Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C10252g21721411171e-157
Sklu_1122.12412157691e-104
Kwal_47.181962582147262e-97
CAGL0H01485g2172166232e-82
AAL059W2172146154e-81
Scas_588.122152156137e-81
YDR302W (GPI11)2192035937e-78
YHR178W (STB5)74363720.25
CAGL0I02552g100563710.38
CAGL0A01364g10362650.74
Scas_680.2573863651.8
Kwal_23.437069263643.0
Sklu_2023.365822633.3
Scas_696.2377044633.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C10252g
         (214 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C10252g complement(878425..879078) similar to sgd|S0002710 ...   434   e-157
Sklu_1122.1 YDR302W, Contig c1122 522-1247                            300   e-104
Kwal_47.18196                                                         284   2e-97
CAGL0H01485g 146756..147409 similar to tr|Q06636 Saccharomyces c...   244   2e-82
AAL059W [128] [Homologous to ScYDR302W (GPI11) - SH] complement(...   241   4e-81
Scas_588.12                                                           240   7e-81
YDR302W (GPI11) [1130] chr4 (1067723..1068382) Protein involved ...   233   7e-78
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    32   0.25 
CAGL0I02552g 227257..230274 weakly similar to sp|P38699 Saccharo...    32   0.38 
CAGL0A01364g 135044..135355 no similarity, hypothetical start          30   0.74 
Scas_680.25                                                            30   1.8  
Kwal_23.4370                                                           29   3.0  
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         29   3.3  
Scas_696.23                                                            29   3.7  

>KLLA0C10252g complement(878425..879078) similar to sgd|S0002710
           Saccharomyces cerevisiae YDR302w GPI11 GPI11 - protein
           involved in glycosylphosphatidylinositol (GPI)
           biosynthesis, start by similarity
          Length = 217

 Score =  434 bits (1117), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 214/214 (100%), Positives = 214/214 (100%)

Query: 1   MHNRKRKTVKKTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLYW 60
           MHNRKRKTVKKTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLYW
Sbjct: 1   MHNRKRKTVKKTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLYW 60

Query: 61  FLKYTDFNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSIPC 120
           FLKYTDFNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSIPC
Sbjct: 61  FLKYTDFNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSIPC 120

Query: 121 LAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCWIS 180
           LAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCWIS
Sbjct: 121 LAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCWIS 180

Query: 181 CFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSIG 214
           CFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSIG
Sbjct: 181 CFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSIG 214

>Sklu_1122.1 YDR302W, Contig c1122 522-1247
          Length = 241

 Score =  300 bits (769), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 180/215 (83%), Gaps = 1/215 (0%)

Query: 1   MHNRKRKTVKKTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLYW 60
           M  +KR T KKTVSFSDD++L  A   NH+K  ID D PPVYVR+++  IPFHLL LLY+
Sbjct: 24  MPVKKRVTPKKTVSFSDDESLNRARQLNHKKKRIDHDNPPVYVRRTYLTIPFHLLPLLYY 83

Query: 61  FLKYTD-FNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSIP 119
           F+K +D +++++LL+  IP Q++YL+F+FNK+T+YG K L+ N  L+F++LGACLLLS+P
Sbjct: 84  FIKISDNYDVVSLLWYSIPPQILYLVFQFNKSTVYGNKILKTNLGLLFVSLGACLLLSVP 143

Query: 120 CLAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCWI 179
            + IIVLFGA F ELLKE+WLLALHCCFL++PAVY VFNC+FKVG FKKYFIS+VIGCWI
Sbjct: 144 AMVIIVLFGAFFTELLKETWLLALHCCFLSFPAVYSVFNCDFKVGVFKKYFISIVIGCWI 203

Query: 180 SCFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSIG 214
           SC VIPLDWDRDWQ WP+P+++GAYLG+F G+S+G
Sbjct: 204 SCIVIPLDWDRDWQNWPIPIVIGAYLGAFTGYSLG 238

>Kwal_47.18196
          Length = 258

 Score =  284 bits (726), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 172/214 (80%), Gaps = 1/214 (0%)

Query: 1   MHNRKRKTVKKTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLYW 60
           M  +KR   KKTVSFSDD++L+ + ++N++K   D D PPV+++K+   +P HL+ALLY+
Sbjct: 41  MAPKKRGAFKKTVSFSDDESLSRSQISNNKKHRSDTDGPPVFLKKTLLTVPVHLIALLYY 100

Query: 61  FLKYT-DFNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSIP 119
           ++K + DF+ + LLY +IP QV+YLI +FNK+T+YG+K L++   LV ITL A LLL++P
Sbjct: 101 YIKVSKDFDTVILLYALIPLQVLYLIIQFNKSTVYGRKILKIKLSLVPITLVATLLLTVP 160

Query: 120 CLAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCWI 179
           C+ II+L GAPF  LL+E+WLLA HCCFL +PAVY VFNC FKVG FKKYFIS+ IGCWI
Sbjct: 161 CMLIIILMGAPFAMLLQETWLLAAHCCFLAFPAVYSVFNCEFKVGIFKKYFISIAIGCWI 220

Query: 180 SCFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSI 213
           SC VIPLDWDRDWQ+WP+PLIVGAY+G+F G+S+
Sbjct: 221 SCIVIPLDWDRDWQSWPIPLIVGAYVGAFFGYSL 254

>CAGL0H01485g 146756..147409 similar to tr|Q06636 Saccharomyces
           cerevisiae YDR302w GPI11, start by similarity
          Length = 217

 Score =  244 bits (623), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 168/216 (77%), Gaps = 4/216 (1%)

Query: 1   MHNRKRKTVK-KTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLY 59
           M  +KR  +K K+VSFSDD  +T    N+H +   + + PPV++RK+W  IP+HL+AL+Y
Sbjct: 1   MPVKKRTPLKHKSVSFSDD--ITQTQHNHHHRKKQNGERPPVFIRKTWLTIPWHLIALVY 58

Query: 60  WFLK-YTDFNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSI 118
            ++K + ++N   LL  ++P Q++Y IF+FNK TIYG KRL+ N+ L  I++ AC++LSI
Sbjct: 59  IYVKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACIVLSI 118

Query: 119 PCLAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCW 178
           P + II+LFGAP +ELL E+WLLALHC FL YPAVY V NC+FKVG +K+YFI +V+GCW
Sbjct: 119 PVVVIIILFGAPLLELLWETWLLALHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCW 178

Query: 179 ISCFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSIG 214
           ISC VIPLDWDRDWQAWP+P+++GAYLG+F+GF+ G
Sbjct: 179 ISCVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYG 214

>AAL059W [128] [Homologous to ScYDR302W (GPI11) - SH]
           complement(245111..245764) [654 bp, 217 aa]
          Length = 217

 Score =  241 bits (615), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 111/214 (51%), Positives = 156/214 (72%), Gaps = 4/214 (1%)

Query: 1   MHNRKRKTVKKT-VSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLY 59
           M  +KR   KK  VSFSDD  L+        K      +PPVYVR++W  IPFHL+ L Y
Sbjct: 1   MTTKKRPVGKKKFVSFSDDDALSRTG--RLPKNLPQHGSPPVYVRRTWQTIPFHLIVLSY 58

Query: 60  WFLKYTD-FNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSI 118
           WF+K+++ +++    ++++P QV+YL  +FN  T+YG K L+LN+ L+ ++   C+LL+I
Sbjct: 59  WFIKHSNGYDVRKCTWLLVPCQVLYLALQFNPATVYGNKILKLNYALLAVSGVTCILLTI 118

Query: 119 PCLAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCW 178
           PC+ ++VLFGAPF+E+L ++WLL+LHCC L+YPAVY V N +FKVG+FKKYFIS+ +GCW
Sbjct: 119 PCMLLVVLFGAPFLEMLDKTWLLSLHCCVLSYPAVYSVLNSDFKVGFFKKYFISIAVGCW 178

Query: 179 ISCFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFS 212
           ISC  IPLDWDR WQ WP+PL+VGA LG+  G++
Sbjct: 179 ISCLAIPLDWDRPWQEWPIPLVVGAQLGAMFGYT 212

>Scas_588.12
          Length = 215

 Score =  240 bits (613), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 167/215 (77%), Gaps = 4/215 (1%)

Query: 1   MHNRKRKTVKKTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLYW 60
           M  +KR  VKK V+FSDD  +       HRK ++  + PPVYVRK+  +IP+HLL LLYW
Sbjct: 1   MATKKRNQVKKKVTFSDDNTMVR---QTHRKKNVGHEHPPVYVRKNIMIIPWHLLVLLYW 57

Query: 61  FLKYT-DFNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSIP 119
           +L    D+    LLY +IPTQ++YLIF+FN+ T+YG K ++LN  LVFI++G  +LLSIP
Sbjct: 58  YLYVALDYPTDKLLYALIPTQLLYLIFQFNQYTVYGNKIIKLNVPLVFISMGCTILLSIP 117

Query: 120 CLAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCWI 179
            L +I+LFGAPF+E LKES LLALHCCFL YPA+Y VFNC+FKVG +KKYFI++V+G W+
Sbjct: 118 ALVLIILFGAPFLEKLKESLLLALHCCFLAYPAMYSVFNCDFKVGLWKKYFITIVVGAWL 177

Query: 180 SCFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSIG 214
           SC VIPLDWDR WQAWPVP IVG+YLG+F+G++IG
Sbjct: 178 SCVVIPLDWDRPWQAWPVPAIVGSYLGAFVGYTIG 212

>YDR302W (GPI11) [1130] chr4 (1067723..1068382) Protein involved in
           glycosylphosphatidylinositol (GPI) biosynthesis, with
           similarity to GPI-anchor biosynthesis protein PIG-F [660
           bp, 219 aa]
          Length = 219

 Score =  233 bits (593), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 113/203 (55%), Positives = 151/203 (74%), Gaps = 4/203 (1%)

Query: 14  SFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLI-PFHLLALLYWFL-KYTDFNLLA 71
           SFSDD  LT     N  K ++D D PPVYVRK+  +  P+HL+ALLY+++   ++FN + 
Sbjct: 16  SFSDDTTLTTHQ--NREKKNVDHDRPPVYVRKTPLMTFPYHLVALLYYYVFVSSNFNTVK 73

Query: 72  LLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSIPCLAIIVLFGAPF 131
           LL  +IPTQV YL+ +FNK T+YG K +++N+ L  I LG   LLS P + + +LFGAP 
Sbjct: 74  LLSFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSFPTMLLTILFGAPL 133

Query: 132 VELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCWISCFVIPLDWDRD 191
           ++LL E+WLL+LH  FL YPAVY VFNC+FKVG +KKYFI +V+G WISC VIPLDWDRD
Sbjct: 134 MDLLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRD 193

Query: 192 WQAWPVPLIVGAYLGSFIGFSIG 214
           WQ WP+P++VG YLG+ +G++IG
Sbjct: 194 WQNWPIPIVVGGYLGALVGYTIG 216

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
           transcriptional activator of multidrug resistance genes
           such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 32.3 bits (72), Expect = 0.25,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 9/63 (14%)

Query: 92  TIYGKKRLRLNWLLVFITLGAC-LLLSIPCLAIIVLFGAPF-----VELLK---ESWLLA 142
           T+Y K+ L LNW+ +F TL  C  +L   C   I L  +       VE+L+   E W+ A
Sbjct: 625 TLYKKRLLPLNWITLFRTLTICNTILYCLCQWSIDLIESKIEIQQCVEILRHFGERWIFA 684

Query: 143 LHC 145
           + C
Sbjct: 685 MRC 687

>CAGL0I02552g 227257..230274 weakly similar to sp|P38699
           Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
           protein, hypothetical start
          Length = 1005

 Score = 32.0 bits (71), Expect = 0.38,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 9/63 (14%)

Query: 92  TIYGKKRLRLNWLLVFITLGAC-LLLSIPCLAIIVLFGAPF-----VELLK---ESWLLA 142
           T+Y +K L LNW+ +F TL  C  +L   C   I L  +       VE+L+   E W+ A
Sbjct: 887 TLYKEKLLPLNWITLFRTLTICNTILYCLCQWSIDLVASTIEIQQCVEILQHFGEKWVFA 946

Query: 143 LHC 145
           + C
Sbjct: 947 MKC 949

>CAGL0A01364g 135044..135355 no similarity, hypothetical start
          Length = 103

 Score = 29.6 bits (65), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 5/62 (8%)

Query: 117 SIPCLAIIVLFGAPFVELLKES----WLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFIS 172
           + PC A++V+FG P   +LK      W LALHC       V+  F   F    F + F+ 
Sbjct: 20  TCPCFAVLVIFGQP-TTMLKSPHKMIWALALHCILCHDLPVFPSFLKFFPFWQFVRGFLP 78

Query: 173 VV 174
           ++
Sbjct: 79  LI 80

>Scas_680.25
          Length = 738

 Score = 29.6 bits (65), Expect = 1.8,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 92  TIYGKKRLRLNWLLVFITLGAC-LLLSIPCLAIIVLFGAPF-----VELLK---ESWLLA 142
           T+Y +K L LNW+ +F TL  C  +L   C   I L  +       VE+L+   E W+ A
Sbjct: 620 TLYKEKLLPLNWITLFRTLTICNTILYCLCQWSIDLIESQIEIQQCVEILQHFGEKWIFA 679

Query: 143 LHC 145
             C
Sbjct: 680 SRC 682

>Kwal_23.4370
          Length = 692

 Score = 29.3 bits (64), Expect = 3.0,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 92  TIYGKKRLRLNWLLVFITLGAC-LLLSIPCLAIIVLFGAPF-----VELLK---ESWLLA 142
           T+Y KK   LNW+ +F TL  C  +L   C   I L  +       VE+L+   E W+ A
Sbjct: 574 TLYKKKLQPLNWITLFRTLTICNTMLYCLCQWSIDLIESKIEIQQCVEILQHFGEKWVFA 633

Query: 143 LHC 145
             C
Sbjct: 634 AKC 636

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 28.9 bits (63), Expect = 3.3,   Method: Composition-based stats.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 92  TIYGKKRLRLNWLLVFITLGAC 113
           T+Y KK L LNW+ +F TL  C
Sbjct: 540 TLYKKKLLPLNWITLFRTLTIC 561

>Scas_696.23
          Length = 770

 Score = 28.9 bits (63), Expect = 3.7,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 132 VELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVI 175
           ++LLKES  + +H  ++ Y     ++  N +V Y+K  FI ++I
Sbjct: 131 IDLLKESKFVKIHKIYMLYKECLPIYKQNNQVKYYK--FIEIMI 172

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.332    0.147    0.502 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,628,336
Number of extensions: 335057
Number of successful extensions: 1078
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1065
Number of HSP's successfully gapped: 26
Length of query: 214
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 117
Effective length of database: 13,238,163
Effective search space: 1548865071
Effective search space used: 1548865071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 59 (27.3 bits)