Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C11913g52952123440.0
Kwal_56.2339053352316560.0
Scas_576.0d48945115980.0
CAGL0I08613g55945115220.0
AGR155C49541111051e-146
Kwal_55.221736591171023e-04
CAGL0K03157g724154950.002
Kwal_14.803693294780.20
KLLA0F28083g698300770.26
CAGL0H08778g106564711.6
YHL016C (DUR3)735150683.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C11913g
         (521 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C11913g complement(1024233..1025822) similar to ca|CA4263|I...   907   0.0  
Kwal_56.23390                                                         642   0.0  
Scas_576.0d                                                           620   0.0  
CAGL0I08613g complement(839912..841591) weakly similar to sp|P33...   590   0.0  
AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp...   430   e-146
Kwal_55.22173                                                          44   3e-04
CAGL0K03157g 290552..292726 highly similar to sp|P33413 Saccharo...    41   0.002
Kwal_14.803                                                            35   0.20 
KLLA0F28083g complement(2594274..2596370) similar to ca|CA5245|C...    34   0.26 
CAGL0H08778g 854147..857344 some similarities with tr|Q12221 Sac...    32   1.6  
YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permeas...    31   3.1  

>KLLA0C11913g complement(1024233..1025822) similar to
           ca|CA4263|IPF2277 Candida albicans unknown function,
           start by similarity
          Length = 529

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/521 (89%), Positives = 468/521 (89%)

Query: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60
           MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL
Sbjct: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60

Query: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120
           GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG
Sbjct: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120

Query: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180
           IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI
Sbjct: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180

Query: 181 SFITDTXXXXXXXXXXXXXXCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240
           SFITDT              CAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN
Sbjct: 181 SFITDTIQVSIVFILLIIVSCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240

Query: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300
           DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG
Sbjct: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300

Query: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRXXXX 360
           AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIR    
Sbjct: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRGIVV 360

Query: 361 XXXXXXXXXXXXADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFLTAWEIIGGGFGGLLS 420
                       ADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFLTAWEIIGGGFGGLLS
Sbjct: 361 LIMVPVVVVGLIADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFLTAWEIIGGGFGGLLS 420

Query: 421 VWIFGTVYYDSPREGGKLLLIWNGLYADDWXXXXXXXXXXXXXXXXXXXXXXXRTIIVYI 480
           VWIFGTVYYDSPREGGKLLLIWNGLYADDW                       RTIIVYI
Sbjct: 421 VWIFGTVYYDSPREGGKLLLIWNGLYADDWAAFGAFVVAPFGGLIFGFFVLFVRTIIVYI 480

Query: 481 DCKKNNKPFDLYSKKFIYRHEGEVQSTTTDGDKKSFTSVER 521
           DCKKNNKPFDLYSKKFIYRHEGEVQSTTTDGDKKSFTSVER
Sbjct: 481 DCKKNNKPFDLYSKKFIYRHEGEVQSTTTDGDKKSFTSVER 521

>Kwal_56.23390
          Length = 533

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/523 (61%), Positives = 383/523 (73%), Gaps = 14/523 (2%)

Query: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60
           MG +S  AAHGI+WP Y V+L+ A  +A+WK     KTFLSANGTQ+GVPLAFNFVASAL
Sbjct: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWK--KDAKTFLSANGTQKGVPLAFNFVASAL 58

Query: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120
           G GV S YPQIANI GL GLLVY+LAG LPMF+FAFFGPIIRKK P GFVLTEWV  R+G
Sbjct: 59  GVGVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYG 118

Query: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180
           ++ G YLSACTI+T+FLFMVSELASLK+ IESLT IKALPV+IVECV+TTIYT++GGFHI
Sbjct: 119 VVGGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHI 178

Query: 181 SFITDTXXXXXXXXXXXXXXCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240
           SF+TDT              CAMG+Y+ ID S I  SGLLK + LGWQLVYIL VAIFTN
Sbjct: 179 SFLTDTMQVSVVFVILVIVACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTN 238

Query: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300
           DFF+SGFWLRTFAARTDKDL+IGCS+A  +L   V +IGVTG +AVWAG + VADQE  G
Sbjct: 239 DFFLSGFWLRTFAARTDKDLLIGCSLAFAVLVAIVALIGVTGFLAVWAGLVEVADQELGG 298

Query: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRXXXX 360
           ++FFI+LT MP WV+GFVLAF+ +LSTCTLDSLQSA+VSTISND+FRNKLP+I++R    
Sbjct: 299 SSFFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRGLVA 358

Query: 361 XXXXXXXXXXXXADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFLTAWEIIGGGFGGLLS 420
                       A+DVL+I+LIVDLLSS+VVP+LMLGL S+  FL+AWEI+GGG GG+ +
Sbjct: 359 LIMVPVVVVGLIAEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFLSAWEIVGGGLGGIFA 418

Query: 421 VWIFGTVYYDSPREGGKLLLIWNGL--------YADDWXXXXXXXXXXXXXXXXXXXXXX 472
           VWIFGTVYYDSPREGG+LLL+ NGL        Y +DW                      
Sbjct: 419 VWIFGTVYYDSPREGGRLLLVSNGLYGQDSQGVYGNDWSAFGAFVVAPFGGMLAGFLILA 478

Query: 473 XRTIIVYIDCKKNNKPFDLYSKKFIYRHEGEVQSTTTDGDKKS 515
            RT +VY+ C+     FD+Y K        E+Q   T  D  +
Sbjct: 479 LRTAVVYLRCRSKGLEFDMYKKP----PAAELQDEDTGYDSAT 517

>Scas_576.0d
          Length = 489

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/451 (70%), Positives = 369/451 (81%), Gaps = 3/451 (0%)

Query: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60
           MG +S   A+ I+WPTY+V+L+ AS +A+WK     K+FLS+NGTQ+ +PLAFNFVAS L
Sbjct: 12  MGILSAVTANAIIWPTYMVLLISASAIAYWK--RDSKSFLSSNGTQKALPLAFNFVASGL 69

Query: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120
           GCGVLSAYPQIANIDGL GLLVY+++G LPMF+FA+ GP+IRKK P GFVLTEWV  RFG
Sbjct: 70  GCGVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFG 129

Query: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180
           +ICGWYLSACTI+T++LF+VSE+ASLKY IE++T IKALPVII+ECVVTTIYTSIGGF+I
Sbjct: 130 LICGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNI 189

Query: 181 SFITDTXXXXXXXXXXXXXXCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240
           SFITD               CAMGSY+ ID+SLI  SGLLK + LGWQLVYILT AIFTN
Sbjct: 190 SFITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTN 249

Query: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300
           DFFMSGFWLRTFA+R+DKDLMIGCS+A VIL VF TV+GVTG IAVWAG + VAD+ENSG
Sbjct: 250 DFFMSGFWLRTFASRSDKDLMIGCSVACVILVVFCTVVGVTGFIAVWAGLVQVADEENSG 309

Query: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRXXXX 360
           AAFFI+L Q+P WV+GF + FV +LSTCTLDSLQSALVSTISND+FRN+L I+W+R    
Sbjct: 310 AAFFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWVRGIVV 369

Query: 361 XXXXXXXXXXXXADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFL-TAWEIIGGGFGGLL 419
                       A++VL IYLIVDLLSSSVVP+L+LG  SKFD L TAWE+IGGG GG+L
Sbjct: 370 LIMVPVVVVGLIAENVLNIYLIVDLLSSSVVPVLVLGFWSKFDDLWTAWEVIGGGLGGIL 429

Query: 420 SVWIFGTVYYDSPREGGKLLLIWNGLYADDW 450
           SVWIFGTVYY S REGG+LLLI NGLY DDW
Sbjct: 430 SVWIFGTVYYHSAREGGRLLLISNGLYVDDW 460

>CAGL0I08613g complement(839912..841591) weakly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c DUR3, hypothetical
           start
          Length = 559

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/451 (68%), Positives = 364/451 (80%), Gaps = 3/451 (0%)

Query: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60
           MG +S  AAH I+WPTY V+L+ AS++A+WK     KTFLSANGTQ+ +PLAFNFVAS L
Sbjct: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWK--RDSKTFLSANGTQKAIPLAFNFVASGL 58

Query: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120
           GCGVLS YPQIAN+DGL GLLVY+LAG LPMF+FAF GP+IRKK P GFVLTEWV  RFG
Sbjct: 59  GCGVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFG 118

Query: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180
           ++CGWYLSACTI+T++LF+VSE+ASLKYAI++LT I +LPVII+ECVVTTIYTSIGGFHI
Sbjct: 119 LLCGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHI 178

Query: 181 SFITDTXXXXXXXXXXXXXXCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240
           SF+TD+               AMGS +HID+ LI  SGLLK + LGWQLVYILTVAIFTN
Sbjct: 179 SFMTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTN 238

Query: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300
           DFFMSGFWLRTFA+R++KDL+IGCS+A  IL  FVTV+GVTG IAVWAG +P  DQENSG
Sbjct: 239 DFFMSGFWLRTFASRSNKDLLIGCSLACFILVTFVTVVGVTGFIAVWAGLLPARDQENSG 298

Query: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRXXXX 360
           AAF+++L Q+P W+IGF L FV +LSTCTLDSLQSALVSTISND+FRNKL I+ +R    
Sbjct: 299 AAFYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLVRGIVV 358

Query: 361 XXXXXXXXXXXXADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFL-TAWEIIGGGFGGLL 419
                       A DVL+IYLIVDLLSSSVVP+L++GL  K D + +AWE+IGGG  G+L
Sbjct: 359 AIMVPVVVVGLIAQDVLSIYLIVDLLSSSVVPVLVVGLWGKLDEIWSAWEVIGGGCAGIL 418

Query: 420 SVWIFGTVYYDSPREGGKLLLIWNGLYADDW 450
            VWIFGTVYY S +EGG+LLLI NGLYADDW
Sbjct: 419 GVWIFGTVYYHSAKEGGRLLLISNGLYADDW 449

>AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp,
           495 aa]
          Length = 495

 Score =  430 bits (1105), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 248/411 (60%), Positives = 319/411 (77%), Gaps = 4/411 (0%)

Query: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60
           MG +S  AA+ IVWPTY VML  AS+LA+ +  +  +TFLSANGTQ+ VPLA NF+AS L
Sbjct: 62  MGKLSYVAANAIVWPTYAVMLAVASVLAY-RLRNV-RTFLSANGTQKAVPLALNFIASGL 119

Query: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120
           GCGVL AYPQ+AN+ GLQGLLVY L  +LPM++FAFFGP+I++ CPDGFVLTEWV+RRFG
Sbjct: 120 GCGVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFG 179

Query: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180
            +   YLSACTI+T++LFMVSE+ SL+ A+++L+ IK +PV++V+CVVTTIYT+IGGFHI
Sbjct: 180 RVAALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPVVVVQCVVTTIYTAIGGFHI 239

Query: 181 SFITDTXXXXXXXXXXXXXXCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240
           SF+TD+               A+G+ V ID + I  SGLL+ S LGWQLVYILTVAIFTN
Sbjct: 240 SFVTDSLQATVVLLLVVVGAVAVGTSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTN 299

Query: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300
           DFFMSGFWLRTFAAR+++DL++GCS+AAV+LAV + ++GVTG++AVWAGY PVAD ++  
Sbjct: 300 DFFMSGFWLRTFAARSNRDLLLGCSLAAVLLAVVLLLVGVTGLLAVWAGYAPVADLDS-- 357

Query: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRXXXX 360
           A+FF++L  +P W  G VLA VV+LSTCTLDS QSALVSTISND+FRN+LP ++ R    
Sbjct: 358 ASFFLLLAALPAWANGVVLALVVVLSTCTLDSFQSALVSTISNDLFRNRLPPLYARAAVA 417

Query: 361 XXXXXXXXXXXXADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFLTAWEII 411
                       A D+L IYLIVDLLS++VVP+++LG   +   L+AWE+I
Sbjct: 418 VVMVPVVVVGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARLSAWELI 468

>Kwal_55.22173
          Length = 659

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 57/117 (48%), Gaps = 6/117 (5%)

Query: 72  ANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFGIICG-WYLSAC 130
           A + G+ G  +Y++ G++ + +FAF    I+++ P    ++E +  RFG      YL  C
Sbjct: 79  AYLHGISGAWLYAVGGTIQITLFAFLALQIKQRAPSAHTVSEMLYVRFGKSGHIMYLCYC 138

Query: 131 TIITIFLFMVSELASL--KYAIESLTKIKALPVIIVECVVTTIYTSIGGFHISFITD 185
               +   MVS L  L    A  + T +  +    +  +   +YT++GG   +FI+D
Sbjct: 139 AATNV---MVSSLLLLGGSQAFAAATGMHTVAASFLLPLNVVVYTALGGLKATFISD 192

>CAGL0K03157g 290552..292726 highly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c Urea active
           transporter, start by similarity
          Length = 724

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 70/154 (45%), Gaps = 11/154 (7%)

Query: 37  KTFLSANGTQRGVPLAFNFVASALGCGVL--SAYPQIANIDGLQGLLVYSLAGSLPMFIF 94
           + F +A  T +   +A   V+S + C  L  SA  Q+   DG+ G   YS      +  F
Sbjct: 46  EEFTTAGRTVKTGLVAAAVVSSWIWCSTLLTSASKQL---DGMLGGYSYSAGACFQIVAF 102

Query: 95  AFFGPIIRKKCPDGFVLTEWVIRRFGII---CGWYLSACTIITIFLFMVSELASLKYAIE 151
           A      ++K P+     E V +R+G I   C  + +  T I +   +++  A++    E
Sbjct: 103 AILAIKTKQKAPNAHTYLELVRKRYGKIGHCCYLFYAFATNILVTAMLLTSGAAV---FE 159

Query: 152 SLTKIKALPVIIVECVVTTIYTSIGGFHISFITD 185
           S+T + ++    +  V   IYT  GG   +F+TD
Sbjct: 160 SMTGMNSVASCFLLPVGVVIYTLFGGIKATFLTD 193

>Kwal_14.803
          Length = 693

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 118/294 (40%), Gaps = 49/294 (16%)

Query: 93  IFAFFGPIIRKKCPDGFVLTEWVIRRFGIICGWYLSACTIITIFLFMVSELASLKYAIES 152
           + A  G   +KK P G    E V  R+G        +  I+ +FL +V+ L S    I  
Sbjct: 107 VMALLGIHAKKKIPKGHTCLEIVHLRYG-------KSTHILYMFLCLVNNLLSTSAMI-- 157

Query: 153 LTKIKALPVII--VECVVTTI--------YTSIGGFHISFITDTXXXXXXXXXXXXXXCA 202
           L    A+ +I   +  V +T+        YT +GG   +F+TD                A
Sbjct: 158 LAAAGAISIICGDLHIVASTMLIPFGVMAYTVVGGLKATFLTDYVHSLIALAILVYINTA 217

Query: 203 MGSYVHI-------DKSLIAESG-LLKASTLGWQLVYILTVAIF------TNDFFM---- 244
           + +  HI       D  L  +S   ++ +  G  L      AIF        DF +    
Sbjct: 218 VINSEHIGGIGGLYDLVLKQDSSRYIEGNYKGSFLTGKSQGAIFFGIIHCIGDFGLTVMD 277

Query: 245 SGFWLRTFAARTDKDLMIGCSIAAVILAVFV----TVIGVTGMIAVWAGYMPVADQE--- 297
           S FW ++F+A     +  G  IAAV++   V    T++G++ +      + P   ++   
Sbjct: 278 SSFWQKSFSANVRASVP-GYLIAAVLIPAIVWPLGTIVGLSNVAIENEPFFPTYPRKMTD 336

Query: 298 ---NSGAAFFIVLTQMPG-WVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFR 347
              NSG      L  + G   +G +L  + +  T T+ +   A+ S IS DIF+
Sbjct: 337 FEINSGFGLPYTLKALLGNKSLGALLLTIYLAVTSTVSAQMIAVSSIISFDIFK 390

>KLLA0F28083g complement(2594274..2596370) similar to
           ca|CA5245|CaDUR32 Candida albicans Urea transport
           protein (by homology), start by similarity
          Length = 698

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 122/300 (40%), Gaps = 49/300 (16%)

Query: 88  SLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFGIICGWYLSACTIITIFLFMVSELASLK 147
           S+ + + A  G   +KK P+G    E V  R+G        +  I+ +F+ +V+ L S  
Sbjct: 102 SVQICLMALLGIQAKKKIPNGHTCLEIVELRYG-------KSAHILYMFMCLVNNLLSSS 154

Query: 148 YAIESLTKIKALPVII--VECVVTTI--------YTSIGGFHISFITDTXXXXXXXXXXX 197
             I  L    A+ +I   +  V +T+        YT +GG   +F+TD            
Sbjct: 155 SMI--LGSAAAISIISGNLHIVASTMLIPFGVMCYTVVGGLKATFLTDYMHSLIALIILV 212

Query: 198 XXXCAMGSYVHI-------DKSLIAESG-LLKASTLGWQLVYILTVAIF------TNDFF 243
               A+ S   I       DK +  E    ++ +  G  L      AIF        DF 
Sbjct: 213 YFNTAVISSDKIGGISGLYDKVIQHEGDRYIEGNYQGSFLTGKSQGAIFFGIIHCVGDFG 272

Query: 244 M----SGFWLRTFAARTDKDLMIGCSIAAVILAVFV----TVIGVTGMIAVWAGYMPVAD 295
           +    S FW + F+A   K  + G  IAA ++   V    T+IG++ ++     + P   
Sbjct: 273 LTVMDSSFWQKAFSANV-KASVPGYLIAAALIPAIVWPLGTIIGLSNIVLEGESFFPTYP 331

Query: 296 QE------NSGAAF-FIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRN 348
           +       N+G    + ++  +    +G +L  + +  T T+ +   A+ S IS DI+RN
Sbjct: 332 RAMTSYEINNGFGLPYTLMAVLGKSSLGGLLLAIYLAVTSTVSAQMIAVSSIISFDIYRN 391

>CAGL0H08778g 854147..857344 some similarities with tr|Q12221
           Saccharomyces cerevisiae YPR042c PUF2 or sp|P47135
           Saccharomyces cerevisiae YJR091c JSN1, hypothetical
           start
          Length = 1065

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 9/64 (14%)

Query: 121 IICGWYLSACT-------IITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYT 173
           ++  WYL +CT       II+  +  + EL S  + + SLT +K L + I +CV  +I T
Sbjct: 782 LLVTWYLDSCTFEEKYAMIISSLIPHIVELCS--HRLGSLTVLKLLNLRIDQCVKDSILT 839

Query: 174 SIGG 177
           +I G
Sbjct: 840 AIFG 843

>YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permease,
           member of the solute:sodium symporter (SSS) family of
           membrane transporters [2208 bp, 735 aa]
          Length = 735

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 57/150 (38%), Gaps = 2/150 (1%)

Query: 37  KTFLSANGTQRGVPLAFNFVASALGCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAF 96
           + F +A  + +   +A   V+S + C  L         DG+ G   Y+      +  FA 
Sbjct: 46  EEFTTAGRSVKTGLVAAAVVSSWIWCSTLLTSSTKEYADGIFGGYAYAAGACFQIIAFAI 105

Query: 97  FGPIIRKKCPDGFVLTEWVIRRFGII-CGWYLSACTIITIFLFMVSELASLKYAIESLTK 155
                ++  P+     E V  R+G I  G YL    I T  L     L S       LT 
Sbjct: 106 LAIKTKQMAPNAHTYLELVRTRYGKIGHGCYLFYA-IATNILVTSMLLTSGSAVFSDLTG 164

Query: 156 IKALPVIIVECVVTTIYTSIGGFHISFITD 185
           +  +    +  V   +YT  GG   +F+TD
Sbjct: 165 MNTIASCFLLPVGVVVYTLFGGIKATFLTD 194

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.142    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,105,063
Number of extensions: 518854
Number of successful extensions: 1513
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1509
Number of HSP's successfully gapped: 23
Length of query: 521
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 415
Effective length of database: 12,926,601
Effective search space: 5364539415
Effective search space used: 5364539415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)