Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C11957g70692392e-28
Sklu_1568.270691811e-19
Kwal_56.23403111691728e-18
Scas_636.9*72671646e-17
YDR086C (SSS1)80671638e-17
AGR157C70691515e-15
KLLA0D02332g16124620.29
ACL102W35622552.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C11957g
         (69 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C11957g complement(1027449..1027661) similar to sp|P35179 S...    97   2e-28
Sklu_1568.2 YDR086C, Contig c1568 3228-3440 reverse complement         74   1e-19
Kwal_56.23403                                                          71   8e-18
Scas_636.9*                                                            68   6e-17
YDR086C (SSS1) [938] chr4 complement(616922..617164) Component o...    67   8e-17
AGR157C [4468] [Homologous to ScYDR086C (SSS1) - SH] (1043498..1...    63   5e-15
KLLA0D02332g 198735..199220 no similarity, hypothetical start          28   0.29 
ACL102W [947] [Homologous to ScYIR026C (YVH1) - SH] complement(1...    26   2.9  

>KLLA0C11957g complement(1027449..1027661) similar to sp|P35179
          Saccharomyces cerevisiae YDR086c SSS1 ER
          protein-translocase complex subunit singleton, start by
          similarity
          Length = 70

 Score = 96.7 bits (239), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 50/69 (72%)

Query: 1  MAKQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKXXXXXXXXXXXXXXXXXXXKL 60
          MAKQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLK                   KL
Sbjct: 1  MAKQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKIIQAVGIGFVAVGVIGYIIKL 60

Query: 61 IHIPIRYLI 69
          IHIPIRYLI
Sbjct: 61 IHIPIRYLI 69

>Sklu_1568.2 YDR086C, Contig c1568 3228-3440 reverse complement
          Length = 70

 Score = 74.3 bits (181), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%)

Query: 1  MAKQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKXXXXXXXXXXXXXXXXXXXKL 60
          MAK N Q ++L E PLEFVK+G+ F+QKCKKP+ KEYLK                   KL
Sbjct: 1  MAKGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKIVRAVGIGFVAVGVIGYAIKL 60

Query: 61 IHIPIRYLI 69
          +HIPIRYLI
Sbjct: 61 VHIPIRYLI 69

>Kwal_56.23403
          Length = 111

 Score = 70.9 bits (172), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 43/69 (62%)

Query: 1   MAKQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKXXXXXXXXXXXXXXXXXXXKL 60
           M+K N Q +KL E P+EFVKEG+ F+QKCKKP+ K++L+                   KL
Sbjct: 42  MSKSNNQIEKLAEAPVEFVKEGSAFIQKCKKPTNKDFLQIVRAVGIGFVAVGIIGYAIKL 101

Query: 61  IHIPIRYLI 69
           +HIPIRYLI
Sbjct: 102 VHIPIRYLI 110

>Scas_636.9*
          Length = 72

 Score = 67.8 bits (164), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (59%)

Query: 3  KQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKXXXXXXXXXXXXXXXXXXXKLIH 62
          K + Q +KL++ PLEFVK+GNQFL KCKKP  KEY +                   KLIH
Sbjct: 5  KSDNQIEKLMDAPLEFVKDGNQFLNKCKKPDLKEYTRIVRAVGIGFVAVGIIGYAIKLIH 64

Query: 63 IPIRYLI 69
          IPIRY+I
Sbjct: 65 IPIRYVI 71

>YDR086C (SSS1) [938] chr4 complement(616922..617164) Component of
          the Sec61p-Sss1p-Sbh1p complex and the
          Ssh1p-Sss1p-Sbh2p complex, involved in protein
          translocation into the endoplasmic reticulum [243 bp,
          80 aa]
          Length = 80

 Score = 67.4 bits (163), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 39/67 (58%)

Query: 3  KQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKXXXXXXXXXXXXXXXXXXXKLIH 62
          + N Q +KLVE P+EFV+EG QFL KCKKP  KEY K                   KLIH
Sbjct: 13 QSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIH 72

Query: 63 IPIRYLI 69
          IPIRY+I
Sbjct: 73 IPIRYVI 79

>AGR157C [4468] [Homologous to ScYDR086C (SSS1) - SH]
          (1043498..1043710) [213 bp, 70 aa]
          Length = 70

 Score = 62.8 bits (151), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (56%)

Query: 1  MAKQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKXXXXXXXXXXXXXXXXXXXKL 60
          MAK N   +KL + PLEF K+G  FL KC KP+++E+L+                   KL
Sbjct: 1  MAKNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKL 60

Query: 61 IHIPIRYLI 69
          IHIPIR+LI
Sbjct: 61 IHIPIRHLI 69

>KLLA0D02332g 198735..199220 no similarity, hypothetical start
          Length = 161

 Score = 28.5 bits (62), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 14 TPLEFVKEGNQFLQKCKKPSKKEY 37
          TP++F   G QFL + KKPS  E+
Sbjct: 21 TPVKFRPTGTQFLNQYKKPSAAEH 44

>ACL102W [947] [Homologous to ScYIR026C (YVH1) - SH]
          complement(162893..163963) [1071 bp, 356 aa]
          Length = 356

 Score = 25.8 bits (55), Expect = 2.9,   Method: Composition-based stats.
 Identities = 8/22 (36%), Positives = 16/22 (72%)

Query: 16 LEFVKEGNQFLQKCKKPSKKEY 37
          L+++ E N+F+ +C  P ++EY
Sbjct: 72 LQYINESNRFIDQCLFPHEEEY 93

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,722,440
Number of extensions: 42084
Number of successful extensions: 118
Number of sequences better than 10.0: 8
Number of HSP's gapped: 112
Number of HSP's successfully gapped: 8
Length of query: 69
Length of database: 16,596,109
Length adjustment: 42
Effective length of query: 27
Effective length of database: 15,142,153
Effective search space: 408838131
Effective search space used: 408838131
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)