Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C14256g36835918330.0
ABL054C35931812691e-176
YKL114C (APN1)36732512381e-171
CAGL0K11528g35432512271e-169
Scas_721.13335932112091e-167
Kwal_26.768536035112091e-167
Scas_707.3691544720.63
AER426C89846655.1
Sklu_2440.1949478637.2
YDR330W50030637.4
Kwal_47.1929253894637.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C14256g
         (362 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C14256g 1239373..1240479 similar to sp|P22936 Saccharomyces...   710   0.0  
ABL054C [538] [Homologous to ScYKL114C (APN1) - SH] (297682..298...   493   e-176
YKL114C (APN1) [3149] chr11 complement(222998..224101) AP endonu...   481   e-171
CAGL0K11528g 1116427..1117491 highly similar to sp|P22936 Saccha...   477   e-169
Scas_721.133                                                          470   e-167
Kwal_26.7685                                                          470   e-167
Scas_707.36                                                            32   0.63 
AER426C [2926] [Homologous to ScYIL137C - SH] (1453808..1456504)...    30   5.1  
Sklu_2440.19 YEL052W, Contig c2440 32002-33486 reverse complement      29   7.2  
YDR330W (YDR330W) [1159] chr4 (1127863..1129365) Protein possibl...    29   7.4  
Kwal_47.19292                                                          29   7.7  

>KLLA0C14256g 1239373..1240479 similar to sp|P22936 Saccharomyces
           cerevisiae YKL114c APN1 AP endonuclease singleton, start
           by similarity
          Length = 368

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/359 (95%), Positives = 344/359 (95%)

Query: 1   METYSSRRYLSNRMSFVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQ 60
           METYSSRRYLSNRMSFVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQ
Sbjct: 1   METYSSRRYLSNRMSFVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQ 60

Query: 61  WNSKPYPESEITKFNENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVR 120
           WNSKPYPESEITKFNENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVR
Sbjct: 61  WNSKPYPESEITKFNENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVR 120

Query: 121 CEQLGIGHYNFHPGSSLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNL 180
           CEQLGIGHYNFHPGSSLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNL
Sbjct: 121 CEQLGIGHYNFHPGSSLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNL 180

Query: 181 EDLKTVIDMIEDKNRVGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLN 240
           EDLKTVIDMIEDKNRVGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLN
Sbjct: 181 EDLKTVIDMIEDKNRVGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLN 240

Query: 241 DSKAPLAANADRHEILGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLE 300
           DSKAPLAANADRHEILGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLE
Sbjct: 241 DSKAPLAANADRHEILGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLE 300

Query: 301 WLETIDEEENKDYIEKRLALNKLGEKSRKEFQAKFDXXXXXXXXXXXXXXXGPSITEQL 359
           WLETIDEEENKDYIEKRLALNKLGEKSRKEFQAKFD               GPSITEQL
Sbjct: 301 WLETIDEEENKDYIEKRLALNKLGEKSRKEFQAKFDKKNKSTKTTKSTKRKGPSITEQL 359

>ABL054C [538] [Homologous to ScYKL114C (APN1) - SH]
           (297682..298761) [1080 bp, 359 aa]
          Length = 359

 Score =  493 bits (1269), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 268/318 (84%), Gaps = 2/318 (0%)

Query: 14  MSFVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQWNSKPYPESEITK 73
           M FVR T S++KFGAHVSGAGGISNSV NAH IGCN+FAMFLKSP+QW SK Y   EI +
Sbjct: 1   MGFVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKR 60

Query: 74  FNENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVRCEQLGIGHYNFHP 133
           F++NC +L Y+P+TD+LPHG YFINL NPD EKAEKAY AFLDDL RCEQLGIG YNFHP
Sbjct: 61  FHDNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHP 120

Query: 134 GSSLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNLEDLKTVIDMIEDK 193
           GS+L G++D QL+QLA YIN+AI++TKFV IVLENMAGHGN+IGS LEDL+TVID++E K
Sbjct: 121 GSALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQK 180

Query: 194 NRVGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLNDSKAPLAANADRH 253
           +RVGVCVDTCHT+AAGYDI ++ AFD FW KF   +G +YL ++H+NDSKAPLAANADRH
Sbjct: 181 DRVGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRH 240

Query: 254 EILGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLEWLETIDEEE--NK 311
           E+LGQGFLGLE F++IA S+FLQ IPI+LETPQKED GYGEEIK+LEWLE +D+E    +
Sbjct: 241 ELLGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDDEAALQQ 300

Query: 312 DYIEKRLALNKLGEKSRK 329
           +Y +K   L + G KSR+
Sbjct: 301 EYKDKCAELQQRGAKSRQ 318

>YKL114C (APN1) [3149] chr11 complement(222998..224101) AP
           endonuclease, DNA (apurinic or apyrimidinic site) lyase
           (3'-repair diesterase) [1104 bp, 367 aa]
          Length = 367

 Score =  481 bits (1238), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 265/325 (81%), Gaps = 3/325 (0%)

Query: 15  SFVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQWNSKPYPESEITKF 74
           SFVRS  SK+KFGAH+SGAGGISNSVTNA   GCNSFAMFLKSPR+W S  Y + EI KF
Sbjct: 6   SFVRSAVSKYKFGAHMSGAGGISNSVTNAFNTGCNSFAMFLKSPRKWVSPQYTQEEIDKF 65

Query: 75  NENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVRCEQLGIGHYNFHPG 134
            +NCA  +Y+P TD+LPHG YFINL NPD EKAEK+Y++F+DDL RCEQLGIG YN HPG
Sbjct: 66  KKNCATYNYNPLTDVLPHGQYFINLANPDREKAEKSYESFMDDLNRCEQLGIGLYNLHPG 125

Query: 135 SSLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNLEDLKTVIDMIEDKN 194
           S+L GDH  QLKQLA Y+NKAI +TKFV IVLENMAG GNL+GS+L DLK VI MIEDK+
Sbjct: 126 STLKGDHQLQLKQLASYLNKAIKETKFVKIVLENMAGTGNLVGSSLVDLKEVIGMIEDKS 185

Query: 195 RVGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLNDSKAPLAANADRHE 254
           R+GVC+DTCHT+AAGYDIST   F+ FWK+F+ +IGFKYL A+HLNDSKAPL AN D HE
Sbjct: 186 RIGVCIDTCHTFAAGYDISTTETFNNFWKEFNDVIGFKYLSAVHLNDSKAPLGANRDLHE 245

Query: 255 ILGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLEWLETIDEE---ENK 311
            LGQG+LG++VF++IAHSE+LQGIPIVLETP + D GYG EIKL+EWLE+  E    E+K
Sbjct: 246 RLGQGYLGIDVFRMIAHSEYLQGIPIVLETPYENDEGYGNEIKLMEWLESKSESELLEDK 305

Query: 312 DYIEKRLALNKLGEKSRKEFQAKFD 336
           +Y EK   L KLG KSRKE   KF+
Sbjct: 306 EYKEKNDTLQKLGAKSRKEQLDKFE 330

>CAGL0K11528g 1116427..1117491 highly similar to sp|P22936
           Saccharomyces cerevisiae YKL114c APN1 AP endonuclease,
           hypothetical start
          Length = 354

 Score =  477 bits (1227), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 223/325 (68%), Positives = 267/325 (82%), Gaps = 3/325 (0%)

Query: 15  SFVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQWNSKPYPESEITKF 74
           +F RST SK+KFGAH+SGAGGISNSVTNA   GCNSFAMFLKSPR+W S  + + EI KF
Sbjct: 3   TFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIAKF 62

Query: 75  NENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVRCEQLGIGHYNFHPG 134
            ENC K  Y+P TDILPHG YFINL NPD EKAEK+Y++F+DDL RCEQLG+G YNFHPG
Sbjct: 63  KENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFHPG 122

Query: 135 SSLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNLEDLKTVIDMIEDKN 194
           S+L GDHD QLKQLA YINKA+ +TKFV IVLENMAG GNL+GS+L DL+ VIDM+ DK+
Sbjct: 123 STLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTDKS 182

Query: 195 RVGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLNDSKAPLAANADRHE 254
           R+GVC+DTCHT+AAGYDI +K+AFD+FWK FD IIG+KYL ++HLNDSKAPL AN D HE
Sbjct: 183 RIGVCIDTCHTFAAGYDIQSKDAFDKFWKDFDDIIGYKYLASVHLNDSKAPLGANRDLHE 242

Query: 255 ILGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLEWLETI---DEEENK 311
            LG+G+LGL+ F+ +AH + L+GIPIVLETPQ +DAGY +E+KLLEWLETI   D ++ K
Sbjct: 243 KLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDKLK 302

Query: 312 DYIEKRLALNKLGEKSRKEFQAKFD 336
           +   K   L KLGEKSRKE  +KF+
Sbjct: 303 EMEAKNEELQKLGEKSRKEQMSKFE 327

>Scas_721.133
          Length = 359

 Score =  470 bits (1209), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 264/321 (82%)

Query: 16  FVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQWNSKPYPESEITKFN 75
           F+RSTTSK+KFGAH+SGAGGISNSV NAH  GCN+FAMFLKSPR+W S  + + EI KFN
Sbjct: 4   FIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIAKFN 63

Query: 76  ENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVRCEQLGIGHYNFHPGS 135
           +NC K +Y+P TDILPHG Y INL NPD EK +K+Y++FLDDL RCE LGIG YNFHPGS
Sbjct: 64  DNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFHPGS 123

Query: 136 SLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNLEDLKTVIDMIEDKNR 195
            L GD   QLKQLA ++N+AI +TKFV I+LENMAG GNL+GSNL+DL  VI+M+EDK R
Sbjct: 124 VLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVEDKTR 183

Query: 196 VGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLNDSKAPLAANADRHEI 255
           +GVCVDTCHT+AAGYDIS + +FD+FWK FD+IIG KYL A+HLNDSKAPL AN D HE 
Sbjct: 184 IGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDLHEK 243

Query: 256 LGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLEWLETIDEEENKDYIE 315
           LG+GFLGLEVF+IIAH++ L+GIPI+LETPQ ++ GYG EIKLLEWLE+++  E+++ I 
Sbjct: 244 LGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPEDQELIT 303

Query: 316 KRLALNKLGEKSRKEFQAKFD 336
           K     +LG KSRKE  +K++
Sbjct: 304 KSEEKQQLGSKSRKEQLSKWE 324

>Kwal_26.7685
          Length = 360

 Score =  470 bits (1209), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 224/351 (63%), Positives = 267/351 (76%), Gaps = 4/351 (1%)

Query: 16  FVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQWNSKPYPESEITKFN 75
           F R ++SK+KFGAH+S AGGISNSVTNA  IGCN+FAMFLKSPR+W S  Y + EI KF 
Sbjct: 4   FTRCSSSKYKFGAHISTAGGISNSVTNAFNIGCNAFAMFLKSPRKWVSPDYSQEEIEKFK 63

Query: 76  ENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVRCEQLGIGHYNFHPGS 135
           ENC +L Y+P TD+LPHG YFINL NP+HEKAEK+Y +F+DDL RCEQLG+G YNFHPGS
Sbjct: 64  ENCKELGYNPLTDVLPHGQYFINLANPEHEKAEKSYASFIDDLRRCEQLGVGLYNFHPGS 123

Query: 136 SLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNLEDLKTVIDMIEDKNR 195
           SL  DH TQL+QLA YINKAI++T FV IVLENMAG G L+GS L DLK VID+++DK+R
Sbjct: 124 SLKADHPTQLRQLASYINKAISETSFVKIVLENMAGTGTLVGSELSDLKEVIDLVDDKSR 183

Query: 196 VGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLNDSKAPLAANADRHEI 255
           VGVC+DTCHT+AAGYDIS+K AFD+FW+ FD  IGFKYL AIHLNDSKAPLAAN D HE 
Sbjct: 184 VGVCIDTCHTFAAGYDISSKEAFDKFWQLFDETIGFKYLAAIHLNDSKAPLAANRDLHEK 243

Query: 256 LGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLEWLETIDEEEN-KDYI 314
           LG+GF+GLE+FK++A S+FL+GIPI+LETP  +D GYG EIKLLEWLE   E+ +  ++ 
Sbjct: 244 LGEGFIGLEIFKLVAQSDFLKGIPIILETPHTKDEGYGHEIKLLEWLENFKEDTDLAEFE 303

Query: 315 EKRLALNKLGEKSRKEFQAKFD---XXXXXXXXXXXXXXXGPSITEQLTKK 362
            K   L   G KSR E  AKFD                  GP I +Q+  K
Sbjct: 304 SKAQDLLSKGAKSRDEQAAKFDKKKSTKTTKGGKKRANSAGPDIAQQMMSK 354

>Scas_707.36
          Length = 915

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 78  CAKLSYDP--KTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLV 119
           C  LSYDP  KT IL H      LGN  H K + A D   + LV
Sbjct: 76  CISLSYDPVSKTQILNHYEIVKELGNGQHGKVKLAKDIRANQLV 119

>AER426C [2926] [Homologous to ScYIL137C - SH] (1453808..1456504)
           [2697 bp, 898 aa]
          Length = 898

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 220 QFWKKFDAIIGFKYLKAIHLNDSKAPLAANADRHEILGQGFLGLEV 265
           +F+   DAIIG +Y K IHL    + LA  A     +G  F GL +
Sbjct: 562 RFFTDIDAIIGSRYQKPIHLQGLHSVLAHMAVLGVDIGNYFHGLAI 607

>Sklu_2440.19 YEL052W, Contig c2440 32002-33486 reverse complement
          Length = 494

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 9/78 (11%)

Query: 46  IGCNSFAMFLKSPRQWNSKPYPESEI-------TKFNENCAKLSYDPKTDILPHGSYFIN 98
           +   +  +FL SP  +   P P S +        K+N   +++S D  + I     YF  
Sbjct: 250 LKTRTHVIFLDSPTDYRKIPKPVSSVYYFPEHGLKYNSRDSQISRD--SHIRAWYEYFSQ 307

Query: 99  LGNPDHEKAEKAYDAFLD 116
           L NP  ++  +A+  ++D
Sbjct: 308 LHNPSAKEVTEAHQTYVD 325

>YDR330W (YDR330W) [1159] chr4 (1127863..1129365) Protein possibly
           involved in proteasome function [1503 bp, 500 aa]
          Length = 500

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 59  RQWNSK-PYPESEITKFNENCAKLSYDPKT 87
           +QWN   P PE  I++ NE  A  S DPK 
Sbjct: 313 KQWNRVVPIPEQFISEINEFLASFSLDPKV 342

>Kwal_47.19292
          Length = 538

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 11/94 (11%)

Query: 124 LGIGHYNFHPGSSLDGDHDTQLK-QLAGYINKAINDTKF-VNIVLENMAGHGNLIGSNLE 181
           LG+  +   P  S  G  D  L+ ++      A+ND +F + +  EN+      I  +  
Sbjct: 393 LGVSSW-VSPSDSDSGTFDVTLEIEVNESYQDALNDVRFCIPVFTENVR-----INDDFN 446

Query: 182 DLKTVIDMIEDKNRVGVCVDTC---HTYAAGYDI 212
           +L  VI+ ++D+N + V VDT     T A G  +
Sbjct: 447 ELGAVIESVDDENGIIVKVDTIPAGTTTAVGLSL 480

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,435,002
Number of extensions: 584907
Number of successful extensions: 1628
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1652
Number of HSP's successfully gapped: 23
Length of query: 362
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 259
Effective length of database: 13,030,455
Effective search space: 3374887845
Effective search space used: 3374887845
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)