Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C11869g19519210081e-141
AGR153C2011985881e-77
Sklu_501.11951945765e-76
Kwal_56.233791951945741e-75
YDR084C1991985541e-72
Scas_636.82011965532e-72
CAGL0K09988g1961935498e-72
Scas_654.350273605.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C11869g
         (192 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C11869g complement(1020415..1021002) similar to sp|P38962 S...   392   e-141
AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)...   231   1e-77
Sklu_501.1 YDR084C, Contig c501 280-867                               226   5e-76
Kwal_56.23379                                                         225   1e-75
YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein ...   218   1e-72
Scas_636.8                                                            217   2e-72
CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces c...   216   8e-72
Scas_654.3                                                             28   5.9  

>KLLA0C11869g complement(1020415..1021002) similar to sp|P38962
           Saccharomyces cerevisiae YDR084c singleton, start by
           similarity
          Length = 195

 Score =  392 bits (1008), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 192/192 (100%), Positives = 192/192 (100%)

Query: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF 60
           MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF
Sbjct: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF 60

Query: 61  TKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTI 120
           TKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTI
Sbjct: 61  TKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTI 120

Query: 121 WVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEAPLFQLPMLPSFA 180
           WVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEAPLFQLPMLPSFA
Sbjct: 121 WVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEAPLFQLPMLPSFA 180

Query: 181 NLDRVTRLQSFF 192
           NLDRVTRLQSFF
Sbjct: 181 NLDRVTRLQSFF 192

>AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)
           [606 bp, 201 aa]
          Length = 201

 Score =  231 bits (588), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (71%), Gaps = 6/198 (3%)

Query: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQF-IIVILTLAADFY 59
           MDS RNFY TI+ SSHPL+L++HL GKA+P+ FYLLG WF+S T  F II IL LA DFY
Sbjct: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60

Query: 60  FTKNINGRKLIQQRWWYDVSG--EDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVA 117
            TKNI+GRKL+  RWW++ +G  ED + F FES+K+YPD +   +NPIDSKLFW+S Y A
Sbjct: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120

Query: 118 PTIWVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEAPLFQLPMLP 177
           P +W +FG LC+++ QF+ L LV+FA GL  +NAY +R CD+WEP   +       P +P
Sbjct: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSSIWPQMP 180

Query: 178 SFANLDRVTRL---QSFF 192
           +F N++ + RL   Q+FF
Sbjct: 181 TFTNVENIQRLFTFQTFF 198

>Sklu_501.1 YDR084C, Contig c501 280-867
          Length = 195

 Score =  226 bits (576), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 118/194 (60%), Positives = 144/194 (74%), Gaps = 4/194 (2%)

Query: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSS-TVQFIIVILTLAADFY 59
           MD  +NFY+TIL SSHPLIL++HLLGKA PI+ YLLGSWF+ S    FI+VIL LAADFY
Sbjct: 1   MDQIKNFYETILKSSHPLILSLHLLGKAAPILSYLLGSWFIHSFAALFILVILLLAADFY 60

Query: 60  FTKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPT 119
            TKNI+GRKL+Q RWWYD  G+  T F FES+K+YP  A  PINPIDSKLFW S+Y+ P 
Sbjct: 61  LTKNISGRKLVQLRWWYDSMGQAKTPFTFESYKQYP--AGNPINPIDSKLFWWSIYLTPV 118

Query: 120 IWVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGH-TAEAPLFQLPMLPS 178
           +W +FG LC++KFQF+YL+LV+ A GLN WNA+ +R CD+WEPG  +       LP L S
Sbjct: 119 VWAIFGILCILKFQFLYLLLVVLALGLNGWNAHGFRSCDKWEPGQDSGNNSWIXLPNLSS 178

Query: 179 FANLDRVTRLQSFF 192
             NL R+ R  SFF
Sbjct: 179 LENLSRIARFXSFF 192

>Kwal_56.23379
          Length = 195

 Score =  225 bits (574), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 108/194 (55%), Positives = 137/194 (70%), Gaps = 4/194 (2%)

Query: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF 60
           MD A+NFY+TIL SSHPL+L++H+ GKA P+V YL+GSWFLS T  FI V+L LA DFY 
Sbjct: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60

Query: 61  TKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTI 120
           TKNINGRKL+Q RWWYD S    +   FES+KEY      PINP+DSKLFW SLYV+P +
Sbjct: 61  TKNINGRKLVQLRWWYDSSSSKDSPLTFESYKEY--APGPPINPVDSKLFWWSLYVSPAL 118

Query: 121 WVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEA--PLFQLPMLPS 178
           WV+FG LCL + +F+YLIL+  A  L  WN + +R CD+W+P   +      FQLP + +
Sbjct: 119 WVIFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSKTETWFQLPNIAT 178

Query: 179 FANLDRVTRLQSFF 192
           F NL R   +Q+FF
Sbjct: 179 FENLGRFATVQNFF 192

>YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spbc2a9.05cp [600 bp, 199 aa]
          Length = 199

 Score =  218 bits (554), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 132/198 (66%), Gaps = 8/198 (4%)

Query: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF 60
           MD ARNFY TIL SSHPL+L+ HL GKAVPIVFY++GS FL+ T QFI V+L L+ DFY 
Sbjct: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL 60

Query: 61  TKNINGRKLIQQRWWYDVSG-EDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPT 119
           TKNI GRKL+Q RWWYD +     + F FES+K+Y      PIN IDSKLFW S+YV P 
Sbjct: 61  TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQY--APGPPINAIDSKLFWWSMYVTPV 118

Query: 120 IWVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEAPL-----FQLP 174
           IW VF  LCL++ +  YLILVI A  L  WN Y +R CD+WEP             F LP
Sbjct: 119 IWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALP 178

Query: 175 MLPSFANLDRVTRLQSFF 192
            +P F NL R+  +QSFF
Sbjct: 179 SVPGFENLSRLANIQSFF 196

>Scas_636.8
          Length = 201

 Score =  217 bits (553), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 136/196 (69%), Gaps = 4/196 (2%)

Query: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF 60
           M+   NFY TIL SSHP++L +HL GKA PIVFY++GS FL  T QFI V+L LA DFY 
Sbjct: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL 60

Query: 61  TKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTI 120
           TKNI+GRKL+Q RWWYD + E+T TFRFES+K+YP     PINPIDS+LFW S+Y  P +
Sbjct: 61  TKNISGRKLVQLRWWYDSTTENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYATPIV 120

Query: 121 WVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEP----GHTAEAPLFQLPML 176
           W VFG LC+++ +  YL+LV+ A  L  WN Y +R CD+W+P       +    FQLP +
Sbjct: 121 WAVFGILCILRLKLFYLVLVVVAVFLTGWNTYGFRCCDKWDPIAKNADNSTESWFQLPSI 180

Query: 177 PSFANLDRVTRLQSFF 192
           P   NL R+ R QSFF
Sbjct: 181 PGLDNLQRMARFQSFF 196

>CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces
           cerevisiae YDR084c, start by similarity
          Length = 196

 Score =  216 bits (549), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 102/193 (52%), Positives = 129/193 (66%), Gaps = 3/193 (1%)

Query: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF 60
           MD  RNFY TIL SSHPL++  HL GKA P+ FY+ G  F S T  FI ++L LAADFYF
Sbjct: 1   MDHVRNFYDTILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTALFITIVLLLAADFYF 60

Query: 61  TKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTI 120
           TKNI+GR+L+Q RWWYD S   T TF FES K+Y   A  PINPIDSKLFW S+Y+ P I
Sbjct: 61  TKNISGRRLVQLRWWYDSSATSTETFTFESHKQY--TAGPPINPIDSKLFWWSMYLTPAI 118

Query: 121 WVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHT-AEAPLFQLPMLPSF 179
           W V G L +++ + +  IL+  A  +  WN Y +R CD+W P ++ +  P FQLP +P  
Sbjct: 119 WFVLGILAILRLKLITFILIAVATCMTGWNTYGFRCCDRWNPNNSQSTEPFFQLPSIPGL 178

Query: 180 ANLDRVTRLQSFF 192
            N+ R+ R QSFF
Sbjct: 179 DNITRLARFQSFF 191

>Scas_654.3
          Length = 502

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 66  GRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTIWVVF- 124
           G K +QQ   +      T     E    YP    A  +P+D++L++  +Y+AP  +  F 
Sbjct: 299 GDKSLQQ---FQSGASKTVKLLSELSLSYPSYRMASTDPVDTELYFAVIYLAPGDYHHFH 355

Query: 125 ---GFLCLIKFQF 134
               ++C ++  F
Sbjct: 356 SPIDWVCKVRRHF 368

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.143    0.469 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,289,646
Number of extensions: 259243
Number of successful extensions: 736
Number of sequences better than 10.0: 12
Number of HSP's gapped: 723
Number of HSP's successfully gapped: 12
Length of query: 192
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 96
Effective length of database: 13,272,781
Effective search space: 1274186976
Effective search space used: 1274186976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 58 (26.9 bits)