Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C09394g1184116645320.0
AAL181C122167110761e-126
Kwal_14.242112057049351e-107
YJL076W (NET1)11895446901e-74
Scas_675.2413195136051e-63
CAGL0H02783g17855015349e-55
Scas_711.389983994932e-50
CAGL0B03179g9272592744e-24
YKR010C (TOF2)7711652361e-19
Scas_684.2548260695.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C09394g
         (1166 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharo...  1750   0.0  
AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF...   419   e-126
Kwal_14.2421                                                          364   e-107
YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein r...   270   1e-74
Scas_675.24                                                           237   1e-63
CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...   210   9e-55
Scas_711.38                                                           194   2e-50
CAGL0B03179g complement(309816..312599) weakly similar to sp|P47...   110   4e-24
YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein t...    96   1e-19
Scas_684.25                                                            31   5.8  

>KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharomyces
            cerevisiae YJL076w NET1 required for rDNA silencing and
            nucleolar integrity, start by similarity
          Length = 1184

 Score = 1750 bits (4532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 920/1166 (78%), Positives = 920/1166 (78%)

Query: 1    MFKLQVVLVPAGANRSFNFGLPSVSSESSQFIXXXXXXXXXXXXXXXXLANNIPAQNGIG 60
            MFKLQVVLVPAGANRSFNFGLPSVSSESSQFI                LANNIPAQNGIG
Sbjct: 1    MFKLQVVLVPAGANRSFNFGLPSVSSESSQFILPVQQQVLQQGGNAPQLANNIPAQNGIG 60

Query: 61   ALDPNVSTNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLSTE 120
            ALDPNVSTNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLSTE
Sbjct: 61   ALDPNVSTNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLSTE 120

Query: 121  LEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESLYSSKRRKLNN 180
            LEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESLYSSKRRKLNN
Sbjct: 121  LEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESLYSSKRRKLNN 180

Query: 181  GNSQQNTSTGATLDQPVTVAKRRPQALKNSALRISTPLAHQIYPPPSQRNPKQVNSXXXX 240
            GNSQQNTSTGATLDQPVTVAKRRPQALKNSALRISTPLAHQIYPPPSQRNPKQVNS    
Sbjct: 181  GNSQQNTSTGATLDQPVTVAKRRPQALKNSALRISTPLAHQIYPPPSQRNPKQVNSDYEE 240

Query: 241  XXXXXXXXXXKSILPPPTVXXXXXXXXXXXXAQKRLKINGSEDTVSKSETVDPSKAKQQR 300
                      KSILPPPTV            AQKRLKINGSEDTVSKSETVDPSKAKQQR
Sbjct: 241  DEYGDDEIGDKSILPPPTVPQSPPIRISSSIAQKRLKINGSEDTVSKSETVDPSKAKQQR 300

Query: 301  LPSGTPMKPMNVIETPNRPGFLAMPQQAQHLLRINSTPVVTNKRITSGMLRIPEPRISEM 360
            LPSGTPMKPMNVIETPNRPGFLAMPQQAQHLLRINSTPVVTNKRITSGMLRIPEPRISEM
Sbjct: 301  LPSGTPMKPMNVIETPNRPGFLAMPQQAQHLLRINSTPVVTNKRITSGMLRIPEPRISEM 360

Query: 361  ERTMHEGLSSPAAGLLPPKSAKIPMKKQYIPDEHDSSSSEGEFTEDKESVPVRVNSKAPL 420
            ERTMHEGLSSPAAGLLPPKSAKIPMKKQYIPDEHDSSSSEGEFTEDKESVPVRVNSKAPL
Sbjct: 361  ERTMHEGLSSPAAGLLPPKSAKIPMKKQYIPDEHDSSSSEGEFTEDKESVPVRVNSKAPL 420

Query: 421  PVSVQSRAPSSIADDNGSPTKKSPLDATKRMNVKVADLPPQRKSSLEAKVEKLAKNASEL 480
            PVSVQSRAPSSIADDNGSPTKKSPLDATKRMNVKVADLPPQRKSSLEAKVEKLAKNASEL
Sbjct: 421  PVSVQSRAPSSIADDNGSPTKKSPLDATKRMNVKVADLPPQRKSSLEAKVEKLAKNASEL 480

Query: 481  VADNHLSSNTTRKEGFXXXXXXXXXXXXXXXDTVCIHPTDRMDGSFQKSXXXXXXKGSKF 540
            VADNHLSSNTTRKEGF               DTVCIHPTDRMDGSFQKS      KGSKF
Sbjct: 481  VADNHLSSNTTRKEGFSESESENAESENEANDTVCIHPTDRMDGSFQKSELLELLKGSKF 540

Query: 541  DVPPAFRRAAGALQENDINKRSRKPYLTVLNKDIDNSEPDPRNILPSKLPRQAAQKAAQF 600
            DVPPAFRRAAGALQENDINKRSRKPYLTVLNKDIDNSEPDPRNILPSKLPRQAAQKAAQF
Sbjct: 541  DVPPAFRRAAGALQENDINKRSRKPYLTVLNKDIDNSEPDPRNILPSKLPRQAAQKAAQF 600

Query: 601  ISTGTSRRPLQXXXXXXXXXXXXXXXXXXXXXIETENSDNSMDEVNLKRLNVHPLRPVMV 660
            ISTGTSRRPLQ                     IETENSDNSMDEVNLKRLNVHPLRPVMV
Sbjct: 601  ISTGTSRRPLQSSSSSSSSSAVVSEEPSSDSDIETENSDNSMDEVNLKRLNVHPLRPVMV 660

Query: 661  PVEETQDTNELNKTXXXXXXXXXXXXXXXXDEPGNEEGKAAGSENPQKSESKVDQMKSVS 720
            PVEETQDTNELNKT                DEPGNEEGKAAGSENPQKSESKVDQMKSVS
Sbjct: 661  PVEETQDTNELNKTNSANSSSSSSEESESADEPGNEEGKAAGSENPQKSESKVDQMKSVS 720

Query: 721  QPAKVTSSRLITLKPVDTPKEVTPSPSMQLHDKIDRQLSPSPTRNKKDYISPEFIEDSDG 780
            QPAKVTSSRLITLKPVDTPKEVTPSPSMQLHDKIDRQLSPSPTRNKKDYISPEFIEDSDG
Sbjct: 721  QPAKVTSSRLITLKPVDTPKEVTPSPSMQLHDKIDRQLSPSPTRNKKDYISPEFIEDSDG 780

Query: 781  DAENENITLSQRSQNNKENTEPSFNKENSEDIKLKKITPSVLXXXXXXXXXXXXXXXXXX 840
            DAENENITLSQRSQNNKENTEPSFNKENSEDIKLKKITPSVL                  
Sbjct: 781  DAENENITLSQRSQNNKENTEPSFNKENSEDIKLKKITPSVLKKKQEAEQRRLQREAARK 840

Query: 841  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTTKKGPKETKK 900
                                                            STTKKGPKETKK
Sbjct: 841  AKEEEKERRRADREAARRAKQEEQERKRAEREAAKRARQEEIARKKAESTTKKGPKETKK 900

Query: 901  NGDITPKVIERAETESSANGTPAKKAAESGVQSPDSPSRASKLDELRNKFAVGKASITGP 960
            NGDITPKVIERAETESSANGTPAKKAAESGVQSPDSPSRASKLDELRNKFAVGKASITGP
Sbjct: 901  NGDITPKVIERAETESSANGTPAKKAAESGVQSPDSPSRASKLDELRNKFAVGKASITGP 960

Query: 961  PKKTINKPIKLQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMTKKTRRGIVDTPKGLIG 1020
            PKKTINKPIKLQL                             MTKKTRRGIVDTPKGLIG
Sbjct: 961  PKKTINKPIKLQLSSTSTSNTSSDSDGSSGSESSTSSENETSMTKKTRRGIVDTPKGLIG 1020

Query: 1021 SISKSAIDKGTSDLENAPQSTQQSNSSPIKVPVTKMMEYASPTANKSSAKSVLVSPPSKA 1080
            SISKSAIDKGTSDLENAPQSTQQSNSSPIKVPVTKMMEYASPTANKSSAKSVLVSPPSKA
Sbjct: 1021 SISKSAIDKGTSDLENAPQSTQQSNSSPIKVPVTKMMEYASPTANKSSAKSVLVSPPSKA 1080

Query: 1081 TKVNRQTXXXXXXXXXXXXXXRGVPEVKEKSAAKTVXXXXXXXXXXXXXXXXXXXXXXXX 1140
            TKVNRQT              RGVPEVKEKSAAKTV                        
Sbjct: 1081 TKVNRQTLSRNSLSSLSDLVSRGVPEVKEKSAAKTVPQPESSSLSEEDELQSGTDDSSDS 1140

Query: 1141 XXXXXXXXXXXXXNFINAKSASKALG 1166
                         NFINAKSASKALG
Sbjct: 1141 DSDSDSSDDGSDTNFINAKSASKALG 1166

>AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF2)
           - SH] (20056..23721) [3666 bp, 1221 aa]
          Length = 1221

 Score =  419 bits (1076), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 288/671 (42%), Positives = 383/671 (57%), Gaps = 50/671 (7%)

Query: 1   MFKLQVVLVPAGANRSF-NFGLPSVSSESSQFIXXXXXXXXXXXXXXXXLANNIPAQNGI 59
           M+KLQVVLVP          GLP+ S ++S F                         +GI
Sbjct: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSIA----GGRGEFSSGI 56

Query: 60  GALDPNVSTNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLST 119
           G    N S N  YLS  + +HI R + +KFL FTKPTN+LY+L+ EI++KC K+YP L+ 
Sbjct: 57  G----NTSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAE 112

Query: 120 ELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESLYSSKRRKLN 179
           E EI TLQDV+ECDLDPDFVVKDVFN+ NTVRV+LRND+D E+  DR  ++Y  K+RKLN
Sbjct: 113 EPEIVTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLD-EAAGDR--TIY-MKKRKLN 168

Query: 180 NGNSQQNTSTGATLDQPVTVAKRRPQALKNSALRISTPLAHQIYPPPSQRNPKQVNSXXX 239
            G +    + G+     + VAK+R  ++K SALR+STPLA+QIYPPP++   KQVNS   
Sbjct: 169 TGAAGVPAAGGSVQAAVLNVAKKR-ASIKTSALRVSTPLANQIYPPPTK---KQVNS--- 221

Query: 240 XXXXXXXXXXXKSILPPPTVXXXXXXXXXXXXAQKRLKINGSEDTVSKSETVDPSKAKQQ 299
                      KSILPPP               QKR+ +N  ++ VSKSETVDP+K++QQ
Sbjct: 222 --DFEDDDVADKSILPPPPPQSPPIRISSGMD-QKRINMN--DNAVSKSETVDPNKSRQQ 276

Query: 300 RLPSGTPMKPMNVIETPNR-----PGFLAMPQQAQHLLRINSTPVVTNKRITSGMLRIPE 354
           RLPSGTPM+P++++ETPNR     P  L+    +Q   +  +TP++TN RITSGMLRIPE
Sbjct: 277 RLPSGTPMRPVSMVETPNRVSLTGPTVLSESTVSQ---KSTATPIITNIRITSGMLRIPE 333

Query: 355 PRISEMERTMHEGLSSPAAGLLPPKSAKIPMKKQYIP---DEHDSSSSEGEFTEDKESVP 411
           PR+SE+E+ + EG +SPA   LP + ++IPMKK Y P    + D SSS     ++  +VP
Sbjct: 334 PRLSEVEKELKEGPASPAVD-LPARPSRIPMKKPYNPSMQQDEDLSSSSSSTEDNVPAVP 392

Query: 412 VRVNSKAPLPVSVQSRAPSSIADDNGSPTKKSPLDATKRMNVKVADLPPQRKSSLEAKVE 471
                +   P     ++ S+IADD GSPTKKS  +   + N+ + +LP  RKSSLE KV 
Sbjct: 393 YENELERSGPTMATRQSSSTIADDQGSPTKKSRFE---KNNIGLVELPSPRKSSLEKKVS 449

Query: 472 KLAKNASELVADNHLSSNTTRKEGFXXXXXXXXXXXXXXXDTVCIHPTDRMDGSFQKSXX 531
           KL K  +        +   TRK+ F                 V   P  + + SFQKS  
Sbjct: 450 KLNKGLASDKGHEDSTGGITRKDHFSDEESEASQNGS----VVVNRPETQREKSFQKSEL 505

Query: 532 XXXXKGSKFDVPPAFRRAAGALQENDINK-RSRKPYLTVLNKDIDNSEPDPRNILPSKLP 590
                  +FD+PP F+ +A   +    N+ R +KPY+TVLNKDIDNS PDPRNI+P +  
Sbjct: 506 LKIFNSKRFDLPPRFKNSASEDEPTSSNQSRKKKPYVTVLNKDIDNSSPDPRNIIPRRTQ 565

Query: 591 RQAAQKAAQFISTGTSRRPLQXXXXXXXXXXXXXXXXXXXXXIETENSDNSMDEVN-LKR 649
           R AAQKAAQ IS+GTSR                            +N    + E N LK+
Sbjct: 566 RHAAQKAAQSISSGTSR----SNVFSGEEKNKYSEENQGDNIASDDNEGVYVHESNALKK 621

Query: 650 LNVHPLRPVMV 660
           LNVHPL+  +V
Sbjct: 622 LNVHPLKESVV 632

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 55/106 (51%), Gaps = 8/106 (7%)

Query: 1005 KKTRRGIVDTPKGLIGSISKSAIDKGTSDLENAPQSTQQSNSSPIKVPVTKMMEYASPTA 1064
            KK RRGIV  PKG + +  K      +S+LE  PQSTQ  N +    P+TK++++ SP  
Sbjct: 1045 KKPRRGIVQPPKGSVSAPVKHVPQSLSSELEGVPQSTQIPNEATNTAPLTKLLDHISPP- 1103

Query: 1065 NKSSAKSVLVSPPSKATKVNRQTXXXXXXXXXXXXXXRGVPEVKEK 1110
              S+AK++     S+    ++ T              RGVP+V+EK
Sbjct: 1104 --STAKTIT----SRGVTESKGT-SNRSLSSLSDLASRGVPDVREK 1142

>Kwal_14.2421
          Length = 1205

 Score =  364 bits (935), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 276/704 (39%), Positives = 385/704 (54%), Gaps = 120/704 (17%)

Query: 1   MFKLQVVLVPAGANRSFNFGLPSV--SSESSQFIXXXXXXXXXXXXXXXXLANNIPAQNG 58
           M+KLQVVLVP G +    F LP+   ++++SQ                  L  NI   NG
Sbjct: 1   MYKLQVVLVPPGFS-GVTFALPTNPPTADNSQV-----------------LPPNI-VSNG 41

Query: 59  ---IGALDPNV-----STNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQLSQEILDKC 110
              +GA  P +     S+N  ++SSF ++H + PKL+K L FTKPTNTL+ L++EI+++C
Sbjct: 42  STILGANRPELGQQTGSSNNLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERC 101

Query: 111 NKIYPNLSTELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESL 170
           +KIYPNL+  +E+ TLQD +ECDLDPD++VKDVFNV N VR +LRND++L    D+ ++L
Sbjct: 102 DKIYPNLTRPVEVLTLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSD--DQSQTL 159

Query: 171 YSSKRRKLN----NGNSQQNTSTGATLDQPVTVAKRRPQALKN-SALRISTPLAHQIYPP 225
           YS+KRR+LN    N + Q N          + +AK+RP  L+N SA+R+STPLA+QIYPP
Sbjct: 160 YSAKRRRLNSSLPNPSGQPNV---------LHIAKKRPHMLRNSSAMRVSTPLANQIYPP 210

Query: 226 PSQRNPKQVNSXXXXXXXXXXXXXXKSILPPPTVXXXXXXXXXXXXAQKRLKINGSEDTV 285
            + R   QVNS              +S+LPPP              + K  KIN +EDTV
Sbjct: 211 ATGR---QVNS-----DYEDDDVGDRSVLPPPQPQSQPIRISSGVGSAK--KINFNEDTV 260

Query: 286 SKSETVDPSKAKQQRLPSGTPMKPMN--VIETPNRPGFLAMPQQAQHLL-RINSTPVVTN 342
           S+SE VDP K++QQRLPSGTPM+ +N     TPNR   L    QA  +  + ++TPV TN
Sbjct: 261 SRSEAVDPDKSRQQRLPSGTPMRHINNGTATTPNRLNVLDGTLQADEVTNKSSATPVATN 320

Query: 343 KRITSGMLRIPEPRISEMERTMHEGLSSPAAGLLPPKSAKIPMKKQYIP---DEHDSSSS 399
           KRITSGMLRIPEP+ISE+E  + +G +SP+A  LPP+  +IPMKKQ  P   DE  S SS
Sbjct: 321 KRITSGMLRIPEPKISEIENELRQGPASPSA-ELPPRPDRIPMKKQQFPQSDDEEQSQSS 379

Query: 400 EGE---FTEDKESVPVRVNSKAPLPVSVQSRAPSSIADDNGSPTKKSPLDATKRMNVKVA 456
             E     E   ++ +   SK   P + +    +SIAD+NGSP K    D  K  NV +A
Sbjct: 380 GNENPTLMEKANNLILEHGSK---PSASRQ---TSIADNNGSPIK----DGNKIGNVNLA 429

Query: 457 DLPP-----QRKSSLEAKVEKLAKNASEL----------VADNHLSSNTTRKEGFXXXXX 501
           +LP       RKSSLE+KVE L K+A+ L          + DN  S+N  RK+ F     
Sbjct: 430 ELPQVGRRITRKSSLESKVESLIKSATNLSEEARGDLQRLKDN--SNNAIRKDTFSEEDD 487

Query: 502 XXXXXXXXXXDTVCI-HPTDRMDGSFQKSXXXXXXKGSKFDVPPAFRRAAGALQENDINK 560
                     DTV + H  +  + SFQKS      KG+KF++P  F         N  + 
Sbjct: 488 MEGQLPEDPNDTVRVNHLDNSGNSSFQKSELLSMLKGNKFNIPSDF---------NKRSL 538

Query: 561 RSRKPYLTVLNKDIDNSEPDPRNILPSKLPRQAAQKAAQFISTGTSRRPLQXXXXXXXXX 620
           RS   Y+      I  +  D +N    +  R AA+KA++ +S+G S+             
Sbjct: 539 RSNTGYVETGGNKISINSTDAKN---QRQQRGAARKASRLLSSGKSK-----------DQ 584

Query: 621 XXXXXXXXXXXXIETENSDNS----MDEVNLKRLNVHPLRPVMV 660
                       IET+ S+N     ++   L++LN+HPL+  ++
Sbjct: 585 EESSESDEESSGIETDRSENGRVNVVENQALRKLNIHPLKERVI 628

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 76/174 (43%), Gaps = 19/174 (10%)

Query: 1005 KKTRRGIVDTPKGLIGSISKSAIDKGTSDLENAPQSTQQSNSS------PIKVPVTKMME 1058
            +K+RRGIVDTPKG I S+ K       S +ENAPQSTQQ + S      P KVPVT+MME
Sbjct: 1020 RKSRRGIVDTPKGAIISLPKRGKKGDLSGVENAPQSTQQGHVSTSAEKTPAKVPVTRMME 1079

Query: 1059 YASPTANKSSAKSVLVSPPSKATKVNRQTXXXXXXXXXXXXXXRGVPEVKE------KSA 1112
             +SP +  +S      SPP  + K   ++              RGVPEVK+      K  
Sbjct: 1080 MSSPVSLSNSN-----SPPKASKKP--ESKPSRSLSSLSDLVSRGVPEVKDLPVNGSKVP 1132

Query: 1113 AKTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFINAKSASKALG 1166
              +                                      NFI+AKSASKALG
Sbjct: 1133 LNSTSEKGESNNDQSQEESDQSDSEEDSDSSTDDSSDGQGSNFISAKSASKALG 1186

>YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein
           required for rDNA chromatin silencing and nucleolar
           integrity, has similarity to Tof2p, component of RENT
           complex [3570 bp, 1189 aa]
          Length = 1189

 Score =  270 bits (690), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 216/544 (39%), Positives = 278/544 (51%), Gaps = 112/544 (20%)

Query: 1   MFKLQVVLVPAG--ANRSFNFGLPSVSSESSQFIXXXXXXXXXXXXXXXXLANNIPAQNG 58
           M+KLQVVLVP    A     FG     +ESSQ +                 AN   A   
Sbjct: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSA--- 57

Query: 59  IGALDPNVSTNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLS 118
                 NVS        F  S+  + + +KFL+FTKPTNTL  LS EI+DKC K+YP+L 
Sbjct: 58  ------NVS--------FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQ 103

Query: 119 TELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDL-ESNPDRQESLYSS-KRR 176
            ++EI +LQD   CDLDPDF+VKDVFNV N VRVIL+N++DL +S P    SLY S KR 
Sbjct: 104 EDIEILSLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAP---VSLYKSVKRS 160

Query: 177 KLNNGNSQQN-------TSTGATLDQPVTVAKRRP----------QALKNSALRISTPLA 219
           KLNNG+ Q         +S+G      + +AK+RP          ++  N ++R+STPLA
Sbjct: 161 KLNNGSPQSVQPQQQIPSSSGV-----LRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLA 215

Query: 220 HQIYPPPSQRNPKQVNSXXXXXXXXXXXXXXKSILPPPTVXXXXX-XXXXXXXAQKRLKI 278
            QIYPPPS +                     +S LPPPT              A K++K 
Sbjct: 216 RQIYPPPSSK------IVSNNSDDEDEDIGERSFLPPPTQPQSPPIRISSGIDAGKKIKS 269

Query: 279 N-GSEDTVSKSETVDPSKAKQQRLPSGTPMKPMNVIETPNRPGFLAMPQQAQHLLR---- 333
           +   ED VS+S TVDP K KQQRL SGTP+  M+ + TPNR         ++H  +    
Sbjct: 270 SIVEEDIVSRSATVDPDKTKQQRLLSGTPI--MSTM-TPNRVTLTGQRVVSEHAHKNELV 326

Query: 334 ----------------------INSTPVVTNKRITSGMLRIPEPRISEMERTMHEGLSSP 371
                                 IN  P VT  RITSGML+IPEPRISE+E+ + EG SSP
Sbjct: 327 FSASASSSSFANGGTAAVTAQDINRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSP 386

Query: 372 AAGLLPPKSAKIPMKKQYIPDEHDSSSSEGEFTEDKESVPVRVNSKAPLPVSVQSRAPSS 431
           A+ +LP K+AKIPMKK Y+ +  +  S +   +E++E+     +SKA L      R+ SS
Sbjct: 387 AS-ILPAKAAKIPMKKPYLENGENYESDDSSSSENQETPETEPHSKASL-----QRSQSS 440

Query: 432 IADDNGSPTKKSPLDATKRMNVKVADLP-----------------------PQRKSSLEA 468
           IAD+NGSP K SPL      NV +A+LP                       P RKSSLE 
Sbjct: 441 IADNNGSPVKNSPLGDAMPHNVHLAELPKASNTSITKSSNGESWGKQQEHQPPRKSSLET 500

Query: 469 KVEK 472
            VEK
Sbjct: 501 IVEK 504

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 82/166 (49%), Gaps = 13/166 (7%)

Query: 513 TVCIHPTDRMDGSFQKSXXXXXXKGSKFDVPPAFRRAAGALQENDINKRSRKPYLTVLNK 572
           TV I P D    SF KS      +G   D+P  F+   G       N ++ KPY TVLNK
Sbjct: 603 TVRIVPQDSDSSSFPKSDLFKMIEGDDTDLPQWFK---GKNSRTSGNSKNSKPYTTVLNK 659

Query: 573 DIDNSEPDPRNILPSKLPRQAAQKAAQFISTGTSRRPLQXXXXXXXXXXXXXXXXXXXXX 632
           DIDNS+PDPRNILP + PR AA++AAQ ++        Q                     
Sbjct: 660 DIDNSKPDPRNILPQRTPRSAAKRAAQLLAGAKKNEVPQ--KSTEDSSSAASTDDESESG 717

Query: 633 IETE-NSDNSMDEVNL-------KRLNVHPLRPVMVPVEETQDTNE 670
           IET+ +SD+     N+       K +++H L+  +VPV++++  N+
Sbjct: 718 IETDFSSDDDFKRKNMSVPNNGPKDISLHSLKGSVVPVKDSKIINK 763

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 15/109 (13%)

Query: 1005 KKTRRGIVDTPKGLIGSISKSAIDKGTSDLEN-APQSTQQSNSSPIKVPVTKMMEYASPT 1063
            +K RR +V+TP+  + S SK         +E  +P   ++ N++P K+PVT++M+ +SP 
Sbjct: 1008 RKARRVVVNTPREPVRSSSK---------IEAPSPSVNKKINATPDKIPVTQLMDMSSPP 1058

Query: 1064 ANKSSAKSVLVSPPSKATKVNRQTXXXXXXXXXXXXXXRGVPEVKEKSA 1112
            + KS   S   +P S    + R+               RG+P+VKEK++
Sbjct: 1059 SVKSKTTS---NPSSILHDLPRKV--RPSLSSLSDLVSRGIPDVKEKTS 1102

>Scas_675.24
          Length = 1319

 Score =  237 bits (605), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 192/513 (37%), Positives = 258/513 (50%), Gaps = 94/513 (18%)

Query: 1   MFKLQVVLVPAGANRSFN-FGLPSVSSESSQFIXXXXXXXXXXXXXXXXLANNIPAQ--N 57
           M+KLQVVLVP  A  S      P+   +SSQF+                 +N +P    N
Sbjct: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNG------------SNILPKSMIN 48

Query: 58  GIGALDPNVSTN-TAYLSSFMTSHIT-RPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYP 115
           G G +    S N T  + S +  + T + K KKFL FTKPTN+L  LS E+L KC K+YP
Sbjct: 49  GTGDMSMQFSNNNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYP 108

Query: 116 NLSTELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESLYSS-K 174
           NL+ +LEI TLQD++ CDLDPDF VKD+FN+ N V V+++N++D+ S      S+Y + K
Sbjct: 109 NLNEDLEILTLQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSS--AGSTSIYRNFK 166

Query: 175 RRKLNNGNSQQ------NTSTGATLDQPVTVAKRRPQALK---------NSALRISTPLA 219
           R+KLNNG +QQ        STGA     + + K+RP             NS LRISTPLA
Sbjct: 167 RQKLNNGGAQQLKTSPRTQSTGA-----LKIEKKRPSTSSGIRNPTTNGNSTLRISTPLA 221

Query: 220 HQIYPPPSQRNPKQVNSXXXXXXXXXXXXXXKSILPPPTVXXXXXXXXXXXXAQ-KRLKI 278
           +QIYP P       +                +S LPPP+              Q KR++ 
Sbjct: 222 NQIYPSP-------IMKMTNNSDDERDDVRERSFLPPPSQPQSPPIRISSGINQSKRIRS 274

Query: 279 N-GSEDTVSKSETVDPSKAKQQRLPSGTPMKPMNVIETPNRPGFLAM---------PQQA 328
               EDTVS+S TVDP K+KQQ +  GTP    N   TPNR                   
Sbjct: 275 TIVEEDTVSRSGTVDPDKSKQQVMLPGTPA---NYTMTPNRVTLTGQRVLSENYNTNGNN 331

Query: 329 QHLLRINST-----------PVVTNKRITSGMLRIPEPRISEMERTMHEGLSSPAAGLLP 377
             L+ ++ST           P ++  RITSGMLRIPEPRI+E+ER +HEG SSPA+ L P
Sbjct: 332 NGLIFVSSTQGPNKSQQGQQPTLSTPRITSGMLRIPEPRIAEIERELHEGPSSPASAL-P 390

Query: 378 PKSAKIPMKKQYIPDEHDSSSSEGEFTEDKESVPVRVNSKAPLPVSVQSRAPSSIADDNG 437
            KS +IPMKK Y+ +  +   S+ E T D E  P+ +  +    +   S+          
Sbjct: 391 AKSDRIPMKKPYL-ETMEQDDSDRESTSDNEVTPIPIEEEKSNDIFNTSKF--------- 440

Query: 438 SPTKKSPLDATKRMNVKVADLPPQRKSSLEAKV 470
                       +++ K   +  QRKSSLE+KV
Sbjct: 441 -----------GKISQKPDKVVIQRKSSLESKV 462

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 1005 KKTRRGIVDTPKGLIGSISKSAIDKGTSDLENAPQSTQQSNSSPIKVPVTKMMEYASPTA 1064
            K +RR +V TPKG +  I K       SDLEN PQSTQ    SP K+   +  +  S  A
Sbjct: 1130 KVSRRLVVATPKGELSFIPKKPSQTDFSDLENMPQSTQPQQKSPPKL-AKQPPKQTSDAA 1188

Query: 1065 NKSSAKSVLVSPPSKATKVNRQTXXXXXXXXXXXXXXRGVPEVKEKSAAKT 1115
            +KS + +V+VS P    K    T              RG+P+VKE  A K+
Sbjct: 1189 HKSES-NVVVSKPVNDIK-EASTTIKPSLSSLSDLVSRGIPDVKENKANKS 1237

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score =  210 bits (534), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 189/501 (37%), Positives = 256/501 (51%), Gaps = 77/501 (15%)

Query: 1   MFKLQVVLVPAGANRS-----FNFGLP--SVSSESSQFIXXXXXXXXXXXXXXXXLANNI 53
           M+KLQV+LVP     +     +N+G    S++ +S Q                    NN 
Sbjct: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQL-----------PNKVNGTFNN- 48

Query: 54  PAQNGIGALDPNVS-TNTAYLSSFMT-SHITRPKLKKFLIFTKPTNTLYQLSQEILDKCN 111
              NG    D ++    T   SS +T ++  +  +KKFL FTK  NTL  LS EI DKC 
Sbjct: 49  -TFNGQSQPDSSIFPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCK 107

Query: 112 KIYPNLSTELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDL-ESNPDRQESL 170
            +YP+L  +L+I +LQD + CDLDPDFVVKDVFNV N VRVIL +++D+ E  P    S 
Sbjct: 108 AMYPSLEADLDILSLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEITP--VSSY 165

Query: 171 YSSKRRKLN---NGNSQQNTSTGATLDQPVTVAKRRP------QALKNSALRISTPLAHQ 221
            S KRR+LN     +S+  +  G    Q + V K+R       +   N   RISTPLA Q
Sbjct: 166 RSIKRRRLNPESLADSKDQSDFGVE-SQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQ 224

Query: 222 IYPPPSQRNPKQVNSXXXXXXXXXXXXXXKSILPPPTVXXXXXXXXXXXXAQKRLKIN-- 279
           +YPP +   P+  +               +S LPPP                   KI   
Sbjct: 225 LYPPSAIFEPQNSDD---------EEVADRSFLPPPIQPGSPPIRISSGIDTNVRKITSR 275

Query: 280 -GSEDTVSKSETVDPSKAKQQRLPSGTPMKPMNVIETPNRPGFLAMPQQAQHLLRIN-ST 337
            G +DTVS+S TVDP K++QQRL SGTP+  M+ + TPNR       Q+     R N S 
Sbjct: 276 IGEQDTVSRSATVDPDKSRQQRLLSGTPV--MSTM-TPNRVTLTG--QRVISEQRPNDSV 330

Query: 338 PVVTN---------KRITSGMLRIPEPRISEMERTMHEGLSSPAAGLLPPKSAKIPMKKQ 388
              TN         +RITSGML+IPEP+I+EME+ + EG SSP+  +LPP   KIPMKK 
Sbjct: 331 LTFTNRHINEPSHSRRITSGMLQIPEPKIAEMEKELLEGPSSPST-ILPPIPDKIPMKKP 389

Query: 389 YIPDEHDSSSSEGEFTEDKESVPVRVNSKAPLPVSVQSRAPSSIADDNGSPTKKSPLDAT 448
           +I  E   S    E + + ES    +N+K+ L         +SIAD+NGSP + + L+  
Sbjct: 390 FIETERYYS----EDSSETESNSGEINAKSSL------HRQTSIADNNGSPLRTNFLNEA 439

Query: 449 KRMNVKVADLPPQRKSSLEAK 469
               V +ADLP  +KS   +K
Sbjct: 440 ----VHLADLPELQKSEKASK 456

>Scas_711.38
          Length = 998

 Score =  194 bits (493), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 147/399 (36%), Positives = 217/399 (54%), Gaps = 52/399 (13%)

Query: 85  KLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLSTELEIDTLQDVDECDLDPDFVVKDVF 144
           K KKFL+FTKPTN L+ LS EI++KC  +YP+LS ELEI+TL+D  +CDLDPDF+V++VF
Sbjct: 63  KNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLDPDFIVEEVF 122

Query: 145 NVYNTVRVILRNDVDLESNPDRQESLYSS-KRRKLNNGN--------SQQNTSTGATLDQ 195
           +  N V+VIL+ND+D +S    Q S Y S KRRK N G+        SQQ  +    + +
Sbjct: 123 SSSNLVKVILKNDIDFQS--LEQVSNYKSIKRRKSNTGSYQPLSNKVSQQQANGVYGIPR 180

Query: 196 PVTVAKRRPQALKNSALRISTPLAHQIYPPPSQR--NPKQVNSXXXXXXXXXXXXXXKSI 253
              +A    +   N   RISTPLA QIYP   ++  N +  N+                I
Sbjct: 181 KQYLAISSTKTPSNVGRRISTPLAQQIYPDIDEQLENEEDRNAADRSFLPPPAQPQSPQI 240

Query: 254 LPPPTVXXXXXXXXXXXXAQKRLKING--SEDTVSKSETVDPSKAKQQRLPSGTP----M 307
                +              +  KI+G   +D+VS+SE VDP K+KQQRL  GTP    M
Sbjct: 241 RVSSGI-------------DRSKKIDGIAKDDSVSRSEVVDPDKSKQQRLLLGTPIMTTM 287

Query: 308 KPMNVIETPNRPGFLAMPQQAQHLL---RINSTPVV---TNKRITSGMLR-IPEPRISEM 360
            P  V  T  R    +    +   +   + NST  +   +N+R+ S +L+ IPEP+I+E+
Sbjct: 288 TPNRVTLTGQRVVSESHTSNSLQFIPNNKENSTQRLSSNSNRRVNSAVLKNIPEPKITEV 347

Query: 361 ERTMHEGLSSPAAGLLPPKSAKIPMKKQYIPDEHDSSSSEGEFTEDKESVPVRVNSKAPL 420
           E+ +  G SSPA+ LLP KS ++PMK+ ++      +     ++++  S     +S+  L
Sbjct: 348 EKVLKAGPSSPAS-LLPEKSERLPMKRPFL------TGVSSSYSDENISSDSSTHSRPTL 400

Query: 421 PVSVQSRAPSSIADDNGSPTKKSPLDATKRMNVKVADLP 459
                 +  SSIAD+NGSP K SP +     ++++A+LP
Sbjct: 401 ------QRQSSIADNNGSPVKNSPNEENNPDSMQLAELP 433

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 51/95 (53%), Gaps = 12/95 (12%)

Query: 513 TVCIHPTDRMDG-----SFQKSXXXXXXKGSKFDVPPAFRRAAGALQENDINKRSRKPYL 567
           TV I+P  R D      S QK       +G    +P   + +    Q        RKPY 
Sbjct: 551 TVRINPPGRGDKNSTNVSLQKVDVLKIFEGESLKIPSWLKGSKSKSQR-------RKPYT 603

Query: 568 TVLNKDIDNSEPDPRNILPSKLPRQAAQKAAQFIS 602
           TVL KDIDNS+PDPRNILP + PR AA++AAQ +S
Sbjct: 604 TVLYKDIDNSKPDPRNILPERTPRSAAKRAAQLLS 638

>CAGL0B03179g complement(309816..312599) weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 927

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 138/259 (53%), Gaps = 30/259 (11%)

Query: 80  HITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLSTE-LEIDTLQDVDECDLDPDF 138
           HI R   +KFL FTKP NTL QL+ EI ++  K+Y NL+ E  EI +LQD++ CDLD  +
Sbjct: 40  HIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATY 99

Query: 139 VVKDVFNVYNTVRVILRNDVD-LESNP-----DRQE----SLYSSKRRKLNN---GNSQQ 185
           +VKDVF++ NTV VIL+N+++ +++N      D  +    S YSS R++ ++   GNS +
Sbjct: 100 LVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRKRRSSKAFGNSSR 159

Query: 186 NTSTGATLDQPVTVAKR-RPQALK--NSALRISTPLAHQIYPPPSQRNPKQVN-SXXXXX 241
                  ++  + V KR +P  L   ++ LR+++PLA++I       +   +N +     
Sbjct: 160 -------IEPQILVPKRSKPNNLAPLSNNLRVTSPLANEISNDEINSSTVVINRNVSTAF 212

Query: 242 XXXXXXXXXKSILPPPTVXXXXXXXXXXXXAQKRLKINGSE--DTVSKSETVDPSKAKQQ 299
                    +S LPPP                 +   + S+  D VS+SE VDP K+KQQ
Sbjct: 213 AANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNLDVVSRSEVVDPDKSKQQ 272

Query: 300 RLPSGTPMKPMNVIETPNR 318
            +    P  PM  I TPNR
Sbjct: 273 LI---VPDIPMEFISTPNR 288

>YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein that
           interacts with DNA topoisomerase I [2316 bp, 771 aa]
          Length = 771

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 92/165 (55%), Gaps = 27/165 (16%)

Query: 84  PKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLSTELEIDTLQDVDECDLDPDFVVKDV 143
           P  KKFL FT   NTL QLS EIL K +++YPN    +EI +LQD   CDLD +F++KDV
Sbjct: 80  PNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIVSLQDRHGCDLDSEFIIKDV 139

Query: 144 FNVYNTVRVILRNDVDLESNPD-----------RQE------SLYSSKRRKLNNGNSQQN 186
           F     V VIL++++D   N             RQ+      S+ + KR+K+    S+++
Sbjct: 140 FENDGVVLVILKDELDWSRNQHISLLQLARQRRRQDNKPSTKSIVTEKRKKI----SKED 195

Query: 187 TSTGATLDQPVTVAKRRPQALKNSAL---RISTPLAHQIYPPPSQ 228
            S+ +  D    +AK    +LKN+ +   R+STPL ++I P  S+
Sbjct: 196 LSSISNKDTMHLIAK---SSLKNNFINKSRVSTPLMNEILPLASK 237

>Scas_684.25
          Length = 482

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 375 LLPPKSAKIPMKKQYIPDE--HDSSSSEGEFTEDKESVPVRVNSKAPLPVSVQSRAPSSI 432
           LL P S  +P     I  E  +D +SS  E+  D  ++PV +     L +  + RAP  I
Sbjct: 399 LLSPTSVNLPKGIDEIAKEKGYDGTSSTNEYMNDLFTIPVSLAGLPALTIPAKKRAPIGI 458

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.124    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 30,595,707
Number of extensions: 1277347
Number of successful extensions: 5760
Number of sequences better than 10.0: 73
Number of HSP's gapped: 5900
Number of HSP's successfully gapped: 89
Length of query: 1166
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1053
Effective length of database: 12,684,275
Effective search space: 13356541575
Effective search space used: 13356541575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 67 (30.4 bits)