGL203c KEX1 carboxypeptidase
           (YSC-alpha), start by similarity
          Length = 642

 Score =  142 bits (357), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/428 (27%), Positives = 186/428 (43%), Gaps = 42/428 (9%)

Query: 53  KKHSFYWFFESRNDP----ANDPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPY 108
           +K+ F+W F    +     A+  +I++LNGGPGCSS+D    E+G   I  D +   NP 
Sbjct: 67  EKNYFFWKFHDLANQTSVVASKTLIIWLNGGPGCSSLDGALMESGALRIDDDGEAYLNPG 126

Query: 109 SWNNNASIIFLDQPVNVGFSY--SEERVKTTNDAARDVYNFLDLFFTKFPNLTANAFHIA 166
           SW+    I+F+DQP   GFS     +  K  N  ++    FL  +F  FP+       +A
Sbjct: 127 SWHTRGDIVFVDQPAGTGFSTVGDSKYDKDLNQVSKHFMKFLKNYFKIFPDDLDKDLVLA 186

Query: 167 GESYAGHYIPRIAHEIV----SVHKDDT--------KFNLSSIVIGNGLTDPLVQNQYFK 214
           GESYAG YIP  A+EI+     + KDD         K+NL S++IGNG  DP  Q+  + 
Sbjct: 187 GESYAGQYIPFFANEILKFNSKLDKDDNEEESRSGKKYNLKSLLIGNGWIDPDQQSLSYI 246

Query: 215 PMACGEGG-------YPAILN-PSKCRTMSVSNLACKGXXXXXXXXXXXXACVSASTFCW 266
           P A            +P +LN  S+C+ +  +N   K                +      
Sbjct: 247 PFALENNLISTKADYFPDLLNMHSRCQNLVNNNGGKKFSFDECEDILTKILYYTRRKTDE 306

Query: 267 KSLIQPAFDSAVNPCDIRGPCEDPESGLCW-KTLGYIRSYLNQEFVQDALG---TKVSSY 322
                P+     N  D R     P  G  W   L  +  +L +  V D+L     KV  +
Sbjct: 307 NGNKVPSNQECTNIYDFRLFDSYPACGSNWPDDLPSVSKFLGKPGVMDSLHLDVDKVPHW 366

Query: 323 NGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDALTW 382
             C++ V S   L   N++P    +  LL  ++ + ++ GD D ICN  G       + W
Sbjct: 367 RECDSKVSS--HLKNKNTQPSIHLLPNLLK-HMQIFLFNGDKDIICNSRGVQDLIKNMKW 423

Query: 383 KDHISYETLPLNPWYS-------LNGSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATM 435
            +H  +       +Y         + ++  G VK+    T++ V+ A H VPY   L + 
Sbjct: 424 NNHTGFTNDA--EYYDWQYYDQFTDDTISAGFVKHESNLTYVSVYNASHMVPYDNALISR 481

Query: 436 EMINRWIS 443
            +++ ++ 
Sbjct: 482 GIMDIYLK 489

>YGL203C (KEX1) [1792] chr7 complement(112477..114666)
           Carboxypeptidase specific for C-terminal Arg or Lys,
           involved in processing precursors of alpha-factor and K1
           and K2 killer toxins [2190 bp, 729 aa]
          Length = 729

 Score =  139 bits (350), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 115/428 (26%), Positives = 195/428 (45%), Gaps = 43/428 (10%)

Query: 49  DYQDKKHSFYWFFESRNDPAN----DPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPI 104
           D QD     Y+F++  N+ +N     P+I++LNGGPGCSSMD    E+GP  +  D K  
Sbjct: 64  DEQDSSDLEYFFWKFTNNDSNGNVDRPLIIWLNGGPGCSSMDGALVESGPFRVNSDGKLY 123

Query: 105 HNPYSWNNNASIIFLDQPVNVGFSYSEERVKTT----------NDAARDVYNFLDLFFTK 154
            N  SW +   ++F+DQP   GFS  + + +             D  +   +FL+ +F  
Sbjct: 124 LNEGSWISKGDLLFIDQPTGTGFSVEQNKDEGKIDKNKFDEDLEDVTKHFMDFLENYFKI 183

Query: 155 FPNLTANAFHIAGESYAGHYIPRIAHEIVSVHK----DDTKFNLSSIVIGNGLTDPLVQN 210
           FP        ++GESYAG YIP  A+ I++ +K    D   ++L +++IGNG  DP  Q+
Sbjct: 184 FPEDLTRKIILSGESYAGQYIPFFANAILNHNKFSKIDGDTYDLKALLIGNGWIDPNTQS 243

Query: 211 QYFKPMACGEGGYPAILNPSKCRTMSVSNLACKGXXXXXXXXXXXXACVSASTFCWKSLI 270
             + P A  E       NP+  + ++ ++  C+                         L+
Sbjct: 244 LSYLPFAM-EKKLIDESNPN-FKHLTNAHENCQNLINSASTDEAAHFSYQECENILNLLL 301

Query: 271 QPAFDSA-------VNPCDIRGPCEDPESGLCW-KTLGYIRSYLNQEFVQDAL---GTKV 319
               +S+       +N  +       P  G+ W K + ++  + +   V D+L     K+
Sbjct: 302 SYTRESSQKGTADCLNMYNFNLKDSYPSCGMNWPKDISFVSKFFSTPGVIDSLHLDSDKI 361

Query: 320 SSYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIPVLIYAGDTDYICNWLGNMAWTDA 379
             +  C  SVG+   L+   S+P    +  LL+  I ++++ GD D ICN  G +   D 
Sbjct: 362 DHWKECTNSVGTK--LSNPISKPSIHLLPGLLESGIEIVLFNGDKDLICNNKGVLDTIDN 419

Query: 380 LTW-------KDHISYETLPLNPWYSLNGSVQF-GEVKNHGPFTFLRVFEAGHTVPYYQP 431
           L W        D +S++   ++   S + S +F G VK     TF+ V+ A H VP+ + 
Sbjct: 420 LKWGGIKGFSDDAVSFDW--IHKSKSTDDSEEFSGYVKYDRNLTFVSVYNASHMVPFDKS 477

Query: 432 LATMEMIN 439
           L +  +++
Sbjct: 478 LVSRGIVD 485

>CAGL0G01232g complement(114924..117116) similar to sp|P09620
           Saccharomyces cerevisiae YGL203c KEX1 carboxypeptidase,
           hypothetical start
          Length = 730

 Score =  133 bits (335), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 105/401 (26%), Positives = 174/401 (43%), Gaps = 23/401 (5%)

Query: 57  FYWFFESRNDPAND--PVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIHNPYSWNNNA 114
           F+W FE++    ND  P+I++LNGGPGCSSM     E GP  +    + I N  SW+   
Sbjct: 65  FFWKFENKKTKKNDETPLIIWLNGGPGCSSMAGALMEIGPFRLNKKAEVIKNDGSWHMRG 124

Query: 115 SIIFLDQPVNVGFSYSEE--RVKTTNDAARDVYNFLDLFFTKFPNLTANAFHIAGESYAG 172
           S++FLDQPV  GFSYS+E   V   ++ A +   FL  ++  FP+       +AGESYAG
Sbjct: 125 SVLFLDQPVGTGFSYSKEDNEVSELDEVADNFMVFLQNYYATFPDDKDRELILAGESYAG 184

Query: 173 HYIPRIAHEIVSVHK----DDTKFNLSSIVIGNGLTDPLVQNQYFKPMACGEGGYPAILN 228
            +IP     I+  ++    +++K N+  + IGNG  DP  Q   + P +  E G     +
Sbjct: 185 QFIPYFTKAIIKFNEQQRDENSKINIKVMFIGNGWLDPKRQYLSYVPFSL-EKGIIKKED 243

Query: 229 PSKCRTMSVSNLACKGXXXXXXXXXXXXACVSASTFCWKSLIQPAFDSAVNPCDIRGPCE 288
           P+  + +   +  C+             +         K + Q      +N         
Sbjct: 244 PA-FKDILKQHETCQNYINSDHTGHSELSYPPCEAVLGKIISQDKT-QCINVYKFDEYDS 301

Query: 289 DPESGLCWKT-LGYIRSYLNQEFVQDAL-GTKVSSYNGCNTSVGSDFFLTGDNSRPFQQY 346
            P  GL W     + + +L  + V  AL      S+  C   V     L    ++P  + 
Sbjct: 302 YPSCGLEWPVDTKFTKQFLTDKKVLAALHANDERSWIECRPDVK----LENIKAKPAIEL 357

Query: 347 VTELLDLNIPVLIYAGDTDYICNWLGNMAWTDALTWKDHISY-ETLPLNPW-----YSLN 400
           +  LL+  I ++++ G+ D ICN LG       L W+    + + + +  W        +
Sbjct: 358 IPSLLESGIELILFNGNKDLICNTLGIDNVLKHLQWEGETGFTDEVQIFDWVYRDDLKSD 417

Query: 401 GSVQFGEVKNHGPFTFLRVFEAGHTVPYYQPLATMEMINRW 441
                G VK     T + + +  H V Y + L +  +++ +
Sbjct: 418 KEKVAGTVKYERQLTLITIEDGSHMVSYDKALISRGILDMY 458

>AEL056W [2450] [Homologous to NOHBY] complement(531590..533554)
           [1965 bp, 654 aa]
          Length = 654

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 7/104 (6%)

Query: 46  GYLDYQDKKHSFYWFFESRNDPANDPVILYLNGGPGCSSMDNLFFETGPASIGPDLKPIH 105
           G+   QD++ +F         P +D    Y+N G    +M  L  E  P+    +L+ + 
Sbjct: 120 GFSSSQDEERAFSVVEGHLQIPQDDA---YINDG---GTMFKLALENSPSVSPEELELLE 173

Query: 106 N-PYSWNNNASIIFLDQPVNVGFSYSEERVKTTNDAARDVYNFL 148
             P++ NN+  I+   Q +    +  ++ V+   DA+R V+++L
Sbjct: 174 TAPFANNNSDDILSFSQVIEQHANMEQDMVQLEPDASRQVFDYL 217

>CAGL0E01573g complement(148847..151561) similar to sp|P42842
           Saccharomyces cerevisiae YNL313c, start by similarity
          Length = 904

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 22/49 (44%)

Query: 365 DYICNWLGNMAWTDALTWKDHISYETLPLNPWYSLNGSVQFGEVKNHGP 413
           D+ICN L ++  TDA  WK     E     PW SL    +     +H P
Sbjct: 778 DFICNTLPSVITTDARCWKLAARVELWRKRPWASLECEEKAYRAVSHNP 826

>Sklu_1897.4 YAL009W, Contig c1897 4338-5261
          Length = 307

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 126 GFSYSEERVKTTNDAARDVYNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSV 185
           GFS+ E  +  +++  + +Y  +  F   F  +T   FH++GE      IPR      S 
Sbjct: 133 GFSFYE--MYFSSEGVQGLYKVILQFILIFIMVTVVLFHLSGEYRRTIVIPR--KFFTST 188

Query: 186 HKDDTKFNLSSIVIGNGLTDPLV 208
           +K   +FN+  + + + ++D ++
Sbjct: 189 NKGIRQFNVKLVKVKSSISDRVI 211

>YJR132W (NMD5) [3023] chr10 (669437..672583) Member of the
           karyopherin-beta family, involved in nuclear transport
           and functions in small ribosomal subunit assembly [3147
           bp, 1048 aa]
          Length = 1048

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 168 ESYAGHYIPRIAHEIVS---VHKDDTKFNLS------SIVIGNGLTDPLVQNQYFKPMAC 218
           +S    Y  R+  ++V      K++ K N+       ++VI N +T+PL+  QY K   C
Sbjct: 796 DSLPQQYRERLLADVVGSILTQKNELKTNVVFSVTAFNVVISNMITEPLITLQYLKQQGC 855

Query: 219 GE 220
            E
Sbjct: 856 LE 857

>Scas_645.4
          Length = 351

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 49  DYQDKKH---SFYWFFESRN-DPANDPVILYLNGG 79
           D +D +H    F W+   ++ DP  DPV++Y +GG
Sbjct: 81  DEEDNEHLQIKFRWYVRPKDFDPERDPVLIYFHGG 115

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,921,474
Number of extensions: 725673
Number of successful extensions: 1584
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1539
Number of HSP's successfully gapped: 31
Length of query: 445
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 340
Effective length of database: 12,961,219
Effective search space: 4406814460
Effective search space used: 4406814460
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)