Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C10274g1300128067960.0
AAL060W1305128938930.0
Kwal_47.181921307129834660.0
Scas_588.131340132033830.0
YDR301W (CFT1)1357133633220.0
CAGL0H01463g1361134231880.0
ACL196W33486722.5
Scas_711.13176990713.9
YNL311C763154697.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C10274g
         (1280 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C10274g complement(879403..883305) similar to sgd|S0002709 ...  2622   0.0  
AAL060W [127] [Homologous to ScYDR301W (CFT1) - SH] complement(2...  1504   0.0  
Kwal_47.18192                                                        1339   0.0  
Scas_588.13                                                          1307   0.0  
YDR301W (CFT1) [1129] chr4 (1063344..1067417) Component of pre-m...  1284   0.0  
CAGL0H01463g 142420..146505 similar to tr|Q06632 Saccharomyces c...  1232   0.0  
ACL196W [853] [Homologous to ScYLR354C (TAL1) - SH; ScYGR043C - ...    32   2.5  
Scas_711.13                                                            32   3.9  
YNL311C (YNL311C) [4302] chr14 complement(49396..51687) Protein ...    31   7.3  

>KLLA0C10274g complement(879403..883305) similar to sgd|S0002709
            Saccharomyces cerevisiae YDR301w CFT1 pre-mRNA 3 -end
            processing factor CF II, start by similarity
          Length = 1300

 Score = 2622 bits (6796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1270/1280 (99%), Positives = 1270/1280 (99%)

Query: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60
            MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI
Sbjct: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60

Query: 61   IDMQLLPQIGSPLKMLAILSSKSKVSLVRFDPVAESLETLSLHYYHDKFVNLSTSSLKTE 120
            IDMQLLPQIGSPLKMLAILSSKSKVSLVRFDPVAESLETLSLHYYHDKFVNLSTSSLKTE
Sbjct: 61   IDMQLLPQIGSPLKMLAILSSKSKVSLVRFDPVAESLETLSLHYYHDKFVNLSTSSLKTE 120

Query: 121  SIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENGIKEPMAKRLKRNQGITSDSI 180
            SIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENGIKEPMAKRLKRNQGITSDSI
Sbjct: 121  SIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENGIKEPMAKRLKRNQGITSDSI 180

Query: 181  IMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGNEKVLGNTMRYMVLSLDVED 240
            IMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGNEKVLGNTMRYMVLSLDVED
Sbjct: 181  IMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGNEKVLGNTMRYMVLSLDVED 240

Query: 241  EKTTVIAELADLPNDLHTLVPLKRGYVLIGVNELLYISASGALQSCIRLNTFATSSINTR 300
            EKTTVIAELADLPNDLHTLVPLKRGYVLIGVNELLYISASGALQSCIRLNTFATSSINTR
Sbjct: 241  EKTTVIAELADLPNDLHTLVPLKRGYVLIGVNELLYISASGALQSCIRLNTFATSSINTR 300

Query: 301  ITDNSDMNIFLSKSSIYFYKALKRHDLLILIDENCRMYNIITESEGNLLTKFDCVQVPIV 360
            ITDNSDMNIFLSKSSIYFYKALKRHDLLILIDENCRMYNIITESEGNLLTKFDCVQVPIV
Sbjct: 301  ITDNSDMNIFLSKSSIYFYKALKRHDLLILIDENCRMYNIITESEGNLLTKFDCVQVPIV 360

Query: 361  NEIFKNSRLPLSVCGDLNLETGRVLIGFLSGDAMFLQLKNLKVAFAAKRQLVETVDDDDD 420
            NEIFKNSRLPLSVCGDLNLETGRVLIGFLSGDAMFLQLKNLKVAFAAKRQLVETVDDDDD
Sbjct: 361  NEIFKNSRLPLSVCGDLNLETGRVLIGFLSGDAMFLQLKNLKVAFAAKRQLVETVDDDDD 420

Query: 421  EYSALYGESQNNTHTRIVETQEPFDISLLDSIFNIGPLTSLTIGKVASVEPTIQRLPNPN 480
            EYSALYGESQNNTHTRIVETQEPFDISLLDSIFNIGPLTSLTIGKVASVEPTIQRLPNPN
Sbjct: 421  EYSALYGESQNNTHTRIVETQEPFDISLLDSIFNIGPLTSLTIGKVASVEPTIQRLPNPN 480

Query: 481  KDEFSIVATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNLKIKGKDKYLVTTDADK 540
            KDEFSIVATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNLKIKGKDKYLVTTDADK
Sbjct: 481  KDEFSIVATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNLKIKGKDKYLVTTDADK 540

Query: 541  EKSDVYQIDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSGGLYLFDVDFKRLARLT 600
            EKSDVYQIDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSGGLYLFDVDFKRLARLT
Sbjct: 541  EKSDVYQIDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSGGLYLFDVDFKRLARLT 600

Query: 601  IDIEIVHACIIDPYILFTDARGNIKIYQLDSXXXXXXXXXXLPEALNEIIITSGSIFKSN 660
            IDIEIVHACIIDPYILFTDARGNIKIYQLDS          LPEALNEIIITSGSIFKSN
Sbjct: 601  IDIEIVHACIIDPYILFTDARGNIKIYQLDSKNKKKFIKFKLPEALNEIIITSGSIFKSN 660

Query: 661  ICNKFLHGLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQIP 720
            ICNKFLHGLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQIP
Sbjct: 661  ICNKFLHGLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQIP 720

Query: 721  EEMNPDPSIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKHSGKLLKCKSHPLITGA 780
            EEMNPDPSIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKHSGKLLKCKSHPLITGA
Sbjct: 721  EEMNPDPSIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKHSGKLLKCKSHPLITGA 780

Query: 781  PNNAYPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVTMA 840
            PNNAYPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVTMA
Sbjct: 781  PNNAYPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVTMA 840

Query: 841  RWGKNSVMCVDNIKNARVMKLDPECYYGNTQILRKIIIEDVVEEFETLGNIAYHERTGMY 900
            RWGKNSVMCVDNIKNARVMKLDPECYYGNTQILRKIIIEDVVEEFETLGNIAYHERTGMY
Sbjct: 841  RWGKNSVMCVDNIKNARVMKLDPECYYGNTQILRKIIIEDVVEEFETLGNIAYHERTGMY 900

Query: 901  IISYTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSENSMVN 960
            IISYTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSENSMVN
Sbjct: 901  IISYTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSENSMVN 960

Query: 961  DIKTMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSNFKFK 1020
            DIKTMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSNFKFK
Sbjct: 961  DIKTMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSNFKFK 1020

Query: 1021 QLFEEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAKSFSN 1080
            QLFEEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAKSFSN
Sbjct: 1021 QLFEEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAKSFSN 1080

Query: 1081 LMIIGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQNHLHV 1140
            LMIIGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQNHLHV
Sbjct: 1081 LMIIGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQNHLHV 1140

Query: 1141 LRYAPDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSKTSNYIALGCQTDGSIFR 1200
            LRYAPDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSKTSNYIALGCQTDGSIFR
Sbjct: 1141 LRYAPDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSKTSNYIALGCQTDGSIFR 1200

Query: 1201 MIPLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEYYHKGHSLRPTLDSQVLKKYI 1260
            MIPLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEYYHKGHSLRPTLDSQVLKKYI
Sbjct: 1201 MIPLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEYYHKGHSLRPTLDSQVLKKYI 1260

Query: 1261 HLPITKRTTIENRVGRHAST 1280
            HLPITKRTTIENRVGRHAST
Sbjct: 1261 HLPITKRTTIENRVGRHAST 1280

>AAL060W [127] [Homologous to ScYDR301W (CFT1) - SH]
            complement(241008..244925) [3918 bp, 1305 aa]
          Length = 1305

 Score = 1504 bits (3893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/1289 (55%), Positives = 955/1289 (74%), Gaps = 17/1289 (1%)

Query: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60
            MNVFDE++  TVVN  + G+FT+  REE ++ RTN+LSV       +LVLAYEWKL+G++
Sbjct: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60

Query: 61   IDMQLLPQIGSPLKMLAILSSKSKVSLVRFDPVAESLETLSLHYYHDKFVNLSTSSLKTE 120
              + L+P   S L  LA+L+ + +VS+VRFD   ++LET SLHYY  KF  LS  ++   
Sbjct: 61   HGLSLVPH-KSGLGRLAVLTGRGRVSIVRFDAENQTLETESLHYYDAKFEELSALTVGAA 119

Query: 121  SIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENGIKEPMAKRLKRNQG--ITSD 178
              +  +P  RCLLV N D LA+LPL+    + E +E E   + P AKR + +    +   
Sbjct: 120  PRLEQEPAARCLLVHNGDCLAVLPLR--GHEEEGEEAEEEEEHP-AKRARTDADGRLVGA 176

Query: 179  SIIMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGNEKVLGNTMRYMVLSLDV 238
            S +MP S LH  +K+V D+++L   +K  VG+LYQP L+WCGNEK+   TM++++LSLD+
Sbjct: 177  STVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNEKLTRQTMKFIILSLDL 236

Query: 239  EDEKTTVIAELADLPNDLHTLVPLKRGYVLIGVNELLYISASGALQSCIRLNTFATSSIN 298
            +DEK+TVI  L  LPN LHT++PL  G VL GVNELLY+  +GALQ  I LN F+ S +N
Sbjct: 237  DDEKSTVINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVDNTGALQGAISLNAFSNSGLN 296

Query: 299  TRITDNSDMNIFLSKSSIYFYKALKRHDLLILIDENCRMYNIITESEGNLLTKFDCVQVP 358
            TRI DNS +  F  +   YF       D+L+L+DE  RMYN+I E+EG LLT F+CVQ+P
Sbjct: 297  TRIQDNSKLQAFFEQPLCYFATQSNGRDILLLMDEKARMYNVIIEAEGRLLTTFNCVQLP 356

Query: 359  IVNEIFKNSRLPLSVCGDLNLETGRVLIGFLSGDAMFLQLKNLKVAFAAKRQLVETVDDD 418
            IVNEIFK + +P S+CG++NLETG + IGF SGDAM ++L NLK +   K  + ET++ D
Sbjct: 357  IVNEIFKRNMMPTSICGNMNLETGSLFIGFQSGDAMHVRLNNLKSSLEHKGTVSETLETD 416

Query: 419  DDEYSALYGESQNNTHTRIVETQEPFDISLLDSIFNIGPLTSLTIGKVASVEPTIQRLPN 478
            +D Y  LYG +      + +ET+ PFDI  LD + NIGP+TSL +GK +S+E T+ +L N
Sbjct: 417  ED-YMELYGNNAEK-EKKNLETESPFDIECLDRLLNIGPVTSLAVGKASSIEHTVAKLAN 474

Query: 479  PNKDEFSIVATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNLKIKGKDKYLVTTDA 538
            PNKDE SIVATSG G GSHLT L +T+ P ++QALKF S T+IWNLKIKGKDKYLVTTD+
Sbjct: 475  PNKDELSIVATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIKGKDKYLVTTDS 534

Query: 539  DKEKSDVYQIDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSGGLYLFDVDFKRLAR 598
             + +SD+Y IDR+F+PF+A DFRK+  T+        KRI+QVTS G++LFD++FKR+  
Sbjct: 535  SQTRSDIYSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVHLFDINFKRMMT 594

Query: 599  LTIDIEIVHACIIDPYILFTDARGNIKIYQLDSXXXXXXXXXXLPEALNEIIITSGSIFK 658
            +  D E+VH CI DP++L T+++G+IKIY+L+           LP+AL EIIIT G I +
Sbjct: 595  MNFDFEVVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIIITFGVILE 654

Query: 659  SNICNKFLHGLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQ 718
            SN+CNK+++GLE S + QLLFTFVT DNQ++FFT+ HNDRIFQLNG+D     LFISTYQ
Sbjct: 655  SNMCNKYINGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQ 714

Query: 719  IPEEMNPDPSIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKHSGKLLKCKSHPLIT 778
            +PE++NPDPSIKQ++++RLGH  K+E+LTILTFGGE+Y Y+K   +  + +KC    LIT
Sbjct: 715  LPEDINPDPSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDRFIKCDHELLIT 774

Query: 779  GAPNNAYPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVT 838
            GAP NAYP+GV  +ERVAHY  +YNGYSV+FITG VPYIIIKEDNSV RIF   NI +V+
Sbjct: 775  GAPENAYPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPRIFPFANITLVS 834

Query: 839  MARWGKNSVMCVDNIKNARVM--KLDPECYYGNTQILRKIIIEDVVEEFETLGNIAYHER 896
            M RWG+NSVMCVD++KNAR+M   LD + YYGN   L KI +ED +E+F+TL NI YHER
Sbjct: 835  MTRWGENSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHER 894

Query: 897  TGMYIISYTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSEN 956
            T  +I+SY K I+Y ALSE+ EPLVGY+P K ++ G++SG++L++P +W IID+++  +N
Sbjct: 895  TQTFIVSYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKN 954

Query: 957  SMVNDIKTMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSN 1016
            S++ND++TM+IQLNS T+R+RE +++G+++V++ED   TG   + DITEVV EPGKPD+N
Sbjct: 955  SLINDMRTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTN 1014

Query: 1017 FKFKQLFEEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAK 1076
            +KFK +F+E+IRG+V+ VCEISGRFMI QSSKA+VRD+QEDNS VPVAFLDMPVFITDAK
Sbjct: 1015 YKFKDIFQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAK 1074

Query: 1077 SFSNLMIIGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQN 1136
            SF NLMIIGDSMQGF+F+GFDAEPYRM+ LGKS SK + M +EFLVNNG++ F+VTDR N
Sbjct: 1075 SFGNLMIIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNN 1134

Query: 1137 HLHVLRYAPDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSKTS-------NYIA 1189
             +HVL+YAPDE NSLSGQRLVHC SFN+ +TN  M+L++K+ EFG  +        ++  
Sbjct: 1135 LMHVLKYAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQC 1194

Query: 1190 LGCQTDGSIFRMIPLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEYYHKGHSLRP 1249
            +G Q DG+IF+++PL+EASYR  YL+QQQL+D E+ L G N +MERL+N +Y  GH LRP
Sbjct: 1195 IGSQADGTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLENPFYQMGHILRP 1254

Query: 1250 TLDSQVLKKYIHLPITKRTTIENRVGRHA 1278
             LD  VLK++  L I  R T+ ++ GR A
Sbjct: 1255 MLDFTVLKRFATLSIPTRMTMASKAGRQA 1283

>Kwal_47.18192
          Length = 1307

 Score = 1339 bits (3466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1298 (50%), Positives = 926/1298 (71%), Gaps = 30/1298 (2%)

Query: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60
            MNV+DEI   T V+  L G+FTS + ++ + ARTNVLSV++    +KLVL +E+KL G+I
Sbjct: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDH-EKLVLLHEYKLHGRI 59

Query: 61   IDMQLLPQIGSPLKMLAILSSKSKVSLVRFDP-VAESLETLSLHYYHDKFVNLSTSSLKT 119
              M L+PQ+ SPL  L I + K+K+SLVRFDP +   LET+SLHYY  +F   S   L  
Sbjct: 60   TGMVLVPQLRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEKSILELAE 119

Query: 120  ESIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENGIKEPMAKRLK----RNQGI 175
             S + +DP  RC+ +FN D+LAILPL       E ++D+N      AK+ K     ++ +
Sbjct: 120  SSKLRIDPEKRCVFLFNTDMLAILPLT----GHEDEDDDNQDHSHQAKKQKVGNDASRSL 175

Query: 176  TSDSIIMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGNEKVLGNT-MRYMVL 234
            T  S++M +S LH+ +K+V DI++LN+F+ PT+ ILYQP LAW GNEKV+  T M++M L
Sbjct: 176  TGQSLVMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGNEKVVSKTPMKFMAL 235

Query: 235  SLDVEDEKTTVIAELADLPNDLHTLVPLKRGYVLIGVNELLYISASGALQSCIRLNTFAT 294
            +L  +D K+T I  +  +P+D+H+++PL    VL+GVNE++ +  +GALQS I+LN+FA+
Sbjct: 236  TL--QDNKSTTIYHMKGIPHDVHSIIPLTNSCVLVGVNEIMSVDNTGALQSTIQLNSFAS 293

Query: 295  SSINTRITDNSDMNIFLSKSSIYFYKAL-KRHDLLILIDENCRMYNIITESEGNLLTKFD 353
                ++  D S + +  ++  ++    + K  ++LI++D    +Y++I++SEG LL  F 
Sbjct: 294  KLPGSKQIDKSSLQVMFNEPVVWTSAMVSKDKEILIIMDHRADLYSVISQSEGRLLLDFT 353

Query: 354  CVQVPIVNEIFKNSRLP---LSVCGDLNLETGRVLIGFLSGDAMFLQLKNLKVAFAAKR- 409
             V++PI ++IFK   LP   L + G + ++  +  IGF SG+A+ ++  NL+ AF +   
Sbjct: 354  LVKLPIASDIFKAHYLPTCILPLSGGIQMKMCQFFIGFSSGNALMVKFNNLRSAFESNEI 413

Query: 410  QLVETVDDDDDEYSALYGESQNNTHTRI-----VETQEPFDISLLDSIFNIGPLTSLTIG 464
            Q +E   D+D++Y ALYG+  +     +     VE   PF I L+D + N+GP+TSL +G
Sbjct: 414  QAIELPHDEDEDYDALYGDDDDLARPAVENMTTVEASIPFSIDLMDFLINVGPITSLAVG 473

Query: 465  KVASVEPTIQRLPNPNKDEFSIVATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNL 524
            KV+S  P I+ LPNPN++E ++V++SG G G+++  +  +V P ++QALKFTS T+IW L
Sbjct: 474  KVSSANPNIEGLPNPNRNEIALVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWAL 533

Query: 525  KIKGKDKYLVTTDADKEKSDVYQIDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSG 584
            KI+ KDKYL+TTD+  EKSDV++I +     + + F+K+  T+ +  +   KRI+QVT+ 
Sbjct: 534  KIRKKDKYLITTDSGAEKSDVFEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTK 593

Query: 585  GLYLFDVDFKRLARLTIDIEIVHACIIDPYILFTDARGNIKIYQLDSXXXXXXXXXXLPE 644
             +YLF++ FK+L  ++ D E+VH  I DP+IL T+++G IKIY+L+           LPE
Sbjct: 594  AVYLFNLGFKKLMTISFDFEVVHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPE 653

Query: 645  ALNEIIITSGSIFKSNICNKFLHGLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNG 704
             L E+IITSG I KS+ICN+++ GLE+  ++QLLFTFV  DNQ+I F ++H+DR+FQLNG
Sbjct: 654  VLEEMIITSGVILKSSICNQYMSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNG 713

Query: 705  VDQLEDMLFISTYQIPEEMNPDPSIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKH 764
            VD L DMLF+STYQ+PE++ PDPSIKQ+M+N LG + KEE+LT+LTFGGEIY YKK    
Sbjct: 714  VDILNDMLFVSTYQLPEQIIPDPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKIGNK 773

Query: 765  SGKLLKCKSHPLITGAPNNAYPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNS 824
              K ++C     ITGAP NAY +GV+ IER+AHY   +NGYS++ +TG VPY+IIKED S
Sbjct: 774  FFKSMRCNEFQ-ITGAPGNAYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFS 832

Query: 825  VCRIFRMTNIPIVTMARWGKNSVMCVDNIKNARVMKLDPECYYGNTQILRKIIIEDVVEE 884
              +IF+  NIP+V++  WG +SV+CVD+IKNAR++ L+ E  YGN   +R+I I D   E
Sbjct: 833  TPKIFKFGNIPLVSLTPWGADSVLCVDDIKNARIVTLNNEFSYGNRLPVRRIKIGDATNE 892

Query: 885  FETLGNIAYHERTGMYIISYTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLT 944
            F+++  +A+HERTGMYI SYTK IEY+A+SE+GE L+G D S P++ GY+SG++L+NP T
Sbjct: 893  FQSITGVAFHERTGMYIASYTKEIEYEAISEEGEKLIGCDDSVPHAKGYQSGIILLNPKT 952

Query: 945  WNIIDRLDLSENSMVNDIKTMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDIT 1004
            WNIID  D  +NS++ND+KTMLIQ NS+ +RKRE +++G++FV++ED  + G   + DIT
Sbjct: 953  WNIIDLADYGKNSLINDMKTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDIT 1012

Query: 1005 EVVAEPGKPDSNFKFKQLFEEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVA 1064
            EVV EPGKPD+N+K KQ+F EE RG+V++VCE+SGRF+I QS K LVRD+QEDNS VPVA
Sbjct: 1013 EVVPEPGKPDTNYKLKQIFHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVA 1072

Query: 1065 FLDMPVFITDAKSFSNLMIIGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNN 1124
            FLD+PVF+TD+KS  NL+IIGD+MQGF FVGFDAEPYRMI LG+S SKF+VM+LEFL+NN
Sbjct: 1073 FLDIPVFVTDSKSCGNLLIIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNN 1132

Query: 1125 GNINFIVTDRQNHLHVLRYAPDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSKT 1184
            GNI F+V+DR N LHVL+YAPDE NSLSGQ+LVHC SFN+ +TN  MKL+ K+ EF  K 
Sbjct: 1133 GNIYFLVSDRSNILHVLKYAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEF--KA 1190

Query: 1185 SN----YIALGCQTDGSIFRMIPLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEY 1240
            +N    + A+G QTDGSIF+++PL+E +YRR Y+V+QQL++ +I L G N KMERL N++
Sbjct: 1191 ANDLPAFQAIGAQTDGSIFKVVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQNDF 1250

Query: 1241 YHKGHSLRPTLDSQVLKKYIHLPITKRTTIENRVGRHA 1278
            Y  GHSLRP LD  V+K Y  L   KR  +  + GR A
Sbjct: 1251 YQLGHSLRPMLDFTVIKNYGALASNKRKQVAAKAGRQA 1288

>Scas_588.13
          Length = 1340

 Score = 1307 bits (3383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/1320 (49%), Positives = 913/1320 (69%), Gaps = 44/1320 (3%)

Query: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60
            MN+++++L  TVV+  + G+FTS  + E ++ RTN++SV+  +   KL L  E+ L  KI
Sbjct: 1    MNIYEDVLTATVVSHSITGHFTSTSQRELIIVRTNIISVYNTTDDGKLNLVEEFNLNAKI 60

Query: 61   IDMQLLPQIGSPLKMLAILSSKSKVSLVRFDPVAESLETLSLHYYHDKFVNLSTSSLKTE 120
             D+ L+PQ  SPL  L I S  +K+S+VRFD V  SLETLSLHYY DK  ++S  +L   
Sbjct: 61   TDIALIPQEKSPLSCLVIASGVAKISIVRFDAVTNSLETLSLHYYEDKLSDISLVTLAKT 120

Query: 121  SIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENGI-----KEPMAKRLKRNQGI 175
            S + VDP+ R LL+FN D +A+LPL     + E ++DE         E   KR K+N+  
Sbjct: 121  SKLRVDPMNRALLLFNNDSIALLPLFSGNHEDEDEDDEEDDYDVTRGEVTTKRSKKNEKH 180

Query: 176  TSDSIIMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGNEKVLGNTMRYMVLS 235
               S I  +  LH+ L++V DI++LN+F+KPT+ +LYQP L W GN ++      +M+ +
Sbjct: 181  VGQSKIFHVKELHQELQNVLDIQFLNDFTKPTLAVLYQPKLTWVGNTELNPQPTSFMIFT 240

Query: 236  LDVEDEK------TTVIAELADLPNDLHTLVPLKRGYVLIGVNELLYISASGALQSCIRL 289
            L++   +        +IA L DL  D   L+P+ RG V++G NE+ YI  +G LQS I L
Sbjct: 241  LNLRTNELETAFDVVIIATLHDLSWDWFQLLPISRGCVVMGNNEMAYIDNTGVLQSIIHL 300

Query: 290  NTFATSSIN-TRITDNSDMNIFLSKSSIYFYKALKRH-----DLLILIDENCRMYNIITE 343
            N+FA  S+   RI D +++ +F ++   YF+ A         + L++ID +  +Y +  E
Sbjct: 301  NSFADKSLQRARIIDETELEVFFNEKVTYFWSASTDKKNIDDETLLIIDASANLYYVRLE 360

Query: 344  SEGNLLTKFDCVQVPIVNEIFKNSRLPLSVCG-DLNLETGR--VLIGFLSGDAMFLQLKN 400
            +EG LLTKFD +++PIVN+  K++  P  V   D N       + IG+LSGD++ ++L N
Sbjct: 361  AEGRLLTKFDLIKLPIVNDALKDTSNPTCVARVDPNSSNSSMDLFIGYLSGDSLVVRLNN 420

Query: 401  LKVAFAAKRQLVET----------------VDDDDDEYSALYGESQNNTHTRIVETQEPF 444
            LK A   + +  E+                +  DD+    +  E  +N   ++++T +PF
Sbjct: 421  LKSAIETREEHKESKQIFTGYDDDDDDEDNLYSDDESKEKIDEELPDNK--QLIQTVQPF 478

Query: 445  DISLLDSIFNIGPLTSLTIGKVASVEPTIQRLPNPNKDEFSIVATSGVGRGSHLTALHST 504
            DI  L S+ NIGP+TSL  GKV SV+P ++ L NPN +E+S+VATSG G GSHLTA+  +
Sbjct: 479  DIEQLTSLRNIGPITSLVAGKVTSVDPNVKGLQNPNSNEYSMVATSGSGTGSHLTAIQPS 538

Query: 505  VQPHIEQALKFTSATRIWNLKIKGKDKYLVTTDADKEKSDVYQIDRNFEPFRAQDFRKDS 564
            VQP +E ALKF S T+IW LK+K KDKYLVTTD+ K KSD+Y+ID  F   +    R+D+
Sbjct: 539  VQPLVELALKFISVTQIWKLKMKNKDKYLVTTDSTKSKSDIYEIDNKFALHKEGRLRRDA 598

Query: 565  RTIGMETMDDDKRILQVTSGGLYLFDVDFKRLARLTIDIEIVHACIIDPYILFTDARGNI 624
             TI +    +  RI+QVT+  LYLFD DF+RL  +  D E+VH  ++DPYIL T  RG+I
Sbjct: 599  TTIHISMFGEGTRIVQVTTNHLYLFDTDFRRLTAIKFDFEVVHVSVMDPYILITVLRGDI 658

Query: 625  KIYQLDSXXXXXXXXXXLPEALNEIIITSGSIFKSNICNKFLHGLENSSQEQLLFTFVTG 684
            KIY+LD+          LPE L E+++TSG I KSN+CN++LHG E+S +EQLLFTFVT 
Sbjct: 659  KIYELDALQKRKLFRVDLPEILKEMVVTSGVILKSNMCNEYLHGHEDSEEEQLLFTFVTA 718

Query: 685  DNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQIPEEMNPDPSIKQIMLNRLGHHKKEE 744
            DNQ+IFF  +HNDRIFQL GVDQL++ LFISTYQ+PEE+ PDPSIKQ+M+N+LGH+ KEE
Sbjct: 719  DNQIIFFLREHNDRIFQLCGVDQLKEGLFISTYQLPEEVVPDPSIKQVMINKLGHNNKEE 778

Query: 745  FLTILTFGGEIYQYKKS-TKHSGKLLKCKSHPL-ITGAPNNAYPQGVNKIERVAHYFPNY 802
            +LTILTFGGEIYQYKKS T+HS       S  + ITGAP+NAY +GV+ IER+ HY P+Y
Sbjct: 779  YLTILTFGGEIYQYKKSRTRHSCFFKNTGSTGMCITGAPDNAYAKGVSSIERIMHYIPDY 838

Query: 803  NGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVTMARWGKNSVMCVDNIKNARVMKLD 862
            +GYSV+F+TG VPYII++ED+S  +IFR  N+ IV++A+WGKNSVM VD+IKNARV  LD
Sbjct: 839  SGYSVIFLTGSVPYIIMREDDSSPKIFRFANLSIVSLAQWGKNSVMAVDDIKNARVYSLD 898

Query: 863  -PECYYGNTQILRKIIIEDVVEEFETLGNIAYHERTGMYIISYTKFIEYQALSEDGEPLV 921
              + YYGN+  L+KI I D +E+F TL  I YHE++ ++++SY K  EY+AL EDGE +V
Sbjct: 899  NKDSYYGNSLPLKKIKISDSLEDFMTLTKITYHEKSQLFLVSYAKEREYEALGEDGEIIV 958

Query: 922  GYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSENSMVNDIKTMLIQLNSKTRRKRELVI 981
            G +   P++  ++SG+LLINP TWN+IDR+D   NS+++D+++MLIQL+SK+R+KRE ++
Sbjct: 959  GSNDQVPHAKSFQSGILLINPRTWNVIDRVDFEVNSIISDMRSMLIQLDSKSRKKREYIV 1018

Query: 982  IGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSNFKFKQLFEEEIRGSVNAVCEISGRF 1041
             G +F+  ED PSTG   + D+TEV+ EPGKPD+NFK K++F+E+IRGSVN+VC+ISGRF
Sbjct: 1019 AGITFIGTEDLPSTGAFHIYDLTEVIPEPGKPDTNFKLKEIFKEDIRGSVNSVCDISGRF 1078

Query: 1042 MIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAKSFSNLMIIGDSMQGFTFVGFDAEPY 1101
            +I QS K +VRD+QEDNS VPVAF D P+F++DAKSF N +I+GDSMQGF F+GFDAEPY
Sbjct: 1079 LINQSQKIMVRDVQEDNSVVPVAFYDTPIFVSDAKSFGNFLILGDSMQGFQFLGFDAEPY 1138

Query: 1102 RMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQNHLHVLRYAPDEANSLSGQRLVHCNS 1161
            RMI LG+S S F+ +++EFL+N G INF +TDR++ LHVL+YAPDE N+LSGQ+LVHC+S
Sbjct: 1139 RMIPLGRSVSSFETVSVEFLINAGEINFAITDREDILHVLKYAPDEPNTLSGQKLVHCSS 1198

Query: 1162 FNMFTTNNYMKLVRKHVEFGSKTS---NYIALGCQTDGSIFRMIPLNEASYRRFYLVQQQ 1218
            FN++++N  M ++ ++ EF +       + A+G Q DG IF++IPL E +YRR Y+VQQQ
Sbjct: 1199 FNLYSSNTCMLMLPRNDEFETSDKAPPKFQAIGGQVDGGIFKIIPLKEDTYRRLYVVQQQ 1258

Query: 1219 LLDHEIPLAGFNTKMERLDNEYYHKGHSLRPTLDSQVLKKYIHLPITKRTTIENRVGRHA 1278
            ++D E+ L G N +MERLDN++Y   H +RP +D  +++++  L I +RT    + GR A
Sbjct: 1259 IIDKEVQLGGLNPRMERLDNDFYQLTHVMRPMIDFNIIRRFSELSIERRTHFAQKAGRRA 1318

>YDR301W (CFT1) [1129] chr4 (1063344..1067417) Component of pre-mRNA
            cleavage factor II [4074 bp, 1357 aa]
          Length = 1357

 Score = 1284 bits (3322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/1336 (47%), Positives = 916/1336 (68%), Gaps = 59/1336 (4%)

Query: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60
            MNV+D++L  TVV+  L  +FT+++ EE +V RTN+LSV+R +R  KL L  E+K  G I
Sbjct: 1    MNVYDDVLDATVVSHSLATHFTTSDYEELLVVRTNILSVYRPTRDGKLYLTDEFKFHGLI 60

Query: 61   IDMQLLPQIGSPLKMLAILSSKSKVSLVRFDPVAESLETLSLHYYHDKFVNLSTSSLKTE 120
             D+ L+PQ  SPL  L + +  +K+S+++F+ +  S++TLSLHYY  KF   S   L   
Sbjct: 61   TDIGLIPQKDSPLSCLLLCTGVAKISILKFNTLTNSIDTLSLHYYEGKFKGKSLVELAKI 120

Query: 121  SIMAVDPLFRCLLVFNEDVLAILPLKLNTEDM------------------EIDEDENGIK 162
            S + +DP   C L+FN D++A LP  +N  D                    +++   G  
Sbjct: 121  STLRMDPGSSCALLFNNDIIAFLPFHVNKNDDDEEEEDEDENIDDSELIHSMNQKSQGTN 180

Query: 163  E-PMAKRLKRNQGITSDSIIMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGN 221
                 KR K     T+ S+++  S L++  K++ DI++L NF+KPT+ +LYQP L W GN
Sbjct: 181  TFNKRKRTKLGDKFTAPSVVLVASELYEGAKNIIDIQFLKNFTKPTIALLYQPKLVWAGN 240

Query: 222  EKVLGNTMRYMVLSLDVEDEKT------TVIAELADLPNDLHTLVPLKRGYVLIGVNELL 275
              +     +Y++L+L+++  ++      T IA + +LP DLHT+VP+  G +++G NEL 
Sbjct: 241  TTISKLPTQYVILTLNIQPAESATKIESTTIAFVKELPWDLHTIVPVSNGAIIVGTNELA 300

Query: 276  YISASGALQSCIRLNTFATSSIN-TRITDNSDMNIFLSK---SSIYFYKALKRH------ 325
            ++  +G LQS + LN+FA   +  T+I +NS + I   +   +SI+   +  ++      
Sbjct: 301  FLDNTGVLQSTVLLNSFADKELQKTKIINNSSLEIMFREKNTTSIWIPSSKSKNGGSNND 360

Query: 326  DLLILIDENCRMYNIITESEGNLLTKFDCVQVPIVNEIFKNSRLPLSVCGDLNLETGR-- 383
            + L+L+D    +Y I  E+EG LL KFD  ++PIVN++ K +  P  +   LN       
Sbjct: 361  ETLLLMDLKSNIYYIQMEAEGRLLIKFDIFKLPIVNDLLKENSNPKCIT-RLNATNSNKN 419

Query: 384  --VLIGFLSGDAMFLQLKNLKVAFAAKR---------QLVETVDDDDDEYSALYGESQ-- 430
              + IGF SG+A+ L+L NLK     +           L++  DDDD+E   LY +    
Sbjct: 420  MDLFIGFGSGNALVLRLNNLKSTIETREAHNPSSGTNSLMDINDDDDEEMDDLYADEAPE 479

Query: 431  ----NNTHTRIVETQEPFDISLLDSIFNIGPLTSLTIGKVASVEPTIQRLPNPNKDEFSI 486
                 N     VET +PFDI LL S+ N+GP+TSLT+GKV+S++  ++ LPNPNK+E+S+
Sbjct: 480  NGLTTNDSKGTVETVQPFDIELLSSLRNVGPITSLTVGKVSSIDDVVKGLPNPNKNEYSL 539

Query: 487  VATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNLKIKGKDKYLVTTDADKEKSDVY 546
            VATSG G GSHLT + ++VQP IE ALKF S T+IWNLKIKG+D+YL+TTD+ K +SD+Y
Sbjct: 540  VATSGNGSGSHLTVIQTSVQPEIELALKFISITQIWNLKIKGRDRYLITTDSTKSRSDIY 599

Query: 547  QIDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSGGLYLFDVDFKRLARLTIDIEIV 606
            + D NF+  +    R+D+ T+ +    ++KRI+QVT+  LYL+D  F+RL  +  D E++
Sbjct: 600  ESDNNFKLHKGGRLRRDATTVYISMFGEEKRIIQVTTNHLYLYDTHFRRLTTIKFDYEVI 659

Query: 607  HACIIDPYILFTDARGNIKIYQLDSXXXXXXXXXXLPEALNEIIITSGSIFKSNICNKFL 666
            H  ++DPYIL T +RG+IKI++L+           LPE LNE++ITSG I KSN+CN+FL
Sbjct: 660  HVSVMDPYILVTVSRGDIKIFELEEKNKRKLLKVDLPEILNEMVITSGLILKSNMCNEFL 719

Query: 667  HGLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQIPEEMNPD 726
             GL  S +EQLLFTFVT DNQ+IFFT+ HNDRIFQLNGVDQL + L+ISTYQ+ +E+ PD
Sbjct: 720  IGLSKSQEEQLLFTFVTADNQIIFFTKDHNDRIFQLNGVDQLNESLYISTYQLGDEIVPD 779

Query: 727  PSIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKHSGKLLK--CKSHPLITGAPNNA 784
            PSIKQ+M+N+LGH  KEE+LTILTFGGEIYQY+K  +   +  +   ++   ITGAP+NA
Sbjct: 780  PSIKQVMINKLGHDNKEEYLTILTFGGEIYQYRKLPQRRSRFYRNVTRNDLAITGAPDNA 839

Query: 785  YPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVTMARWGK 844
            Y +GV+ IER+ HYFP+YNGYSV+F+TG VPYI+IKED+S  +IF+  NIP+V++  W +
Sbjct: 840  YAKGVSSIERIMHYFPDYNGYSVIFVTGSVPYILIKEDDSTPKIFKFGNIPLVSVTPWSE 899

Query: 845  NSVMCVDNIKNARVMKLDPE-CYYGNTQILRKIIIEDVVEEFETLGNIAYHERTGMYIIS 903
             SVMCVD+IKNARV  L  +  YYGN   L++I I +V+++++TL  + YHER  ++++S
Sbjct: 900  RSVMCVDDIKNARVYTLTTDNMYYGNKLPLKQIKISNVLDDYKTLQKLVYHERAQLFLVS 959

Query: 904  YTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSENSMVNDIK 963
            Y K + Y+AL EDGE ++GYD + P++ G++SG+LLINP +W +ID++D  +NS+VN+++
Sbjct: 960  YCKRVPYEALGEDGEKVIGYDENVPHAEGFQSGILLINPKSWKVIDKIDFPKNSVVNEMR 1019

Query: 964  TMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSNFKFKQLF 1023
            + +IQ+NSKT+RKRE +I G +    ED P TG   + D+ EVV EPGKPD+N+K K++F
Sbjct: 1020 SSMIQINSKTKRKREYIIAGVANATTEDTPPTGAFHIYDVIEVVPEPGKPDTNYKLKEIF 1079

Query: 1024 EEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAKSFSNLMI 1083
            +EE+ G+V+ VCE+SGRFMI QS K LVRD+QEDNS +PVAFLD+PVF+TD+KSF NL+I
Sbjct: 1080 QEEVSGTVSTVCEVSGRFMISQSQKVLVRDIQEDNSVIPVAFLDIPVFVTDSKSFGNLLI 1139

Query: 1084 IGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQNHLHVLRY 1143
            IGD+MQGF F+GFDAEPYRMI LG+S SKFQ M+LEFLVN G++ F  TD   ++HVL+Y
Sbjct: 1140 IGDAMQGFQFIGFDAEPYRMISLGRSMSKFQTMSLEFLVNGGDMYFAATDADRNVHVLKY 1199

Query: 1144 APDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGS-KTSNYIALGCQTDGSIFRMI 1202
            APDE NSLSGQRLVHC+SF + +TN+ M L+ ++ EFGS +  ++  +G Q DGS+F+++
Sbjct: 1200 APDEPNSLSGQRLVHCSSFTLHSTNSCMMLLPRNEEFGSPQVPSFQNVGGQVDGSVFKIV 1259

Query: 1203 PLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEYYHKGHSLRPTLDSQVLKKYIHL 1262
            PL+E  YRR Y++QQQ++D E+ L G N +MERL N++Y  GHS+RP LD  V++++  L
Sbjct: 1260 PLSEEKYRRLYVIQQQIIDRELQLGGLNPRMERLANDFYQMGHSMRPMLDFNVIRRFCGL 1319

Query: 1263 PITKRTTIENRVGRHA 1278
             I +R +I  + GRHA
Sbjct: 1320 AIDRRKSIAQKAGRHA 1335

>CAGL0H01463g 142420..146505 similar to tr|Q06632 Saccharomyces
            cerevisiae YDR301w CFT1 pre-mRNA 3 -end processing factor
            CF II, start by similarity
          Length = 1361

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1342 (46%), Positives = 913/1342 (68%), Gaps = 67/1342 (4%)

Query: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60
            MNV+D+++ PTVV+  + G+FT+ +  E +V RT+VLS+++  R+ +L L  E KL+G+I
Sbjct: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60

Query: 61   IDMQLLPQI-------GSPLKMLAILSSKSKVSLVRFDPVAESLETLSLHYYHDKFVNLS 113
             D+ L+P+        G  L  L + +  +K+SL+ ++ +  S+ET+SLH+Y DKF + +
Sbjct: 61   NDVALIPKHSNGSNGNGINLSYLLLSTGVAKLSLLMYNNMTSSIETISLHFYEDKFESAT 120

Query: 114  TSSLKTESIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENGI-----------K 162
               L   S + ++P     ++FN DVLAILP      +   DEDE+ I           K
Sbjct: 121  MLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGINE---DEDEDYINNDKSKINDNSK 177

Query: 163  EPMAKRLK---RNQGITSDSIIMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWC 219
            + + KR K   +N  +T  SII+  S L   +K++ DI++L  F+K T+G+LYQP LAWC
Sbjct: 178  KSLFKRKKGKTQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWC 237

Query: 220  GNEKVLGNTMRYMVLSLDVE---DEKT---TVIAELADLPNDLHTLVPLKRGYVLIGVNE 273
            GN +++     Y ++SLD++   D  T    +I+E++ LP+D HT+ P   G +++GVNE
Sbjct: 238  GNSQLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNE 297

Query: 274  LLYISASGALQSCIRLNTFATSSI-NTRITDNSDMNIFLSKSSIYFYKALKRHDL----L 328
            + ++  +G LQS + LN+++   +   R+ D S   +F +  S +       ++     +
Sbjct: 298  IAFLDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENERSVENI 357

Query: 329  ILIDENCRMYNIITESEGNLLTKFDCVQVPIVNEIFKNSRLPLSVC---GDLNLETGRVL 385
            +L DEN  ++N+  +SEG LLT+F+  ++P+  ++      P SV     D  L+T  + 
Sbjct: 358  LLFDENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIF 417

Query: 386  IGFLSGDAMFLQLKNLKVAFAAK----------RQLVETVDDDD--------DEYSALYG 427
            IGF SGDA  L+L +L  A   +          +Q     +++D        + YS    
Sbjct: 418  IGFQSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEDDDDDDDDFNLYSDEEN 477

Query: 428  ESQNNTHTRIV---ETQEPFDISLLDSIFNIGPLTSLTIGKVASVEPTIQRLPNPNKDEF 484
            +  NN + R     E+ EPF    L  + NIGP+ S+ +GKV+S+E  ++ LPNPNK E 
Sbjct: 478  DQVNNKNDRTFGTNESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQEI 537

Query: 485  SIVATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNLKIKGKDKYLVTTDADKEKSD 544
            SIV TSG G GSHL A+ ++VQP +E+ALKF S T+IWNL IKGKDK+L+TTD+ + +S+
Sbjct: 538  SIVCTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQSN 597

Query: 545  VYQIDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSGGLYLFDVDFKRLARLTIDIE 604
            +Y+ID NF   +    R+D+ TI + T+ D+KRI+QVT+  LYL+D+ F+R + +  D E
Sbjct: 598  IYEIDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYE 657

Query: 605  IVHACIIDPYILFTDARGNIKIYQLDSXXXXXXXXXXLPEALNEIIITSGSIFKSNICNK 664
            +VH  ++DPY+L T +RG+IK+++L++          LPE L E++ITSG I KSN+CN+
Sbjct: 658  VVHVSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNE 717

Query: 665  FLHGLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQIPEEMN 724
            FL G+  S+ EQLLFTFVT DNQ+IFFT+ HNDRIFQLNG+DQL+D L+ISTYQ+P+E+ 
Sbjct: 718  FLSGIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEII 777

Query: 725  PDPSIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKHSGKLLKC---KSHPLITGAP 781
            PDPSIKQIM+N+LG++ K+E+LTILTFGGEIYQYKKS     +  +      HP ITGAP
Sbjct: 778  PDPSIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHP-ITGAP 836

Query: 782  NNAYPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVTMAR 841
            +NAYP+GV+ IER+ HY PN++GYSV+F+TG  PYII+KED+S+ RIF   NIPIV+M+R
Sbjct: 837  DNAYPKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSR 896

Query: 842  WGKNSVMCVDNIKNARVMKLDPE-CYYGNTQILRKIIIEDVVEEFETLGNIAYHERTGMY 900
            WG+ SV+C+D+IKNAR+  L+ +  YYGN   +RKI I  +++ ++TL +I YHERT +Y
Sbjct: 897  WGEGSVICIDDIKNARIYSLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQLY 956

Query: 901  IISYTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSENSMVN 960
            ++SYTK I Y+A +EDG  L+GY P  PN+  +KSG+LLINP +W +ID LDL +NS+VN
Sbjct: 957  LVSYTKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLVN 1016

Query: 961  DIKTMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSNFKFK 1020
            D+K+  IQ++++T+RKRE +I+G  +   ED P TG   + DITEVV EPGKP++NFK K
Sbjct: 1017 DMKSSFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKLK 1076

Query: 1021 QLFEEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAKSFSN 1080
            ++F+E+IRG V+ V  ISGRF+I QS K +VRD+Q+DNS +PVAFLD+PVF+T  K+F N
Sbjct: 1077 EIFKEDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFGN 1136

Query: 1081 LMIIGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQNHLHV 1140
            L++IGD+MQG  FVGFDAEPYRMI LG S +KF+V+++EFLVNNG+I F+VTDR + +HV
Sbjct: 1137 LIVIGDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMHV 1196

Query: 1141 LRYAPDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSK---TSNYIALGCQTDGS 1197
            L+YAPD+ N+LSGQRLVHC+SFN+ + NN   L+ K+ EF      + ++  +  Q DGS
Sbjct: 1197 LKYAPDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQTITAQVDGS 1256

Query: 1198 IFRMIPLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEYYHKGHSLRPTLDSQVLK 1257
            I +++P+ E +YRR Y +QQQ++D E  LAG N +MER DN+YYH GHSLRP LD  ++K
Sbjct: 1257 ISKIVPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDFNIIK 1316

Query: 1258 KYIHLPITKRTTIENRVGRHAS 1279
            ++  + + +R+ I  ++G++++
Sbjct: 1317 RFKDMSMNRRSHIVQKLGKNSN 1338

>ACL196W [853] [Homologous to ScYLR354C (TAL1) - SH; ScYGR043C - SH]
           complement(18017..19021) [1005 bp, 334 aa]
          Length = 334

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 116 SLKTESIMAVDPLFRCLLVFNEDVLAILPLKLNTE---DMEIDEDENGIKEPMAKRLKRN 172
           S++ ++  AVD   R L+ F +++L ++P +++TE    +  D+D    K      L   
Sbjct: 76  SVEQQTEAAVD---RLLVEFGKEILKVVPGRVSTEVDARLSFDKDATVRKALEIISLYEQ 132

Query: 173 QGITSDSIIMPISSLHKSLKHVYDIK 198
           QG++ D +++ I+S  + ++   +++
Sbjct: 133 QGVSKDRVLIKIASTWEGIQAARELE 158

>Scas_711.13
          Length = 1769

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 502 HSTVQPHIEQALKFTSATRIWNLKIKGKDKY-LVTTDADKEKSDVYQIDRNFEPFRAQDF 560
           ++TV    ++  K  SA+ I+N K      Y L+  +A K   ++ QID  FE F+   F
Sbjct: 15  NATVALDRKRRQKLHSASLIYNPKTAATQDYDLIFDNAVKALDELIQIDPKFEVFKRSLF 74

Query: 561 RKDSRTI--GMETMDDDKRILQVTSGGLYL 588
            + S +I   ++T D+ K +    +G L L
Sbjct: 75  SETSVSIDRNVQTKDEIKALDNAINGYLLL 104

>YNL311C (YNL311C) [4302] chr14 complement(49396..51687) Protein
           that may be involved in amino acid metabolism, contains
           an cyclin-associated F-box [2292 bp, 763 aa]
          Length = 763

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 68/154 (44%), Gaps = 16/154 (10%)

Query: 140 LAILPLKLNTEDMEIDEDENGIKEPM-AKRLKRNQGITSDSIIMPISSLHKSLKHVYDIK 198
           +  LPL L  ED E+      ++ P+ A  L     +  + I+    S  K +KH+  +K
Sbjct: 359 MEFLPLFLKNEDNEL----YSLQSPITALTLDSCDVVPGNGILRLFHSYFKMVKHLSLLK 414

Query: 199 WLNNFSK------PTVGILYQPVLAWC-GNEKVLGNTMRYMVLSLDVE---DEKTTVIAE 248
             + F        P++  L     + C  NE+V+G +  +   SLD E   D+  ++   
Sbjct: 415 INSKFDLLLCSCFPSLSNLTIDCNSKCFTNEQVVGESYYFQQRSLDTEDDFDDCNSMTET 474

Query: 249 LADLPNDLHTLVPLKRGYVLIGVNELLYISASGA 282
           L + P+D   + P     V++ +N L YIS +  
Sbjct: 475 LFEAPSDSKIITPPPTSSVVLSLN-LNYISRTTG 507

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 42,316,291
Number of extensions: 1925045
Number of successful extensions: 5260
Number of sequences better than 10.0: 18
Number of HSP's gapped: 5395
Number of HSP's successfully gapped: 18
Length of query: 1280
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1167
Effective length of database: 12,684,275
Effective search space: 14802548925
Effective search space used: 14802548925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)