Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C14322g1841729311e-130
ABL057W2341314483e-56
Sklu_2430.141681344269e-54
Scas_721.1312381474268e-53
Scas_254.1*1371344003e-50
CAGL0K11572g2181364049e-50
Kwal_26.76772021224021e-49
YKL117W (SBA1)2161353673e-44
YBR129C (OPY1)32881632.7
CAGL0G09559g120886615.5
Scas_604.988240615.6
ADL038W150940598.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C14322g
         (181 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C14322g complement(1243993..1244547) similar to sp|P28707 S...   363   e-130
ABL057W [535] [Homologous to ScYKL117W (SBA1) - SH] complement(2...   177   3e-56
Sklu_2430.14 YKL117W, Contig c2430 26534-27040                        168   9e-54
Scas_721.131                                                          168   8e-53
Scas_254.1*                                                           158   3e-50
CAGL0K11572g complement(1120136..1120792) similar to sp|P28707 S...   160   9e-50
Kwal_26.7677                                                          159   1e-49
YKL117W (SBA1) [3147] chr11 (219970..220620) Ste5p-associated pr...   145   3e-44
YBR129C (OPY1) [316] chr2 complement(494309..495295) Protein tha...    29   2.7  
CAGL0G09559g complement(910788..914414) similar to sp|P21339 Sac...    28   5.5  
Scas_604.9                                                             28   5.6  
ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W...    27   8.6  

>KLLA0C14322g complement(1243993..1244547) similar to sp|P28707
           Saccharomyces cerevisiae YKL117w SBA1 Hsp90 (Ninety)
           Associated Co-chaperone singleton, start by similarity
          Length = 184

 Score =  363 bits (931), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 172/172 (100%), Positives = 172/172 (100%)

Query: 1   MSVHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGIK 60
           MSVHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGIK
Sbjct: 1   MSVHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGIK 60

Query: 61  YHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW 120
           YHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW
Sbjct: 61  YHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW 120

Query: 121 VDEDEQEENVAADNDLMSQFGQMGGAGFPGMEQGFNPQAFADAGINLDEALP 172
           VDEDEQEENVAADNDLMSQFGQMGGAGFPGMEQGFNPQAFADAGINLDEALP
Sbjct: 121 VDEDEQEENVAADNDLMSQFGQMGGAGFPGMEQGFNPQAFADAGINLDEALP 172

>ABL057W [535] [Homologous to ScYKL117W (SBA1) - SH]
           complement(293539..294243) [705 bp, 234 aa]
          Length = 234

 Score =  177 bits (448), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 101/131 (77%), Gaps = 2/131 (1%)

Query: 5   TPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHS--KDGIKYH 62
           TPEV WAQRS E+D+ KN + +T+ IPDC  PK++L   SLEFSA S  H+  KDG  Y 
Sbjct: 6   TPEVHWAQRSHETDEDKNYVLLTLVIPDCEEPKLKLESTSLEFSARSPGHTGEKDGHTYQ 65

Query: 63  LHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKWVD 122
           LHIDF+K ID E S+ RVANG+ Y+L L KK+LG EYWPRLTKEKLKYHYIKTDFDKWVD
Sbjct: 66  LHIDFFKEIDPEKSQHRVANGQGYYLKLVKKELGKEYWPRLTKEKLKYHYIKTDFDKWVD 125

Query: 123 EDEQEENVAAD 133
           EDEQEE   A+
Sbjct: 126 EDEQEEVPQAE 136

>Sklu_2430.14 YKL117W, Contig c2430 26534-27040
          Length = 168

 Score =  168 bits (426), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 87/134 (64%), Positives = 101/134 (75%), Gaps = 2/134 (1%)

Query: 3   VHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKD--GIK 60
           V TPEVLWAQRSS+SD  +N L +TI + DC +PK++L    LEF+A S  H  D     
Sbjct: 4   VITPEVLWAQRSSDSDPKRNYLLLTIGVRDCESPKLDLKPGYLEFTANSPGHVGDESAHS 63

Query: 61  YHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW 120
           Y LHIDFYK I  E+S  +VANG++YFL L KKDL  EYWPRLTKEKLKYH+IKTDFDKW
Sbjct: 64  YRLHIDFYKDIIPEDSLNKVANGQDYFLKLYKKDLDSEYWPRLTKEKLKYHFIKTDFDKW 123

Query: 121 VDEDEQEENVAADN 134
           VDEDEQEE+VA DN
Sbjct: 124 VDEDEQEEHVAEDN 137

>Scas_721.131
          Length = 238

 Score =  168 bits (426), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 86/147 (58%), Positives = 103/147 (70%), Gaps = 10/147 (6%)

Query: 3   VHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGI--K 60
           + TPEV WAQRS+E+D  KN L IT+ IPDC  PK++L     E +ALSK H  D    +
Sbjct: 5   ILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDEATHQ 64

Query: 61  YHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW 120
           Y LHIDF+K +  E S  RVANG++YFL + KKDLGLEYWPRLTKEK+KY+YIKTDFDKW
Sbjct: 65  YKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTDFDKW 124

Query: 121 VDEDEQEENVAADNDLMSQFGQMGGAG 147
           VDEDEQ+E    D+        M GAG
Sbjct: 125 VDEDEQDEVPEQDD--------MAGAG 143

>Scas_254.1*
          Length = 137

 Score =  158 bits (400), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 83/134 (61%), Positives = 96/134 (71%), Gaps = 2/134 (1%)

Query: 3   VHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKD--GIK 60
           V TPEVLWAQRSS+SD  +N L +TI + DC +PK++L    LEF+A S  H  D     
Sbjct: 4   VITPEVLWAQRSSDSDPKRNYLLLTIGVRDCESPKLDLKPGYLEFTANSPGHVGDESAHS 63

Query: 61  YHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW 120
           Y LHIDFYK I  E+S  ++   R  FL L KKDL  EYWPRLTKEKLKYH+IKTDFDKW
Sbjct: 64  YRLHIDFYKDIIPEDSLTKLLMARTTFLKLYKKDLDSEYWPRLTKEKLKYHFIKTDFDKW 123

Query: 121 VDEDEQEENVAADN 134
           VDEDEQEE+VA DN
Sbjct: 124 VDEDEQEEHVAEDN 137

>CAGL0K11572g complement(1120136..1120792) similar to sp|P28707
           Saccharomyces cerevisiae YKL117w SBA1 Hsp90 Associated
           Co-chaperone, hypothetical start
          Length = 218

 Score =  160 bits (404), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 84/136 (61%), Positives = 99/136 (72%), Gaps = 4/136 (2%)

Query: 3   VHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGIK-- 60
           V TPEV WAQRSSESD  KN L IT++IPDC +P++++   SL+  A S+ H  D  K  
Sbjct: 4   VLTPEVAWAQRSSESDAEKNYLLITVSIPDCESPEVKIEAGSLDLEAQSRGHVGDEHKHT 63

Query: 61  YHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW 120
           Y LHIDFYK I  E S  ++ANG++YFL L KKDL LEYWPRLTKEK+KY  IKTDFDKW
Sbjct: 64  YKLHIDFYKDIVPEKSLHKIANGQHYFLKLFKKDLELEYWPRLTKEKIKYSNIKTDFDKW 123

Query: 121 VDEDEQEENVAADNDL 136
           VDEDEQE   AAD  +
Sbjct: 124 VDEDEQE--TAADTGM 137

>Kwal_26.7677
          Length = 202

 Score =  159 bits (402), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 90/122 (73%), Gaps = 2/122 (1%)

Query: 2   SVHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGI-- 59
           S  TPEVLWAQRSS+SD  KN L +TI IPDC+ P ++LT   LEF A S  H+ D    
Sbjct: 3   STLTPEVLWAQRSSDSDAEKNYLLVTIVIPDCSEPTLDLTSTHLEFKAKSPGHTGDEQEH 62

Query: 60  KYHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDK 119
           +Y L IDFYK ID E S  RVANGRNYFL L KK+L  EYWPRLTKEKLKYHYIKTDF+K
Sbjct: 63  QYKLRIDFYKEIDAEKSLSRVANGRNYFLKLYKKELESEYWPRLTKEKLKYHYIKTDFNK 122

Query: 120 WV 121
           WV
Sbjct: 123 WV 124

>YKL117W (SBA1) [3147] chr11 (219970..220620) Ste5p-associated
           protein, putative cochaperone with Hsp90 family proteins
           (Hsp82p, Hsc82p) [651 bp, 216 aa]
          Length = 216

 Score =  145 bits (367), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 93/135 (68%), Gaps = 2/135 (1%)

Query: 3   VHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGIKYH 62
           V  P+V WAQRSS +D  +N + IT++I DC  P++ +  + +E  A SK H  D   +H
Sbjct: 5   VINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDENVHH 64

Query: 63  --LHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW 120
             LHID YK I  E +  +VANG++YFL L KKDL  EYWPRLTKEK+KY YIKTDFDKW
Sbjct: 65  YQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDKW 124

Query: 121 VDEDEQEENVAADND 135
           VDEDEQ+E  A  ND
Sbjct: 125 VDEDEQDEVEAEGND 139

>YBR129C (OPY1) [316] chr2 complement(494309..495295) Protein that
           blocks G1 arrest by mating pheromone (Far- phenotype)
           when overproduced [987 bp, 328 aa]
          Length = 328

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 11/81 (13%)

Query: 66  DFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPR----LTKEKLKYHYIKT------ 115
           +FY+  D  N+E +V +G  Y  V +KK      W +    LT      +  KT      
Sbjct: 203 EFYRMFDPRNAEHQVCSGILYTKVKKKKLFNRAKWQKFNVELTNTSFNLYSFKTGKLKKS 262

Query: 116 -DFDKWVDEDEQEENVAADND 135
              DK +D  E + N    ND
Sbjct: 263 IKLDKIIDCIELDNNSKMKND 283

>CAGL0G09559g complement(910788..914414) similar to sp|P21339
           Saccharomyces cerevisiae YOR188w MSB1
           morphogenesis-related protein, start by similarity
          Length = 1208

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 3/86 (3%)

Query: 11  AQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGIKYHLHIDFYKP 70
           AQ +++SD+TK+N  ++ +I + T P  +  +  L  S        +G  YH  ID    
Sbjct: 473 AQETTQSDNTKDNEHVSQDIRNITPPYEKFQKEVLNNSVNPSNGPSNG--YHTVIDLDAR 530

Query: 71  IDTENSEQRVANGRNYFLVLRKKDLG 96
            D  N + ++    N    LRKK  G
Sbjct: 531 KDKNNMKHKIQKW-NPLNNLRKKSGG 555

>Scas_604.9
          Length = 882

 Score = 28.1 bits (61), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%)

Query: 61  YHLHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYW 100
           YH  ID    +D++N+EQ        + +LR   L L YW
Sbjct: 581 YHYIIDEILDLDSDNNEQTTIENSMQYNILRSCSLHLIYW 620

>ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W -
            SH] complement(623312..627841) [4530 bp, 1509 aa]
          Length = 1509

 Score = 27.3 bits (59), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 20/40 (50%)

Query: 97   LEYWPRLTKEKLKYHYIKTDFDKWVDEDEQEENVAADNDL 136
            L Y  RL K  L    +K + D+W +ED+   +V  +  +
Sbjct: 967  LNYAARLMKNDLIAELMKGEHDRWFEEDDTNRSVGVEGGI 1006

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,639,569
Number of extensions: 310205
Number of successful extensions: 798
Number of sequences better than 10.0: 28
Number of HSP's gapped: 789
Number of HSP's successfully gapped: 28
Length of query: 181
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 86
Effective length of database: 13,307,399
Effective search space: 1144436314
Effective search space used: 1144436314
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 58 (26.9 bits)