Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C10340g54153325970.0
AAL063C53551813171e-178
Kwal_47.1817857150713211e-178
Scas_688.116334548421e-105
Kwal_23.55866074538131e-101
AEL099W6674518121e-100
Kwal_56.230524854567885e-99
CAGL0J00495g6654537912e-97
KLLA0F21802g6104537821e-96
CAGL0M01078g6954507532e-91
AER234W6144627445e-91
YDR338C6954457226e-87
KLLA0F04279g4834507076e-87
KLLA0A06952g7164536941e-82
YHR032W5814636851e-82
Scas_373.16944486861e-81
YBL020W (RFT1)574218760.35
KLLA0C05236g60164760.40
KLLA0E10439g556243721.1
AFR015W552227711.4
Kwal_14.2114569329702.1
Sklu_2114.2114084692.4
YNL254C40163656.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C10340g
         (533 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C10340g 886390..888015 weakly similar to sp|Q05497 Saccharo...  1004   0.0  
AAL063C [124] [Homologous to ScYHR032W - SH] (236488..238095) [1...   511   e-178
Kwal_47.18178                                                         513   e-178
Scas_688.11                                                           328   e-105
Kwal_23.5586                                                          317   e-101
AEL099W [2407] [Homologous to ScYDR338C - SH] complement(439214....   317   e-100
Kwal_56.23052                                                         308   5e-99
CAGL0J00495g complement(40807..42804) similar to sp|P38767 Sacch...   309   2e-97
KLLA0F21802g 2029687..2031519 similar to sp|P38767 Saccharomyces...   305   1e-96
CAGL0M01078g 118018..120105 highly similar to sp|Q05497 Saccharo...   294   2e-91
AER234W [2736] [Homologous to ScYHR032W - SH] complement(1071224...   291   5e-91
YDR338C (YDR338C) [1167] chr4 complement(1147369..1149456) Membe...   282   6e-87
KLLA0F04279g 407511..408962 similar to ca|CA6037|CaERC4 Candida ...   276   6e-87
KLLA0A06952g complement(628173..630323) similar to sp|Q05497 Sac...   271   1e-82
YHR032W (YHR032W) [2319] chr8 (173336..175081) Member of the mul...   268   1e-82
Scas_373.1                                                            268   1e-81
YBL020W (RFT1) [175] chr2 (182366..184090) Protein required for ...    34   0.35 
KLLA0C05236g 469306..471111 similar to sgd|S0004290 Saccharomyce...    34   0.40 
KLLA0E10439g 920415..922085 gi|730506|sp|P40913|RFT1_KLULA Kluyv...    32   1.1  
AFR015W [3207] [Homologous to ScYBL020W (RFT1) - SH] complement(...    32   1.4  
Kwal_14.2114                                                           32   2.1  
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          31   2.4  
YNL254C (YNL254C) [4353] chr14 complement(168042..169247) Protei...    30   6.3  

>KLLA0C10340g 886390..888015 weakly similar to sp|Q05497
           Saccharomyces cerevisiae YDR338c, start by similarity
          Length = 541

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/533 (92%), Positives = 495/533 (92%)

Query: 1   MNQESEYLCDSMDRPRYDTINDNTRYESDGESASSGDAIDNRYRLMSPXXXXXXXXXXXX 60
           MNQESEYLCDSMDRPRYDTINDNTRYESDGESASSGDAIDNRYRLMSP            
Sbjct: 1   MNQESEYLCDSMDRPRYDTINDNTRYESDGESASSGDAIDNRYRLMSPDADRDDFIDEDF 60

Query: 61  XXXLTAPTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVM 120
              LTAPTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCK           VM
Sbjct: 61  IEDLTAPTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKSSDALASASLAVM 120

Query: 121 TYNITGLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSAS 180
           TYNITGLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSAS
Sbjct: 121 TYNITGLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSAS 180

Query: 181 WLGYVIAEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNI 240
           WLGYVIAEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNI
Sbjct: 181 WLGYVIAEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNI 240

Query: 241 ILVYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFC 300
           ILVYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFC
Sbjct: 241 ILVYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFC 300

Query: 301 SWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGC 360
           SWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGC
Sbjct: 301 SWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGC 360

Query: 361 VVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVEL 420
           VVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVEL
Sbjct: 361 VVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVEL 420

Query: 421 YRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQL 480
           YRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQL
Sbjct: 421 YRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQL 480

Query: 481 GLKGLWYGCGTGILLLAFALSYCVFNSNWENIVXXXXXXXXXXXXVDLESMAS 533
           GLKGLWYGCGTGILLLAFALSYCVFNSNWENIV            VDLESMAS
Sbjct: 481 GLKGLWYGCGTGILLLAFALSYCVFNSNWENIVEECHRREKEENEVDLESMAS 533

>AAL063C [124] [Homologous to ScYHR032W - SH] (236488..238095) [1608
           bp, 535 aa]
          Length = 535

 Score =  511 bits (1317), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 256/518 (49%), Positives = 349/518 (67%), Gaps = 16/518 (3%)

Query: 1   MNQESEYLCDSM---DRP--RYDTINDNTRYESDGESASSGDAIDNRYRLMSPXXXXXXX 55
           M  E E L  S+   D+    Y +IN    Y  D  S S    +++RY ++         
Sbjct: 1   MQTEEEALTASLAAFDKKLGTYRSINAGN-YADDAVSGSYSVVVNSRYAMLC-------- 51

Query: 56  XXXXXXXXLTAPTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXX 115
                   L    + R E   IL +S  I++ FLME+S+ I SLF+IGH+C         
Sbjct: 52  -GSDFEEPLDGAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASAS 110

Query: 116 XXXVMTYNITGLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISW 175
              VMTYNITGL+ VEG+AT+LDT C QAYG+++Y+KVGLY  R +AMIM G+    I W
Sbjct: 111 LA-VMTYNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIW 169

Query: 176 WFSASWLGYVIAEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLIT 235
           +FSASWL  +I E D++P+IQL+LRI+  G+P L+ F TGKR+LQ+Q  ++A TY L I 
Sbjct: 170 FFSASWLQLLIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIV 229

Query: 236 VPVNIILVYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHF 295
            P+ I+ V  FTR+ G+ GAP+GI  S W M ++L V+ +  R +TL CWYP   S  HF
Sbjct: 230 FPLTIVFVLGFTRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHF 289

Query: 296 KRLFCSWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIP 355
           KR+F  W+P+W+LAFPGL+M+EAE+LS E LT++STY GV AIA+Q+V++N+ SLIYQIP
Sbjct: 290 KRVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIP 349

Query: 356 FAMGCVVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDK 415
           FA+GCV+S RVA+YVG+  + NA++ I  SY +A+ VG++ C  +   +K LA LFT ++
Sbjct: 350 FAIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNE 409

Query: 416 EVVELYRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTF 475
           EVVEL   V+ ILAVNQ+YDAF TF AAILR QGRQ++G + N+IAYY ++LPL  WL F
Sbjct: 410 EVVELAHSVSYILAVNQIYDAFNTFGAAILRGQGRQRLGGIWNMIAYYIVSLPLGWWLAF 469

Query: 476 GKFQLGLKGLWYGCGTGILLLAFALSYCVFNSNWENIV 513
           G  +L L GLWYGCG GIL+LA A S+ ++NS+W+ I+
Sbjct: 470 GPLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLII 507

>Kwal_47.18178
          Length = 571

 Score =  513 bits (1321), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 252/507 (49%), Positives = 327/507 (64%), Gaps = 21/507 (4%)

Query: 26  YESDGESASSGDAIDNRYRLMSPX--------------------XXXXXXXXXXXXXXLT 65
           Y SDG S +S D   NR+RL+SP                                     
Sbjct: 36  YVSDGRSVASDDVRSNRFRLLSPDFSHDCNHCLEYLVSPDDDTDDLEQCARCGARCDPPA 95

Query: 66  APTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNIT 125
            P ++  E   ILS +  +T TF +EY+L + SLF+IGH               MTYNIT
Sbjct: 96  PPGATAREARAILSAALPLTTTFFLEYALLVSSLFIIGHF-GSADHLASASLAAMTYNIT 154

Query: 126 GLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYV 185
           GLA +EGMATSLDTFC+QAYGA++YAKVGLY +RC  MI   + P+ + WW +ASWL  +
Sbjct: 155 GLAVIEGMATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVL 214

Query: 186 IAEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVYS 245
           + +  +L ++QLFLR+ S GLPGL+ FETGKR++Q+QG ++AGT+ L + VPVN+ L  +
Sbjct: 215 VPQPALLQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVA 274

Query: 246 FTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFCSWKPM 305
             R IG+ GAPL +A +HW +A++L  YC +W   TL C YP+++S  H KR    W  M
Sbjct: 275 LVRQIGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPVWASRRHLKRALTHWGGM 334

Query: 306 WNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGCVVSTR 365
           W+LAFPGL+MIE+EYLSFEVLT+MST  GV+AIAAQSVV+N GSLIYQ+PFAMGCVVSTR
Sbjct: 335 WSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTR 394

Query: 366 VANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVELYRHVA 425
           V   VG   +  A+  +   Y +AA VG  NC L++ G   +A LFT+D  V+ L   + 
Sbjct: 395 VGGRVGRGELAGARRTVRAGYWVAAVVGTVNCVLLVVGRGAVARLFTQDAGVIALAERLV 454

Query: 426 PILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQLGLKGL 485
           PILAVNQ+ DA  TF AA+LR QGRQ+VG  LN++AYY + LP+SGWL FG  Q+GL GL
Sbjct: 455 PILAVNQVADAVATFGAAVLRGQGRQRVGGALNVVAYYAVGLPVSGWLAFGPLQMGLAGL 514

Query: 486 WYGCGTGILLLAFALSYCVFNSNWENI 512
           W GCG GI++LA A S  V  S+W  I
Sbjct: 515 WVGCGAGIVVLAVAASVWVRKSDWREI 541

>Scas_688.11
          Length = 633

 Score =  328 bits (842), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/454 (39%), Positives = 276/454 (60%), Gaps = 16/454 (3%)

Query: 68  TSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNITGL 127
           T+ + E   I  N+  +  TF+++ SL++ S+F + H+              MT NITGL
Sbjct: 175 TTYKRECKVIAVNALPLIFTFILQNSLSLASIFSVSHL--GTKELGGVTLGSMTANITGL 232

Query: 128 AFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWW-FSASWLGYVI 186
           A ++G+ T LDT CSQAYGAK Y  VG+   RCA + +    PV+  WW +S + L ++I
Sbjct: 233 AAIQGLCTCLDTLCSQAYGAKNYRLVGVLIQRCAVITILAFLPVMYIWWSWSETILSWMI 292

Query: 187 AEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNI----IL 242
            E+++      +LRI +FG+PG I FE GKRFLQ QG F A T  L I  P+N     IL
Sbjct: 293 PEKELCKLAANYLRITAFGVPGFIIFECGKRFLQCQGIFHASTIVLFICAPLNALMNYIL 352

Query: 243 VYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKET--LICWYPMFSSMFHFKRLFC 300
           V+  T  IGY GAPL +AI++W MAL L+VY    + E   + CW    + +    ++F 
Sbjct: 353 VWDKTIGIGYLGAPLSVAINYWLMALGLMVYAVTTQHEARPMKCW----NGIIKKTQVFK 408

Query: 301 SWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGC 360
           +W+ M+NLA PG++M+EAE+L FE+LTI +++LG   +AAQS+V+ + SL YQ+PF++  
Sbjct: 409 NWRKMFNLALPGIIMVEAEFLGFEILTIFASHLGTAPLAAQSIVATVASLAYQVPFSISV 468

Query: 361 VVSTRVANYVGTESVNNAKICINTSYVIAAFVGIA-NCCLILTGDKNLAYLFTKDKEVVE 419
             STRVAN++G  S+  + I   T  ++ +FV  + N  +I      +A +F+ + +VV 
Sbjct: 469 STSTRVANFIGA-SLYRSCIKTCTMALLLSFVCSSMNMVIIFECKDRIAKMFSNESDVVN 527

Query: 420 LYRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQ 479
           L     PILA  QL+DAF   +A  LR QGRQ++G  +N+ A+Y + +P++  LTF  F+
Sbjct: 528 LVISTLPILACMQLFDAFNASTAGCLRGQGRQKIGGYINLFAFYCVGIPMAYMLTF-NFK 586

Query: 480 LGLKGLWYGCGTGILLLAFALSYCVFNSNWENIV 513
           +G+ GLWYG    +++++    Y VF+ +W+ I+
Sbjct: 587 MGISGLWYGITCALIMMSICQGYAVFHCDWKQII 620

>Kwal_23.5586
          Length = 607

 Score =  317 bits (813), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/453 (39%), Positives = 269/453 (59%), Gaps = 14/453 (3%)

Query: 68  TSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNITGL 127
           T+ R E   ++ N+  +  TF+M+ SL++ S+F    +              MT NITG 
Sbjct: 149 TTYRRECQVLVKNAFPLVFTFVMQNSLSLASVFTTSRL--GIKELGGITLGSMTANITGF 206

Query: 128 AFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWF-SASWLGYVI 186
           A ++G+ T LDT CSQAYGAK Y  VG+   RCA + +    P++  WWF S + L  VI
Sbjct: 207 AAIQGLCTCLDTLCSQAYGAKNYQLVGILLQRCAIITIIFFTPILFMWWFWSEAILAAVI 266

Query: 187 AEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVYSF 246
            E+++      +L+I++ G+PG +FFE GKRFLQ QG F A T  LL   P N I+ Y  
Sbjct: 267 PERELCKLAANYLKIVALGVPGFVFFECGKRFLQCQGIFHASTIVLLFCAPFNAIMNYML 326

Query: 247 ---TRY-IGYAGAPLGIAISHWFMALMLLVYCKFWRKE--TLICWYPMFSSMFHFKRLFC 300
               R+ IGY GAP+ +A+++W MAL LL Y  F + +     CW    S      ++F 
Sbjct: 327 VLDKRFGIGYIGAPISVALNYWLMALGLLFYTIFTKHKINPRKCW----SGTIKPNQVFK 382

Query: 301 SWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGC 360
           +WK M++LA PG++M+EAE+L FE+LTI +++LG   + AQS+VS I SL YQ+PF++  
Sbjct: 383 NWKKMFSLALPGVVMVEAEFLGFEILTIFASHLGTSELGAQSIVSTIASLAYQVPFSISI 442

Query: 361 VVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVEL 420
             STRVAN++G     N       S +++  V   N   I      LA+ F+K+ EV+ L
Sbjct: 443 STSTRVANFIGASLYRNCIATCKVSLLLSTVVSFFNMSAIYFFRVPLAHAFSKESEVISL 502

Query: 421 YRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQL 480
             +V P+LA  QL+DAF   +A  LR QG+Q++G  +N++A+Y I +P+S +LTF K  L
Sbjct: 503 VVNVLPLLAFMQLFDAFNACTAGCLRGQGQQKIGGYINVLAFYCIGIPMSYFLTF-KCNL 561

Query: 481 GLKGLWYGCGTGILLLAFALSYCVFNSNWENIV 513
           G+ GLWYG  + ++ ++   SY VF+ N++ ++
Sbjct: 562 GMAGLWYGITSALIFMSIFQSYAVFSCNYKEVI 594

>AEL099W [2407] [Homologous to ScYDR338C - SH]
           complement(439214..441217) [2004 bp, 667 aa]
          Length = 667

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/451 (37%), Positives = 264/451 (58%), Gaps = 16/451 (3%)

Query: 67  PTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNITG 126
           P + ++E   +L  S  +  TFL+E    ++   V+GH+ K            MT NIT 
Sbjct: 204 PATVKSESLVLLCYSVPLIFTFLLEQMFPVVCALVVGHLGKNELAAVSLAS--MTTNIT- 260

Query: 127 LAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYVI 186
            A  EG++TSLDT C QAYGA+ Y  VGL+  RC    +    P    +WFS   L Y+I
Sbjct: 261 FAIFEGISTSLDTLCPQAYGARNYYGVGLHMQRCVLFSLAFFVPFAALFWFSEGILPYLI 320

Query: 187 AEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNII----L 242
            E+ ++P    FLR++  G PG I FE  KR+LQ+QG F AG Y LLI  P+NI+    L
Sbjct: 321 KEKSLVPLTSQFLRVMIVGGPGFILFENLKRYLQAQGIFDAGIYVLLICCPLNIVMSYLL 380

Query: 243 VYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFCSW 302
           V++    +G+ GAP+ +A++ W M L+LL+YC ++      CW  +       ++ F  W
Sbjct: 381 VWNPVIGLGFIGAPIAVALNFWCMFLLLLLYCIYFNGSK--CWGGLS------RKAFDHW 432

Query: 303 KPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGCVV 362
           K +  LA PG++M+EAE +S E+LT+ S+YLG + +AAQS VS   +++Y IP+A+G  V
Sbjct: 433 KDLSKLAVPGIIMLEAEDMSSEILTLFSSYLGTEYLAAQSAVSTTVAMLYMIPYAVGISV 492

Query: 363 STRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVELYR 422
           STR+A Y+G  + +NA++        +A VGI NC +++ G   +  +++ D EV+ L R
Sbjct: 493 STRIAQYIGARNPDNARLASRVGIASSAVVGIVNCTMLILGRDLIPRIYSSDAEVIRLMR 552

Query: 423 HVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQLGL 482
            + P+L + +++DA    + + LR QG Q VGS++N++ YY  A+PL G L    F + L
Sbjct: 553 EILPLLGLVEIFDALNAIAGSCLRGQGMQYVGSVVNLVVYYLFAIPL-GMLLSWTFDMKL 611

Query: 483 KGLWYGCGTGILLLAFALSYCVFNSNWENIV 513
            GLW G G+G+L++     Y V  ++W+ ++
Sbjct: 612 SGLWVGIGSGMLVIGLIEGYYVLFADWDMLI 642

>Kwal_56.23052
          Length = 485

 Score =  308 bits (788), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 165/456 (36%), Positives = 269/456 (58%), Gaps = 19/456 (4%)

Query: 66  APTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNIT 125
           A T ++ E   I  NS  + LTF+++ SL+ +++  +G +              +T+  T
Sbjct: 29  ARTDAKTEFKEISKNSGPLILTFVLQMSLSFVTVIFVGRLSAVDLGGVSLAN--VTFTAT 86

Query: 126 GLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYV 185
              F +G+AT LDT C QAYG K++  VGLY  R  A+      P+ + WW+S   LG V
Sbjct: 87  SGIF-QGLATCLDTLCPQAYGGKRFKLVGLYFQRGLAISFAFAIPIAVLWWYSNYVLGLV 145

Query: 186 IAEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVY- 244
           + +  ++     +LR++   +PG + FE GK++LQ+Q  +  G Y L +  P+N++L Y 
Sbjct: 146 VDDLRLVDIACRYLRVMIAAIPGYVMFECGKKYLQAQNDYTTGQYILFVCAPLNVVLNYL 205

Query: 245 -SFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKETLI----CWYPMFSSMFHFKRLF 299
             F   +G+ GAP+  ++ +  M   L  Y   W +   +    CW P    +  ++ +F
Sbjct: 206 FVFKFALGFIGAPIATSLIYTLMGFSLATY--IWHQNRNLSETNCWSP----LSEWRPIF 259

Query: 300 CSWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMG 359
            +W  M +LA PG++M+EAE+L+FE LT++S   G +++AAQSV+++I +L +++PF++G
Sbjct: 260 SNWMTMISLALPGIVMVEAEFLAFESLTVISAKFGTESLAAQSVIASIQTLTFEVPFSVG 319

Query: 360 CVVSTRVANYVGTESVNNAKICINTSYV-IAAFVGIANCCLILTGDKNLAYLFTKDKEVV 418
              S R+A Y+G   + + +I   T+ V +A  VGIAN   ++ G   +  +F+ D EV+
Sbjct: 320 VAASNRIAYYIGKGRLRDCQIATRTTLVSLACVVGIANFSTLILGRHAIPAIFSNDPEVI 379

Query: 419 ELYRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFG-K 477
            +   V PI+ +NQ+ D F+  SA +LRAQGRQ++G +LNIIAYY + LP++  + FG +
Sbjct: 380 RIASQVLPIIGLNQILDVFSVLSAGVLRAQGRQRIGGILNIIAYYVVGLPMA--VVFGFR 437

Query: 478 FQLGLKGLWYGCGTGILLLAFALSYCVFNSNWENIV 513
           + LGL+GLW G G GI LL+ +L YCV  SNW  I+
Sbjct: 438 WNLGLRGLWMGLGCGIALLSMSLVYCVSRSNWTKIL 473

>CAGL0J00495g complement(40807..42804) similar to sp|P38767
           Saccharomyces cerevisiae YHR032w ERC1 ethionine
           resistance protein, start by similarity
          Length = 665

 Score =  309 bits (791), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 174/453 (38%), Positives = 261/453 (57%), Gaps = 14/453 (3%)

Query: 68  TSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNITGL 127
           TS   E+  I  N+  +  TF+++ SL++ S+F + H+              MT NIT L
Sbjct: 207 TSFHREIQVISVNAFPLVFTFILQNSLSLASIFSVSHL--GTKELGGVTLGSMTANITCL 264

Query: 128 AFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWF-SASWLGYVI 186
           A ++G+ T LDT CSQAYGA+    VG+   RCA +      PV+  W+F S   L  +I
Sbjct: 265 AAIQGLCTCLDTLCSQAYGARNNHLVGVLVQRCAIITCLAFLPVMYIWFFWSDRILASMI 324

Query: 187 AEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIIL---- 242
            E+++      +L+I + G+PG IFFE GKRFLQ QG F A T  L+I  P+N IL    
Sbjct: 325 PEKELCSLAASYLKITAIGVPGFIFFECGKRFLQCQGIFHASTIVLVICAPLNAILNYIL 384

Query: 243 VYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRK--ETLICWYPMFSSMFHFKRLFC 300
           V+     IGY GAP  +AIS+W MAL LL Y    +     + CW    + +    +LF 
Sbjct: 385 VWDKNIGIGYLGAPTSVAISYWAMALGLLAYTVLTKHPANPMKCW----NGVIKPNQLFR 440

Query: 301 SWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGC 360
           +WK M+NLA PG++M+EAE+L FE+LT+ ++ +G   + AQS+V+ + SL YQ+PF++  
Sbjct: 441 NWKKMFNLALPGIIMVEAEFLGFEILTVFASRIGTAPLGAQSIVATVASLAYQVPFSISV 500

Query: 361 VVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVEL 420
             STRVAN++G     +  I    S +++      N  +I T  K +A LF+ +++VV L
Sbjct: 501 STSTRVANFIGASLYKSCIITCKVSLLLSFACSSLNMLIIFTFKKQIAGLFSSEEDVVSL 560

Query: 421 YRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQL 480
                PILA  QL+DAF   +A  LR QGRQ++G  +N+ A+Y I +P++  L F  F  
Sbjct: 561 VVSTLPILAFMQLFDAFNASTAGCLRGQGRQKIGGYINLFAFYCIGIPMAYCLAF-VFNT 619

Query: 481 GLKGLWYGCGTGILLLAFALSYCVFNSNWENIV 513
           G+ GLWYG    +++++    Y VF+ +W+ I+
Sbjct: 620 GVGGLWYGITCALVMMSICQGYAVFHCDWKQII 652

>KLLA0F21802g 2029687..2031519 similar to sp|P38767 Saccharomyces
           cerevisiae YHR032w ERC1 ethionine resistance protein,
           start by similarity
          Length = 610

 Score =  305 bits (782), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 166/453 (36%), Positives = 264/453 (58%), Gaps = 14/453 (3%)

Query: 68  TSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNITGL 127
           T+ + E   I SN++ + LTF+++ SL++ S+F + H+              MT +ITG 
Sbjct: 152 TTFKREAIVITSNASPLVLTFILQNSLSLASIFSVSHLGSNELGAVTLGS--MTASITGF 209

Query: 128 AFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWW-FSASWLGYVI 186
           A ++G+ T LDT C+QAYG   Y  VG+   RCA + +    PV+ +WW +S   L   I
Sbjct: 210 AAIQGLCTCLDTLCAQAYGGNHYHLVGVLFQRCAIITIILSLPVLFTWWQWSEQILALFI 269

Query: 187 AEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNI----IL 242
            E+++      +L+I+S G+P  I FE GKRFLQ QG F A +  LL+  P+N     +L
Sbjct: 270 PERELCALAAKYLQIVSLGIPAFILFECGKRFLQCQGIFHASSIVLLVCAPLNALMNYVL 329

Query: 243 VYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKET--LICWYPMFSSMFHFKRLFC 300
           V+     IGY GAP+ + +++W MAL L  Y  + + E   + CW    +      ++  
Sbjct: 330 VWDKNIGIGYLGAPISVVLNYWLMALGLFAYTLYTKNEKNPMKCW----NGFIKPHQILK 385

Query: 301 SWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGC 360
           + + M+NLA PG++M+EAE+L FE+LTI +++LG   +AAQS++S I SL YQ+PF++  
Sbjct: 386 NSRKMFNLALPGIIMVEAEFLGFEILTIFASHLGTHELAAQSIISTIASLAYQVPFSISI 445

Query: 361 VVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVEL 420
             STRVAN++G     +  I    S +++  +   N  +I      +A LF+ + +VV L
Sbjct: 446 STSTRVANFIGASLYRSCVITCKVSLLLSFIISSLNMAMIYKARYLIARLFSSEPDVVRL 505

Query: 421 YRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQL 480
                PILA  Q++DAF   +A  LR QG+Q++G  +N+ A+Y I +P+S  LTF  +  
Sbjct: 506 VSSSLPILAFMQIFDAFNASTAGCLRGQGQQKIGGYINVFAFYCIGIPVSYLLTF-HYGF 564

Query: 481 GLKGLWYGCGTGILLLAFALSYCVFNSNWENIV 513
           G+ GLW+G  +G++ ++   SY VF+ NW +I+
Sbjct: 565 GVSGLWWGITSGLVFMSIFQSYAVFHCNWNDII 597

>CAGL0M01078g 118018..120105 highly similar to sp|Q05497
           Saccharomyces cerevisiae YDR338c, start by similarity
          Length = 695

 Score =  294 bits (753), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 168/450 (37%), Positives = 256/450 (56%), Gaps = 22/450 (4%)

Query: 71  RNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNITGLAFV 130
           R E   + S S  +  TFL+E    ++    +GH+ K            MT NIT LA  
Sbjct: 224 REEAKVLSSFSFPLIFTFLLEQIFPMVCSLTVGHLGKNQLAAVSLAS--MTSNIT-LAVF 280

Query: 131 EGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYVIAEQD 190
           EG+ATSLDT C QAYGA +Y  VG++  RC         P  + W+FS   L  V+ E++
Sbjct: 281 EGIATSLDTLCPQAYGAGRYYSVGIHFQRCVLFSFIIFLPFALFWFFSEPILFLVVPEKE 340

Query: 191 ILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVYSF--TR 248
           ++     FLR++ FG P  I FE  KRFLQ+QG F AG Y L I  P+NI + Y+    +
Sbjct: 341 LIALTSQFLRVLIFGAPAYILFENLKRFLQAQGIFDAGIYVLTICAPLNIFVSYTLVWNK 400

Query: 249 YIG--YAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFCSWKPMW 306
           YIG  + G+ + + I+ W M ++LL+Y  +   +   CW   FS     K+ F  WK + 
Sbjct: 401 YIGIGFIGSAVAVVINFWLMFILLLLYTIYIDGKK--CW-GGFS-----KKAFTHWKDLG 452

Query: 307 NLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGCVVSTRV 366
           +LAF G++M+EAE LS+E+LT+ S Y G   +AAQS VS + +L+Y +PFA+G   STR+
Sbjct: 453 HLAFSGIIMLEAEELSYEILTLFSAYFGTSYLAAQSAVSTMAALLYMVPFAIGISASTRI 512

Query: 367 ANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVELYRHVAP 426
           AN++G + V+ A        V +   G+ NCC++  G   +A++F++D EV++L   +  
Sbjct: 513 ANFIGAKRVDLAHNASEVGLVFSFGAGLTNCCVLFFGRNIIAHVFSRDDEVIDLMTGLLR 572

Query: 427 ILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLS---GWLTFGKFQLGLK 483
           ++AV Q++D+    + + LR QG Q +GS++N++ YY   +PL+   GW+    F + L 
Sbjct: 573 LVAVVQIFDSLNAVAGSCLRGQGMQSLGSIVNLLGYYLFGIPLALILGWV----FNMKLY 628

Query: 484 GLWYGCGTGILLLAFALSYCVFNSNWENIV 513
           GLW G G  +LL+    +Y V   NW+ I+
Sbjct: 629 GLWIGIGCAMLLIGLIEAYNVLYPNWDYIL 658

>AER234W [2736] [Homologous to ScYHR032W - SH]
           complement(1071224..1073068) [1845 bp, 614 aa]
          Length = 614

 Score =  291 bits (744), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 176/462 (38%), Positives = 268/462 (58%), Gaps = 24/462 (5%)

Query: 65  TAPTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNI 124
           T  TS + E + +  N+  +  TF+++ SL++ S+F + H+              MT NI
Sbjct: 152 TITTSYKRESTVLTKNALPLVATFILQNSLSLASVFSVSHL--GTKELGGITLGSMTANI 209

Query: 125 TGLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISW-WFSASWLG 183
           TG A ++G+ T LDT CSQAYGA+ Y  VGL   RC  + +    PV+  W  +S   LG
Sbjct: 210 TGFAAIQGLCTCLDTLCSQAYGARNYTLVGLLLQRCCIISLLVFAPVVWLWVCYSEQVLG 269

Query: 184 YVIAEQDILPEIQLF----LRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVP-- 237
           Y++++    PE+ LF    LRI++ GLP  I FE GKR+LQ Q  + A T  LL   P  
Sbjct: 270 YLVSD----PELCLFAAKYLRIVAAGLPAFILFECGKRYLQCQDIYHASTIVLLFCAPAN 325

Query: 238 --VNIILVYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKE--TLICWYPMFSSMF 293
             +N +LV++    IGY GAP+ + +++W M L LL+Y  F + E     CW    +   
Sbjct: 326 AFLNYLLVWNSKVGIGYLGAPVSVVLNYWLMVLGLLLYTIFTKSEIQPRKCW----TGWI 381

Query: 294 HFKRLFCSWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQ 353
              ++F ++  M  LA PG++M+EAE+L FE+LTI ++++ V A+AAQS+++ I SL YQ
Sbjct: 382 KPHQIFKNYDKMLGLALPGIIMVEAEFLGFEILTIFASHISVNALAAQSIIATIASLAYQ 441

Query: 354 IPFAMGCVVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAY-LFT 412
           IPF++    STRVAN++G     +  I    S +++  V + +   I     NLA+ LF 
Sbjct: 442 IPFSISISTSTRVANFIGASLYRSCIITCKVSLLLSFGVSLTSMLAIFVFRSNLAHILFL 501

Query: 413 KDKEVVELYRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLL-NIIAYYFIALPLSG 471
            + EV+ L     PILAV Q++D+F   +A  LR QG+Q+   LL N+ A+Y I +P+S 
Sbjct: 502 NEAEVIMLIETTLPILAVMQIFDSFNASTAGCLRGQGQQKDWWLLSNVFAFYCIGIPMSY 561

Query: 472 WLTFGKFQLGLKGLWYGCGTGILLLAFALSYCVFNSNWENIV 513
           +L+F    LG+KGLWYG    +++++   SY VFN +WE +V
Sbjct: 562 FLSF-HCDLGVKGLWYGITCALIVMSVCQSYAVFNCSWEELV 602

>YDR338C (YDR338C) [1167] chr4 complement(1147369..1149456) Member
           of the multiple antimicrobiotic resistance (MAR) family
           of membrane transporters [2088 bp, 695 aa]
          Length = 695

 Score =  282 bits (722), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 161/445 (36%), Positives = 251/445 (56%), Gaps = 12/445 (2%)

Query: 71  RNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNITGLAFV 130
           ++E   + S S  +  TFL+E    ++    +GH+ K            MT NIT LA  
Sbjct: 226 KSEARVLASYSFPLIFTFLLEQIFPMVCSLTVGHLGKNELAAVSLAS--MTSNIT-LAIF 282

Query: 131 EGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYVIAEQD 190
           EG+ATSLDT C QAYG+ ++  VG++  RC A  +    P  + WW+S   L Y+I E++
Sbjct: 283 EGIATSLDTLCPQAYGSGRFYSVGVHLQRCIAFSLVIYIPFAVMWWYSEPLLSYIIPEKE 342

Query: 191 ILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVYSF--TR 248
           ++     FLR++  G P  IFFE  KRFLQ+QG F AG Y L I  P+N+++ Y+    +
Sbjct: 343 LINLTSRFLRVLILGAPAYIFFENLKRFLQAQGIFDAGIYVLTICAPLNVLVSYTLVWNK 402

Query: 249 YIGYAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFCSWKPMWNL 308
           YIG       IA+   F  +  L+       +   CW   FS     ++ F  W  + +L
Sbjct: 403 YIGVGFIGAAIAVVLNFWLMFFLLLFYALYIDGRKCW-GGFS-----RKAFTHWNDLGHL 456

Query: 309 AFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGCVVSTRVAN 368
           AF G++M+EAE LS+E+LT+ S Y GV  +AAQS VS + +L+Y IPFA+G   STR+AN
Sbjct: 457 AFSGIIMLEAEELSYELLTLFSAYYGVSYLAAQSAVSTMAALLYMIPFAIGISTSTRIAN 516

Query: 369 YVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVELYRHVAPIL 428
           ++G +  + A I        +   G  NCC+++ G   +A +++KD EV++L   V P++
Sbjct: 517 FIGAKRTDFAHISSQVGLSFSFIAGFINCCILVFGRNLIANIYSKDPEVIKLIAQVLPLV 576

Query: 429 AVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQLGLKGLWYG 488
            + Q +D+    + + LR QG Q +GS++N++AYY   +PL+  L++  F + L GLW G
Sbjct: 577 GIVQNFDSLNAVAGSCLRGQGMQSLGSIVNLMAYYLFGIPLALILSW-FFDMKLYGLWIG 635

Query: 489 CGTGILLLAFALSYCVFNSNWENIV 513
            G+ +LL+    +Y V   +W+ I+
Sbjct: 636 IGSAMLLIGLVEAYYVLFPDWDKIM 660

>KLLA0F04279g 407511..408962 similar to ca|CA6037|CaERC4 Candida
           albicans ethionine resistance protein (by homology),
           hypothetical start
          Length = 483

 Score =  276 bits (707), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 164/450 (36%), Positives = 252/450 (56%), Gaps = 11/450 (2%)

Query: 68  TSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNITGL 127
           TS   E  Y+   S  + +TFL++ SL+  +L   G V              +T+ +T  
Sbjct: 31  TSLEYEFWYMTKTSIPLIITFLLQCSLSSSALVFAGRVGTLEVGGISIGN--VTFAVTSA 88

Query: 128 AFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYVIA 187
            F+ G+AT LDT C QAYGA KY  VGLY  R  A+      PVI  W+ S   L +++ 
Sbjct: 89  IFI-GIATCLDTVCPQAYGAGKYNMVGLYFQRGVAISFLFAVPVIAFWYNSEYVLSFLVE 147

Query: 188 EQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVYSFT 247
           + D++    ++LRI+   LPG I FE GK++LQ+QG F  G   L +  P+NI+L Y F 
Sbjct: 148 DADVVHIAAVYLRIMILSLPGYIIFECGKKYLQAQGDFVTGQNILFVCAPLNILLNYLFV 207

Query: 248 -RY-IGYAGAPLGIAISHWFMALMLLVY-CKFWRKETLICWYPMFSSMFHFKRLFCSWKP 304
            +Y  GY G+P+ + +S+  M L ++ Y C+        CW+P+     +F  +F +W P
Sbjct: 208 LKYKFGYIGSPISMVLSYTLMGLTIVAYICRQIYFGNSSCWHPITG---NFSAIFKNWGP 264

Query: 305 MWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGCVVST 364
           +  LA PGL+MIEAE+ +FE++T++S   G + +AAQS+V+ + +  +Q+PF+     S 
Sbjct: 265 LIALALPGLIMIEAEFFAFEIITVLSAKFGTEVLAAQSIVATLQTFFFQLPFSCSVAASN 324

Query: 365 RVANYVGTESVNNAKICIN-TSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVELYRH 423
           R+A ++G+    N K     T + +    GI N  ++  G   L  LF  D  +V     
Sbjct: 325 RIAYHIGSGITENCKTATKATMFGVGPAAGIINFTVLYFGRYKLCSLFNADPVLVNKAAG 384

Query: 424 VAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQLGLK 483
           +  ++A+NQ+YD F   +A +LRAQGRQ++G  LNI+AYY + L +   L F KF++ + 
Sbjct: 385 LLCVVALNQIYDCFNVMAAGVLRAQGRQRIGGYLNIMAYYLVGLEVGILLAF-KFKMEVL 443

Query: 484 GLWYGCGTGILLLAFALSYCVFNSNWENIV 513
           G W G G G+L LA   +Y V+ SNW NI+
Sbjct: 444 GFWIGIGVGVLFLAIGENYFVYISNWRNII 473

>KLLA0A06952g complement(628173..630323) similar to sp|Q05497
           Saccharomyces cerevisiae YDR338c, start by similarity
          Length = 716

 Score =  271 bits (694), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 156/453 (34%), Positives = 252/453 (55%), Gaps = 17/453 (3%)

Query: 66  APTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNIT 125
           A  ++ +E+  + S S  +  TFL+E    ++    +GH+ +            MT NIT
Sbjct: 232 AKVTANSELKVLASYSIPLIFTFLLEQMFPVVCSLTVGHLGRTELAAVSLAS--MTTNIT 289

Query: 126 GLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYV 185
             A  EG+ATSLDT C  AYG+  Y  VG++  RC     T   P    WW+S + L  V
Sbjct: 290 -YAIFEGIATSLDTLCPLAYGSGNYYSVGVHMQRCIMFSFTVFIPFGFIWWWSETLLTLV 348

Query: 186 IA-EQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVY 244
           +  E +++     FLR+   G P  I FE+ KRFLQ+QG F AG Y L+I  P N+ + Y
Sbjct: 349 MPHEPELIHMTAKFLRVSILGAPAYIIFESLKRFLQAQGIFDAGIYVLMICAPWNMFVSY 408

Query: 245 SFTRY----IGYAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFC 300
           +        +G+ GAP+ + ++ W M  +L +Y  +   +   CW       F+ K L  
Sbjct: 409 TLVWNERIGMGFIGAPIAVVLNFWTMVTLLSLYAIY--VDGYKCW-----GGFNSKSL-K 460

Query: 301 SWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGC 360
            WK +  LA PG++M+EAE LS+E+LT+ S+Y G   +AAQS VS   +L+Y IPF++G 
Sbjct: 461 HWKALSELAVPGIVMLEAEDLSYEILTLFSSYFGTPYLAAQSAVSTTAALLYMIPFSVGI 520

Query: 361 VVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVEL 420
             STR+ N++G    N AK+        + FVG+ NC +I    +++A ++TKD+EV++L
Sbjct: 521 SSSTRIGNFIGCRRPNCAKLSAELGIGSSLFVGLLNCLIINVDKRSIANIYTKDEEVIQL 580

Query: 421 YRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQL 480
              + P++ + +++D+    S + LR  G Q +GS++N++ Y+ +A+PL  +L +    +
Sbjct: 581 MCQLLPLVGIVEIFDSLNAISGSCLRGLGLQYIGSIVNLVVYHLVAIPLGIFLAW-YMDM 639

Query: 481 GLKGLWYGCGTGILLLAFALSYCVFNSNWENIV 513
            L GLW G G G+L++    SY V  ++W +++
Sbjct: 640 KLNGLWIGIGVGMLIIGLVQSYYVIFADWNDVM 672

>YHR032W (YHR032W) [2319] chr8 (173336..175081) Member of the
           multiple antimicrobiotic resistance (MAR) family of
           membrane transporters [1746 bp, 581 aa]
          Length = 581

 Score =  268 bits (685), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 168/463 (36%), Positives = 244/463 (52%), Gaps = 30/463 (6%)

Query: 10  DSMDRPR-----YDTINDNTRYESDG------ESASSGDAI--DNRYRLMSPXXXXXXXX 56
           DS DR R      D + DN      G      ES   G AI  D   R   P        
Sbjct: 92  DSHDRKRLLDEERDLLIDNKLLSQHGNGGGDIESHGHGQAIGPDEEER---PAEIANTWE 148

Query: 57  XXXXXXXLTAPTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXX 116
                    + T  R E   I  N+  +  TF+++ SL++ S+F + H+           
Sbjct: 149 SAIESGQKISTTFKR-ETQVITMNALPLIFTFILQNSLSLASIFSVSHL--GTKELGGVT 205

Query: 117 XXVMTYNITGLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWW 176
              MT NITGLA ++G+ T LDT C+QAYGAK Y  VG+   RCA + +    P++  W+
Sbjct: 206 LGSMTANITGLAAIQGLCTCLDTLCAQAYGAKNYHLVGVLVQRCAVITILAFLPMMYVWF 265

Query: 177 -FSASWLGYVIAEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLIT 235
            +S   L  +I E+++      +LR+ +FG+PG I FE GKRFLQ QG F A T  L + 
Sbjct: 266 VWSEKILALMIPERELCALAANYLRVTAFGVPGFILFECGKRFLQCQGIFHASTIVLFVC 325

Query: 236 VPVNII----LVYSFTRYIGYAGAPLGIAISHWFMALMLLVYC--KFWRKETLICWYPMF 289
            P+N +    LV++    IGY GAPL + I++W M L LL+Y      ++  L CW  + 
Sbjct: 326 APLNALMNYLLVWNDKIGIGYLGAPLSVVINYWLMTLGLLIYAMTTKHKERPLKCWNGII 385

Query: 290 SSMFHFKRLFCSWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGS 349
                FK    +W+ M NLA PG++M+EAE+L FEVLTI +++LG  A+ AQS+V+ I S
Sbjct: 386 PKEQAFK----NWRKMINLAIPGVVMVEAEFLGFEVLTIFASHLGTDALGAQSIVATIAS 441

Query: 350 LIYQIPFAMGCVVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAY 409
           L YQ+PF++    STRVAN++G    ++  I    S +++      N  +I    + +A 
Sbjct: 442 LAYQVPFSISVSTSTRVANFIGASLYDSCMITCRVSLLLSFVCSSMNMFVICRYKEQIAS 501

Query: 410 LFTKDKEVVELYRHVAPILAVNQLYDAFTTFSAAILRAQGRQQ 452
           LF+ +  VV++     P+LA  QL+DAF   +A  LR QGRQ+
Sbjct: 502 LFSTESAVVKMVVDTLPLLAFMQLFDAFNASTAGCLRGQGRQK 544

>Scas_373.1
          Length = 694

 Score =  268 bits (686), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 162/448 (36%), Positives = 252/448 (56%), Gaps = 18/448 (4%)

Query: 71  RNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKXXXXXXXXXXXVMTYNITGLAFV 130
           ++E   + S S  +  TFL+E    ++    +GH+ K            MT NIT LA  
Sbjct: 220 KSEAKVLASYSFPLIFTFLLEQIFPMVCSLTVGHLGKNQLAAVSLAS--MTSNIT-LAVF 276

Query: 131 EGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYVIAEQD 190
           EG+ATSLDT C QAYG+ +Y  VG++  RC A  +    P    W++S   L  V+ E++
Sbjct: 277 EGIATSLDTLCPQAYGSGRYFSVGIHLQRCIAFSLVIFIPFAFFWYYSEPILYLVVPEKE 336

Query: 191 ILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVYSF--TR 248
           ++     FL+++  G P  IFFE  KR+LQ+QG F AG Y L I  P NI++ Y+    +
Sbjct: 337 LIHLTSQFLKVLILGAPAYIFFENLKRYLQAQGIFDAGIYVLAICAPTNILVSYTLVWNK 396

Query: 249 YIG--YAGAPLGIAISHWFMALMLLVYC-KFWRKETLICWYPMFSSMFHFKRLFCSWKPM 305
           YIG  + G+ + + ++ W M  +LL Y  KF   E   CW   FS     ++    WK +
Sbjct: 397 YIGIGFIGSAVAVVLNFWLMFFLLLFYTIKF---EGGKCW-GGFS-----RKALTHWKDL 447

Query: 306 WNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGCVVSTR 365
            +LA  G++M+EAE LS+E+LT+ S Y G   +AAQS VS + +L+Y +PFA+G   STR
Sbjct: 448 GHLALSGIIMLEAEELSYELLTLFSAYFGASYLAAQSAVSTMAALLYMVPFAIGISTSTR 507

Query: 366 VANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVELYRHVA 425
           +AN++G    + A I        +   G+ NC L++ G   +A +F+KD+EV  L  ++ 
Sbjct: 508 IANFIGARRTDCAHISSKVGLTFSFGAGLINCSLLILGRHFIANIFSKDEEVKTLISNLL 567

Query: 426 PILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQLGLKGL 485
           P++ + Q +D+    + + LR QG Q +GS++N+++YY   +PL+  L++  F + L GL
Sbjct: 568 PLVGIVQNFDSLNAVAGSCLRGQGMQSLGSIVNLLSYYLFGIPLALILSW-HFDMKLNGL 626

Query: 486 WYGCGTGILLLAFALSYCVFNSNWENIV 513
           W G G+ +LL+    SY V   NW  I+
Sbjct: 627 WVGIGSAMLLIGLIESYYVLFPNWNAIM 654

>YBL020W (RFT1) [175] chr2 (182366..184090) Protein required for
           translocation of lipid-linked intermediate Man5GlcNAc2
           from the cytoplasmic face to the luminal face of the ER
           during synthesis of the Glc3Man9GlcNAc2 substrate for
           N-linked glycosylation [1725 bp, 574 aa]
          Length = 574

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 98/218 (44%), Gaps = 37/218 (16%)

Query: 286 YPMFSSMF-------HFKRLFCSWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAI 338
           YP  +S F       HFK+++      + L F  LL  E + L      I+++   V+  
Sbjct: 273 YPKSTSYFFQNDILQHFKKVY------FQLCFKHLLT-EGDKL------IINSLCTVEEQ 319

Query: 339 AAQSVVSNIGSLIYQIPFA-MGCVVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANC 397
              +++SN GSL+ ++ FA +   +   +A  + + +  N K+ I     +  F    + 
Sbjct: 320 GIYALLSNYGSLLTRLLFAPIEESLRLFLARLLSSHNPKNLKLSIEVLVNLTRFYIYLSL 379

Query: 398 CLILTGDKNLAYLF----------TKDKEVVELYRHVAPILAVNQLYDAFTTFSAAILRA 447
            +I+ G  N ++L           T   + + +Y    P L++N +++AF  F +    A
Sbjct: 380 MIIVFGPANSSFLLQFLIGSKWSTTSVLDTIRVYCFYIPFLSLNGIFEAF--FQSV---A 434

Query: 448 QGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQLGLKGL 485
            G Q +     ++A+  I L L+ WL   K +L ++GL
Sbjct: 435 TGDQILKHSYFMMAFSGIFL-LNSWLLIEKLKLSIEGL 471

>KLLA0C05236g 469306..471111 similar to sgd|S0004290 Saccharomyces
           cerevisiae YLR299w ECM38 gamma-glutamyltransferase,
           involved in glutathione synthesis, hypothetical start
          Length = 601

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 32/64 (50%)

Query: 381 CINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVELYRHVAPILAVNQLYDAFTTF 440
            ++ +  +A  +G+ N      G    A + TK++ V   +R  AP+L+ N +YD    F
Sbjct: 76  AVDAAVTVALCIGMINFFNSGIGGGGFAVVSTKEESVTYDFRETAPLLSNNTMYDGLGDF 135

Query: 441 SAAI 444
           ++ +
Sbjct: 136 ASVV 139

>KLLA0E10439g 920415..922085 gi|730506|sp|P40913|RFT1_KLULA
           Kluyveromyces lactis NUCLEAR DIVISION RFT1 PROTEIN,
           start by similarity
          Length = 556

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 102/243 (41%), Gaps = 48/243 (19%)

Query: 278 RKETLICWYPMFSSMFHFKRLFCSWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKA 337
           R+E+   +Y    ++ HFK+++      + L F  LL  E + L      I+++   V+ 
Sbjct: 255 RQES---YYFQNDTVQHFKKVY------FQLCFKHLLT-EGDKL------IINSLCTVEE 298

Query: 338 IAAQSVVSNIGSLIYQIPFA-MGCVVSTRVANYVGTESVNNAKICINTSYVIAAFVGIAN 396
               S++SN GSLI ++ FA +   +   +A  +   S  N  + +     +  F    +
Sbjct: 299 QGIYSLLSNYGSLITRLLFAPIEEALRLFLARLLSVSSKKNLWLSMKVLIDLTKFYLYLS 358

Query: 397 CCLILTGDKNLAYLF----------TKDKEVVELYRHVAPILAVNQLYDAFTTFSAAILR 446
             +I+ G  N +YL           T   E +  Y    P L++N +++AF         
Sbjct: 359 LFIIIFGPINSSYLLKFVIGSKWSSTSFLETIRTYCFYIPFLSLNGIFEAFF-------- 410

Query: 447 AQGRQQVGSLLNIIAYYFIALPLSG------WLTFGKFQLGLKGLWYGCGTGILLLAFAL 500
               Q V S   I  + ++ +  SG      WL    F L L+GL     + IL +A  +
Sbjct: 411 ----QSVASGDQIFKHSYVMMLFSGIFLFNCWLFIEYFDLSLEGL---IVSNILNMALRI 463

Query: 501 SYC 503
           +YC
Sbjct: 464 AYC 466

>AFR015W [3207] [Homologous to ScYBL020W (RFT1) - SH]
           complement(462128..463786) [1659 bp, 552 aa]
          Length = 552

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 98/227 (43%), Gaps = 45/227 (19%)

Query: 294 HFKRLFCSWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQ 353
           HFK+++      + L F  LL  E + L      I+++   V+     S++SN GSLI +
Sbjct: 263 HFKKVY------FQLCFKHLLT-EGDKL------IINSLCTVEEQGIYSLLSNYGSLITR 309

Query: 354 IPFA-MGCVVSTRVANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLF- 411
           + FA +   +   +   +  ++  N  IC+     +  F       +++ G  N ++L  
Sbjct: 310 MVFAPIEESLLLFLTRLLSDKTQQNLHICMRVLVNLVKFYLYLALVIVIFGPTNSSFLLK 369

Query: 412 ---------TKDKEVVELYRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAY 462
                    T   E + +Y    P L++N + +AF  F++    A G +       I+ +
Sbjct: 370 FLIGSKWSSTSVLETIRVYCFYLPFLSMNGILEAF--FASV---ASGDE-------ILRH 417

Query: 463 YFIALPLSG------WLTFGKFQLGLKGLWYGCGTGILLLAFALSYC 503
            ++ + LSG      W+    F L L+GL +   + I+ +   + YC
Sbjct: 418 SYLMMLLSGVFLLNCWVFLAHFNLSLEGLIF---SNIINMTLRIIYC 461

>Kwal_14.2114
          Length = 569

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 69/329 (20%), Positives = 133/329 (40%), Gaps = 52/329 (15%)

Query: 211 FFETGKRFLQSQGHFQAGTYSLLITVPVNIILVYSFTRYIGYAGAPLGIAISHWFMALML 270
           FF   +  L  +   Q  + S++ +   N  +VY +   +  +GA L  A     +A++ 
Sbjct: 164 FFVVNQFMLNYKVRSQLDSVSVVASCLANFTIVYVYENNVNGSGASLHDATKQEGIAIVA 223

Query: 271 LVYCKFWRKETLICWY-----PMFSSMFHFKRLFCS------WKPMWNLAFPGLLMIEAE 319
               K     TL+C Y        +    F  L C        +P + L    L   +  
Sbjct: 224 FATSKLVYSITLLCGYYYDYLTRLAPTKKFTILPCKVQVSVGTQPFY-LQADILQYFKKV 282

Query: 320 YLSF---EVLT-----IMSTYLGVKAIAAQSVVSNIGSLIYQIPFA-MGCVVSTRVANYV 370
           YL      +LT     I+++   V+     S++SN GSL+ ++ FA +   +   +A  +
Sbjct: 283 YLQLCFKHLLTEGDKLIINSMCSVEEQGIYSLLSNYGSLLTRLLFAPIEESLRLFLARLL 342

Query: 371 GTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLF----------TKDKEVVEL 420
             +S  N ++ +     +  F    +  +++ G  N  +L           T   + + +
Sbjct: 343 SVKSSKNIQLSMEVLINLTKFYLYLSVMILVFGPVNSPFLLKFLIGSKWSSTSVLDTIRV 402

Query: 421 YRHVAPILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNII--AYYFIALP----LSGWLT 474
           Y    P L+VN +++AF             Q V S  +I+  +Y+ IA      LS W+ 
Sbjct: 403 YCLYLPFLSVNGIFEAFF------------QSVASGEDILRHSYFMIAFSGTFLLSCWIF 450

Query: 475 FGKFQLGLKGLWYGCGTGILLLAFALSYC 503
              +++ L+GL +   + I+ +   +S+C
Sbjct: 451 ISHYKMSLEGLIF---SNIINMILRISFC 476

>Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement
          Length = 1140

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 8/84 (9%)

Query: 412 TKDKEVVELYRHVAPI---LAVN-----QLYDAFTTFSAAILRAQGRQQVGSLLNIIAYY 463
           TK+  VV  +RH+ P    LA+      +  +A   ++AA+    G +++     ++A  
Sbjct: 766 TKNVVVVHDFRHLIPDKRELAIEYRLMGETPEALAKYNAAVAEKYGYEEISHCWKMLANL 825

Query: 464 FIALPLSGWLTFGKFQLGLKGLWY 487
            IA     +  FG  Q  L G W+
Sbjct: 826 LIARDEKNFYNFGWDQHPLGGRWF 849

>YNL254C (YNL254C) [4353] chr14 complement(168042..169247) Protein
           of unknown function, has weak similarity to
           uncharacterized C. albicans Orf6.1109p [1206 bp, 401 aa]
          Length = 401

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%)

Query: 127 LAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYVI 186
           L+  E    +L+ F +  YG K+  +VG    +     +T   P  + WW    +  YV+
Sbjct: 241 LSVDEFRKLNLNKFTAGFYGLKRQLRVGEEIAKRYKRALTHNQPATLKWWGITDFCNYVL 300

Query: 187 AEQ 189
           A +
Sbjct: 301 APE 303

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.139    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,691,216
Number of extensions: 559626
Number of successful extensions: 1786
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1744
Number of HSP's successfully gapped: 27
Length of query: 533
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 427
Effective length of database: 12,926,601
Effective search space: 5519658627
Effective search space used: 5519658627
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)