Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C10318g33332816280.0
Sklu_1023.23523478831e-118
Kwal_47.181843373367011e-90
CAGL0D03916g3443296853e-88
AAL062W3273276671e-85
Scas_690.373323366113e-77
YHR034C3443465168e-63
Scas_695.352754691.1
CAGL0I07865g97463672.4
Scas_671.22*48761645.2
KLLA0C14157g109063645.5
KLLA0D10824g50689636.4
Scas_632.1362255637.2
Kwal_27.1015121777618.1
Scas_637.1557555628.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C10318g
         (328 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C10318g complement(885031..886032) similar to sp|P38768 Sac...   631   0.0  
Sklu_1023.2 YHR034C, Contig c1023 1165-2223                           344   e-118
Kwal_47.18184                                                         274   1e-90
CAGL0D03916g complement(391089..392123) similar to sp|P38768 Sac...   268   3e-88
AAL062W [125] [Homologous to ScYHR034C - SH] complement(238295.....   261   1e-85
Scas_690.37                                                           239   3e-77
YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein...   203   8e-63
Scas_695.3                                                             31   1.1  
CAGL0I07865g 758457..761381 similar to tr|Q12252 Saccharomyces c...    30   2.4  
Scas_671.22*                                                           29   5.2  
KLLA0C14157g complement(1223130..1226402) similar to sp|P32337 S...    29   5.5  
KLLA0D10824g complement(922978..924498) similar to sp|P40016 Sac...    29   6.4  
Scas_632.13                                                            29   7.2  
Kwal_27.10151                                                          28   8.1  
Scas_637.15                                                            28   8.8  

>KLLA0C10318g complement(885031..886032) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c singleton, start by
           similarity
          Length = 333

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/328 (97%), Positives = 320/328 (97%)

Query: 1   MSFLLRPLNDXXXXXXXXVIRISPEPCFVVKSKVINPGTTSLSSNAKIFINICHNDQIPL 60
           MSFLLRPLND        VIRISPEPCFVVKSKVINPGTTSLSSNAKIFINICHNDQIPL
Sbjct: 1   MSFLLRPLNDSSSNNSNNVIRISPEPCFVVKSKVINPGTTSLSSNAKIFINICHNDQIPL 60

Query: 61  PEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQL 120
           PEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQL
Sbjct: 61  PEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQL 120

Query: 121 REIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYEETINDLVN 180
           REIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYEETINDLVN
Sbjct: 121 REIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYEETINDLVN 180

Query: 181 REQKEPVSIIEKRRDFLAEDEPSTGELPPLIPIDQSSRRKPLIEEIEDLSLHETKKPKVE 240
           REQKEPVSIIEKRRDFLAEDEPSTGELPPLIPIDQSSRRKPLIEEIEDLSLHETKKPKVE
Sbjct: 181 REQKEPVSIIEKRRDFLAEDEPSTGELPPLIPIDQSSRRKPLIEEIEDLSLHETKKPKVE 240

Query: 241 EIQKKSISYELSMGKPKDTSEFLLKIEVTSELNSSLDYNIKYDAKSNKLIIKNTNLGIYP 300
           EIQKKSISYELSMGKPKDTSEFLLKIEVTSELNSSLDYNIKYDAKSNKLIIKNTNLGIYP
Sbjct: 241 EIQKKSISYELSMGKPKDTSEFLLKIEVTSELNSSLDYNIKYDAKSNKLIIKNTNLGIYP 300

Query: 301 EKKLKVPLPDIFNNPPKLECFFVKPERR 328
           EKKLKVPLPDIFNNPPKLECFFVKPERR
Sbjct: 301 EKKLKVPLPDIFNNPPKLECFFVKPERR 328

>Sklu_1023.2 YHR034C, Contig c1023 1165-2223
          Length = 352

 Score =  344 bits (883), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 248/347 (71%), Gaps = 23/347 (6%)

Query: 2   SFLLRPLNDXXXXXXXXVIRISPEPCFVVKSKVINPGT-TSLSSNAKIFINICHNDQIPL 60
           +FLLRP+N         V+ + P+P FV+KSK+ +    T L+   KIFIN+C ++Q+P 
Sbjct: 4   NFLLRPINSTESTAS--VLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVPK 61

Query: 61  PEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQL 120
           P  +FNP+IVYPLI+NNQWEIPI+TS++RED DKKG +CYV DCCINT+C+SW+  D QL
Sbjct: 62  PNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQL 121

Query: 121 REIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYEETINDLVN 180
           REI+VEWCLESCELR  +EISRD I+FPKLK+KGD IP LEIL  DL +++ + I+ +V 
Sbjct: 122 REILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIVE 181

Query: 181 REQKEPVSIIEKRRDFLAED---------EPSTGELPPLIP------IDQSSRRKPLIEE 225
           +++ +P SI+E +RD +  +         +  TG LPPL P       + ++++KPLIEE
Sbjct: 182 KDRTDPTSILEMQRDLVFGETLGGRKNNGDEDTGTLPPLFPTTATTTTNNTTQKKPLIEE 241

Query: 226 IEDLSLH----ETKKPKVEEIQKKSISYELSMGKPKDTSEFLLKIEVTSELNSSLDYNIK 281
           I+DLS+     ET+KP+   ++ K++ Y+ +M K KD  +F LKIE+ SEL+SSLDY+IK
Sbjct: 242 IQDLSIREKQAETRKPRA-IVEPKTLEYQATMVKTKDDKKFKLKIEIISELDSSLDYSIK 300

Query: 282 YDAKSNKLIIKNTNLGIYPEKKLKVPLPDIFNNPPKLECFFVKPERR 328
           YD K++ L IKN NL +Y EKKL++PLP IF   P ++CFF+K ER+
Sbjct: 301 YDVKNSVLAIKNINLHLYNEKKLEIPLPKIFEEQPDIKCFFIKSERK 347

>Kwal_47.18184
          Length = 337

 Score =  274 bits (701), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 144/336 (42%), Positives = 211/336 (62%), Gaps = 12/336 (3%)

Query: 1   MSFLLRPLNDXXXXXXXXVIRISPEPCFVVKSKVINPGTTSLSSNAKIFINICHNDQIPL 60
           M+FLLR + D        V+R+ P+P FVVKSK+++      S  AK+F+N+CH DQ+P 
Sbjct: 1   MAFLLRAI-DNGNNDADSVVRVEPQPGFVVKSKLVSSYDGRYSLGAKVFVNVCHEDQVPQ 59

Query: 61  PEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQL 120
           PEI FNP++VYPLI+ NQWEIPI+ S++R+D DKKG++CYV DCCIN+ C+ W + +LQL
Sbjct: 60  PEIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQL 119

Query: 121 REIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYEETINDLVN 180
           REI+VEWCLESCELR  +EISR++++FPKL+ KG +I  LE+L  DL  ++   + DL  
Sbjct: 120 REILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHADFRHEMRDLAK 179

Query: 181 REQKEPVSIIEKRRDFLAEDEPST----GELPPLIPIDQSSRRKPLIEEIEDLSLHETKK 236
           RE  EP SI+E +R+ +  D  ST      LPPL P    +R   LI+EI+  S      
Sbjct: 180 RE-AEPASILELKRELIDADLDSTSIDSSALPPLFPSKTPTRL--LIQEIDSTSTSSQAP 236

Query: 237 PKVEEIQKKSI--SYELSMGKP-KDTSEFLLKIEVTSELNSSLDYNIKYDAKSNKLIIKN 293
            K       +   ++++SMGKP    S+  L+I++ S L +  DY I Y++  N L I +
Sbjct: 237 AKTVSTTPPTTDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYNSNENTLTISH 296

Query: 294 TNLGIYPEKKLKVPLPD-IFNNPPKLECFFVKPERR 328
           TN   +  K++ + LP  + ++ P++   F    R+
Sbjct: 297 TNTTHFLPKEITIALPHVVVSSTPQITTAFDDQSRK 332

>CAGL0D03916g complement(391089..392123) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c, hypothetical start
          Length = 344

 Score =  268 bits (685), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 208/329 (63%), Gaps = 26/329 (7%)

Query: 1   MSFLLRPLNDXXXXXXXXVIRISPEPCFVVKSKVIN-----PGTTSLSSNAKIFINICHN 55
           M FLLRP+          V  + PEP FV+KSK++N          L + +KIF+N+CH+
Sbjct: 1   MDFLLRPI---ASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHD 57

Query: 56  DQIPLPEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQ 115
            Q P PEI F+P IVYPLIINN+WEIPIV SSIR D DKKG VCYV DCC+ + CV W  
Sbjct: 58  PQAPKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFV 117

Query: 116 HDLQLREIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDL--TENYEE 173
            D QL+EIVVEWCLE+ ELR  +EISRD ISFPK++KKGD+IP+LEI   +L  ++  E 
Sbjct: 118 EDYQLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDGSDIKEA 177

Query: 174 TINDLVNREQKEPVSIIEKRRDFLAEDEP---------STGELPPLIPIDQSSRRKPLIE 224
           T ND  N    +P S+++ RRD L+++E          +   LPPL P    ++ + LI+
Sbjct: 178 TQNDKGN----DPSSLLQIRRDLLSQEEDLSLSNDSDITAHGLPPLFPKANETKGRSLIQ 233

Query: 225 EIEDLSLHETKKPKVEEIQKKSISYELSMGKPKDTSEFL-LKIEVTSELNSSLDYNIKYD 283
           EI+DL+L E  K   +++Q K+I Y + M K ++    L L I++ S    S D NI YD
Sbjct: 234 EIDDLTLKEKPKNAAKKVQ-KNIEYNVVMKKIENHKYKLRLDIQIDSITGKS-DLNIFYD 291

Query: 284 AKSNKLIIKNTNLGIYPEKKLKVPLPDIF 312
             +N ++++N N  +Y +K  K+PLP+IF
Sbjct: 292 PTNNDIVLRNLNTDLYDQKDFKIPLPNIF 320

>AAL062W [125] [Homologous to ScYHR034C - SH]
           complement(238295..239278) [984 bp, 327 aa]
          Length = 327

 Score =  261 bits (667), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 201/327 (61%), Gaps = 12/327 (3%)

Query: 1   MSFLLRPLNDXXXXXXXXVIRISPEPCFVVKSKVINPGTTSLSSNAKIFINICHNDQIPL 60
           M FLLRP++         VI   P P FV+KSK+ +    +L    K F+N+CH+ Q+PL
Sbjct: 1   MDFLLRPIDSKECS----VITFVPTPGFVIKSKLEHGKDATLVVGTKTFVNVCHHTQVPL 56

Query: 61  PEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQL 120
           P++ F+ +IVYPLI+ N+WEIPIVTS++R D DKKG  CYV DCCIN++C+ WI+ D QL
Sbjct: 57  PDVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQL 116

Query: 121 REIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYEETINDLVN 180
           REI+VEWCLESCELR  + ISR+ + FP++K KG  +P +E+L++DLT +Y+  I +  +
Sbjct: 117 REILVEWCLESCELRQSVGISREAVVFPRMKSKG-ALPAVEVLQQDLTHDYKHEIAENSS 175

Query: 181 REQKEPVSIIEKRRDFLAEDEPSTGELPPLIPIDQSSRRKPLIEEIEDLSLHET--KKPK 238
               +P  I+  R     E     G LP L P   ++R  PLIEE+ +   H    + PK
Sbjct: 176 LGMDDPRQILHMRGALDEEASGDDGTLPSLFPERPATR--PLIEEV-NTGRHSASVEAPK 232

Query: 239 -VEEIQKKSISYELSMGKPKDTSEFLLKIEVTSELNSSLDYNIKYDAKSNKLIIKNTNLG 297
            +       + + ++MG+P++ + + +K++V S LNS   Y++ YD K N L++ +T+  
Sbjct: 233 TLPACGLPRLEFAVTMGRPRNDANYKIKVQVASALNSGHAYSVHYDGKENSLLVTSTSQA 292

Query: 298 IYPEKKLKVPLPDIFNNPPKLECFFVK 324
            Y  K++ +PLP +      +   F+K
Sbjct: 293 -YEPKEICIPLPGVVAGTRSMRALFLK 318

>Scas_690.37
          Length = 332

 Score =  239 bits (611), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 137/336 (40%), Positives = 207/336 (61%), Gaps = 26/336 (7%)

Query: 3   FLLRPLNDXXXXXXXXVIRISPEPCFVVKSKVINPGTTSLSSNAKIFINICHNDQIPLPE 62
           FL+RP++         +I I P P FV+KSK+         +N+K+FIN+C +  +P P 
Sbjct: 8   FLIRPIS----TAQDPIITIHPTPKFVIKSKLT-------PTNSKLFINVCQDANVPSPS 56

Query: 63  IDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQLRE 122
           I F P +VYPLI+ ++WEIPI+TS +R+D DKKG+ C+V DC IN +C+ WI  DLQLRE
Sbjct: 57  IPFQPNVVYPLIMRDEWEIPILTSPMRQDTDKKGSPCHVCDCIINDQCMQWIAKDLQLRE 116

Query: 123 IVVEWCLESCELRAELEISRDNISFPKLKKKGDT-IPELEILREDLTENYEETINDLVNR 181
           I++EWCLE+ ELR  + + RD +  PKL  KG   +P LEI + +L  +++  I  ++  
Sbjct: 117 ILIEWCLEAVELREAVTVDRDAVKLPKLTCKGSLPLPVLEIPKRELERDFKRDIASIIEE 176

Query: 182 EQ-KEPVSIIEKRRDFLAEDEPSTGELPPLIPIDQSSRRKPLIEEIEDLSLHETKKPKVE 240
               EPV +++ +R     D+P    LPPL P    + + PLIEEI D+ + + K  K E
Sbjct: 177 NTVDEPVKVLQLKR--TQNDDPD-DTLPPLFP-QSGNVQGPLIEEI-DVDMDDLKITKQE 231

Query: 241 EIQK------KSISYELSMGKPKDTSEFLLKIEVTSELNSSLDYNIKYDAKSNKLIIKNT 294
                     K + +E  M K  +T  + L+I++TSE++SSLD ++ YD  +N+LI++N 
Sbjct: 232 PTSSRTSPLLKDLHFETVMRKTNNTQRYKLRIDITSEIDSSLDLHLAYDRTNNELILQNL 291

Query: 295 NLGIYPEKKLKVPLPDIFN--NPPKLECFFVKPERR 328
           N   + EKK+K+PLP+IF   N  + ECFF+K ++R
Sbjct: 292 NTVEFIEKKIKIPLPNIFTYENIKQSECFFIKKQKR 327

>YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.8994p [1035 bp, 344 aa]
          Length = 344

 Score =  203 bits (516), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 133/346 (38%), Positives = 192/346 (55%), Gaps = 32/346 (9%)

Query: 3   FLLRPLNDXXX---------XXXXXVIRISPEPCFVVKSKVINP-GTTSLSSNAKIFINI 52
           FLLRP+                   V +I P   FV+K+K+++  G   L    K+FIN+
Sbjct: 4   FLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFINV 63

Query: 53  CHNDQIPLPEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVS 112
           CH+  +P PE+DFN  IV+PLII N+WEIPI+TS  R D DKKG  CYV DCCIN+ C  
Sbjct: 64  CHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCSR 123

Query: 113 WIQHDLQLREIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYE 172
           WI  D+QLREI+VEWCLESCE+R  + + RD I+FPK+KKKG  +P LE+L ++L ++Y+
Sbjct: 124 WICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDYK 183

Query: 173 ETINDLVNREQKEPVSIIEKRRDFLAEDEPSTGE-LPPLIPIDQSSRRKPLIEEIE---- 227
             ++ ++  E  +P+SI+  R D   ++       LPPL PI+        IEEI+    
Sbjct: 184 AKMHKIIEEEAGDPMSILRGRNDDGDDNNDPDDGTLPPLFPIENKISGAK-IEEIDKNEI 242

Query: 228 ---DLSLHETKKPKVEEIQKKSISYELSMGKPKDTSEFLLKIEVTSEL-NSSLD-YNIKY 282
              +L       P   E Q+    YE+ M + K  + + L+I + ++  NS  D ++  Y
Sbjct: 243 AHRNLKQAPAPAPAPHEQQEDVPEYEVKMKRFKGAA-YKLRILIENKAPNSKPDRFSPSY 301

Query: 283 DAKSNKLIIKNTNLGIYPEKKLKVPLP-DIFNNPPKLECFFVKPER 327
           +   N L I           KL +PLP DI  N   ++ F ++ ER
Sbjct: 302 NFAENILYING---------KLSIPLPRDIVVNAADIKIFHIRKER 338

>Scas_695.3
          Length = 527

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 173 ETINDLVNREQKEPVSIIEKRR-DFLAEDEPSTGELPPLIPIDQSSRRKPLIEE 225
           E +N  +N E++    I+EK   DFL E+E    E    + ID++  +KPL+E+
Sbjct: 292 EELNQWINFEEQVEGKILEKVGIDFLLENEEHDNEKSWKLLIDKAKSKKPLVED 345

>CAGL0I07865g 758457..761381 similar to tr|Q12252 Saccharomyces
           cerevisiae YOL084w PHM7, hypothetical start
          Length = 974

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 6/63 (9%)

Query: 150 LKKKGDTIPELEILREDLTENYEETINDLVNREQKEPVSIIEKRRDFLAEDEPSTGELPP 209
           LK+  D + E    R++  +NYE+T+N L+N+  K+  S  EK+R+ L +D     +L  
Sbjct: 220 LKELQDMVKE----RDETAQNYEKTLNKLINKCVKKQNS--EKKREKLYKDGKPKDDLST 273

Query: 210 LIP 212
            +P
Sbjct: 274 YVP 276

>Scas_671.22*
          Length = 487

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 10/61 (16%)

Query: 186 PVSIIEKRRDFLAEDEPSTGELPPLIPIDQSSRRKPLIEEIEDLSLHETKKPKVEEIQKK 245
           P  ++ ++ D +A DE ST          ++ ++ PLI+EI   S     K  +EEI+  
Sbjct: 93  PTKLLARQGDLVAADEIST----------KTVKKGPLIQEIGGTSTSTGLKDSIEEIRAA 142

Query: 246 S 246
            
Sbjct: 143 G 143

>KLLA0C14157g complement(1223130..1226402) similar to sp|P32337
           Saccharomyces cerevisiae YMR308c PSE1 beta karyopherin,
           start by similarity
          Length = 1090

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 207 LPPLIPIDQSSRRKPLIEEIEDLSLHETKKPKVEEIQKKSISYELSMGKPKDTSEFLLKI 266
           +PPL+   ++++   LIEE E  +  +     V +IQ K I+   S+   K T+  LL++
Sbjct: 627 IPPLLETAKATQDVSLIEEEEAANYQQYTDWDVVQIQGKHIAIHTSVLDDKVTAMELLQV 686

Query: 267 EVT 269
             T
Sbjct: 687 YAT 689

>KLLA0D10824g complement(922978..924498) similar to sp|P40016
           Saccharomyces cerevisiae YER021w SUN2 26S proteasome
           regulatory subunit singleton, start by similarity
          Length = 506

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 12/89 (13%)

Query: 194 RDFLAEDEPSTGE----LPPLIPIDQSSRRKPLIEEIEDLSLHETKKPKVEEIQKKSISY 249
           RDF A     T E    L  L+  D SS +K L++ I     H T +PKVE   K    Y
Sbjct: 53  RDFAALRHDVTVENTSILVNLVYPDDSSYKKYLLKTI-----HPTSRPKVENAVKFREEY 107

Query: 250 ELSMGKPKDTSEFLLKIEVTSELNSSLDY 278
             S+ + +        ++V+SE+NS + Y
Sbjct: 108 PASLYQLQQDGT---SLDVSSEVNSFVHY 133

>Scas_632.13
          Length = 622

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 69  IVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQLREI 123
           ++YP  + NQ +   V  + + + ++KGN+    +CC + +C   +    ++R I
Sbjct: 495 VLYPNNMENQDDYKKVLETFKSEFERKGNI----ECCHSFECFQEMMGKSEMRTI 545

>Kwal_27.10151
          Length = 217

 Score = 28.1 bits (61), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 144 NISFPKLKKKGDTIPELEILR-EDLTENYEET-----INDLVNREQKEPVSIIEKRRDFL 197
           ++ FP   +  D++P+    + +DL + +E T     I DLV R+ K+P  I+++ +  +
Sbjct: 22  DVLFPFFLRHVDSLPQSSDPQVQDLLKQFETTDAIAHIRDLVARDVKDP--ILKQLQGLI 79

Query: 198 AEDEPSTGELPPLIPID 214
            E+  ++GE+   + ID
Sbjct: 80  WENGYASGEIKTPLYID 96

>Scas_637.15
          Length = 575

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 147 FPKLKKKGDTIPELEILREDLTENYEETINDLVNREQ---KEPVSIIEKRRDFLA 198
           F  LK++G  + +LE +  DL   + E I+   +REQ    EP+ I   RR  +A
Sbjct: 193 FDTLKREGTKLTDLETIERDLNRTFPENIH--FHREQFQKDEPIIIQSLRRVLIA 245

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,624,038
Number of extensions: 555419
Number of successful extensions: 2319
Number of sequences better than 10.0: 107
Number of HSP's gapped: 2355
Number of HSP's successfully gapped: 109
Length of query: 328
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 226
Effective length of database: 13,065,073
Effective search space: 2952706498
Effective search space used: 2952706498
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 62 (28.5 bits)