Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C09372g29429014290.0
AAL180C2972973765e-43
Kwal_14.24142932892376e-23
Scas_675.263193192324e-22
YKR011C3533652222e-20
CAGL0B03201g3182961391e-09
Scas_720.74223149681.6
AAR071W223149662.9
Scas_720.4271938653.3
Sklu_1935.256457628.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C09372g
         (290 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C09372g 816494..817378 weakly similar to sp|Q02209 Saccharo...   555   0.0  
AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)...   149   5e-43
Kwal_14.2414                                                           96   6e-23
Scas_675.26                                                            94   4e-22
YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protei...    90   2e-20
CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02...    58   1e-09
Scas_720.74                                                            31   1.6  
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...    30   2.9  
Scas_720.42                                                            30   3.3  
Sklu_1935.2 YIL136W, Contig c1935 2747-4441                            28   8.6  

>KLLA0C09372g 816494..817378 weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5 hypothetical
           protein singleton, start by similarity
          Length = 294

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/290 (96%), Positives = 280/290 (96%)

Query: 1   MDKIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNX 60
           MDKIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSN 
Sbjct: 1   MDKIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNS 60

Query: 61  XXXXXXXXXKPFYILEYCVAEDTYSLWKSRSEWKLSSAIATLYGSNTLTDLPDRLVEALK 120
                    KPFYILEYCVAEDTYSLWKSRSEWKLSSAIATLYGSNTLTDLPDRLVEALK
Sbjct: 61  HSDDTDDHDKPFYILEYCVAEDTYSLWKSRSEWKLSSAIATLYGSNTLTDLPDRLVEALK 120

Query: 121 DSQHIFMVRNLLKEFNIRDTMKIDWDSIATDLMIFFEARELKKPIDPYELKTSMALSLLR 180
           DSQHIFMVRNLLKEFNIRDTMKIDWDSIATDLMIFFEARELKKPIDPYELKTSMALSLLR
Sbjct: 121 DSQHIFMVRNLLKEFNIRDTMKIDWDSIATDLMIFFEARELKKPIDPYELKTSMALSLLR 180

Query: 181 SMVDLNKRELGSTLLSYDVKVHQDNSPVSSPPSASTKANKNITFQSDYTHMPSTQLQSNF 240
           SMVDLNKRELGSTLLSYDVKVHQDNSPVSSPPSASTKANKNITFQSDYTHMPSTQLQSNF
Sbjct: 181 SMVDLNKRELGSTLLSYDVKVHQDNSPVSSPPSASTKANKNITFQSDYTHMPSTQLQSNF 240

Query: 241 NTFFQSMAENFETYDTERQPSTRSLRLPSFAKNKKTPAGQVHKPARKGNG 290
           NTFFQSMAENFETYDTERQPSTRSLRLPSFAKNKKTPAGQVHKPARKGNG
Sbjct: 241 NTFFQSMAENFETYDTERQPSTRSLRLPSFAKNKKTPAGQVHKPARKGNG 290

>AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)
           [894 bp, 297 aa]
          Length = 297

 Score =  149 bits (376), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 165/297 (55%), Gaps = 24/297 (8%)

Query: 1   MDKIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNX 60
           M+++YVY+GEN P+V L  ++    +EE+  Y+ R+QD + L+L  VETITGNLKI  + 
Sbjct: 9   MEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITGNLKIGCDT 68

Query: 61  XXXXXXXXXKPFYILEYCVAEDTYSLWKSR-SEWKLSSAIATLY-GSNT----LTDLPDR 114
                     PFYILEY      YSLWK+  ++W+L S +AT+Y G+         LP R
Sbjct: 69  HADCEAC---PFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERGGLP-R 124

Query: 115 LVEALKDSQHIFMVRNLLKEFNIRDTMKIDWDSIATDLMIFFEARELKKPIDPYELKTSM 174
            ++ L++   +  V + L+  N+    +IDW      L     A+ +    D   L+  +
Sbjct: 125 ELQGLREGLDMEYVWDCLRRLNL-PLEQIDWAEFRELLESMLAAKRVADD-DCVTLRGVV 182

Query: 175 ALSLLRSMVDLNKRELGSTLLSYDVKVHQDNSPV----SSPPSASTKANKNITFQS-DYT 229
           AL+ L++ V  +KR + S L +YD +V   ++P     SSP S     ++  +  S  YT
Sbjct: 183 ALAALQATVQTSKRAVRSQLRAYDRRVRAASTPASTRTSSPESLLPADSRESSVSSVHYT 242

Query: 230 H-MPSTQLQSNFNTFFQSMAENFETYDTERQPSTRSLRLPSFAKNKKTPAGQ-VHKP 284
           + +P+TQL +NF T+F+SMAENFE ++   +P+  +LR    AK +K  AG+  H+P
Sbjct: 243 YGLPATQLDANFKTYFRSMAENFELFE---EPAL-ALR-GRVAKPRKKAAGRHGHRP 294

>Kwal_14.2414
          Length = 293

 Score = 95.9 bits (237), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 133/289 (46%), Gaps = 47/289 (16%)

Query: 3   KIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNXXX 62
           +IYV  G+++  V+LT +     I ++ R+LH +QD F ++L    TIT NLKI+     
Sbjct: 11  EIYVPIGDDQ-SVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITDNLKIQC---V 66

Query: 63  XXXXXXXKPFYILEYCVAEDTYSLWKSRSEWKLSSAIATLYGSN--------TLTDLPDR 114
                   P YILE+      Y+LWKS  +W L   + +LY +         TL  L   
Sbjct: 67  SHRACNSCPLYILEFDDVSQGYALWKSPGDWALGIMLTSLYATKNGARRVHPTLKALVAE 126

Query: 115 LVEALKDSQHIFMVRNLLKEFNIRDTMKIDWDSIATDL-------------MIFFEAREL 161
            V +  D+   F++  L K       + +DWD+I T                +    R+ 
Sbjct: 127 QVSSKHDAP--FLMETLQK-------LNVDWDNIDTRFDFTLFLKLLEEALELEIGTRDY 177

Query: 162 KKPID---PYELKTSMALSLLRSMVDLNKRELGSTLLSYDVKVH-QDNSPVSSPPSASTK 217
              +D     + K+ M +++LR+ V ++KR L  +L  YD ++   D++   +   AS  
Sbjct: 178 SSYLDIVTRLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRAADDACKEASREASVL 237

Query: 218 ANKNITFQSDYTHMP---------STQLQSNFNTFFQSMAENFETYDTE 257
           ++  +  +S  T  P         S QL +NF   F++MAE FET+D +
Sbjct: 238 SDSIVHSRSPSTSAPVPDDEYLLSSKQLVTNFQNHFRNMAETFETFDVK 286

>Scas_675.26
          Length = 319

 Score = 94.0 bits (232), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 140/319 (43%), Gaps = 46/319 (14%)

Query: 4   IYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNXXXX 63
           IY+Y G+N+PKV+LT+++      ++I+Y H +QD + ++ +  ETIT NLK+ S     
Sbjct: 7   IYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENLKLTSTSSLA 66

Query: 64  XXXXXXKPFYILEYCVAEDTYSLWKSRSEWKLSSAIATLYGSNTLTDLPDRLVEALKDSQ 123
                  P +I+EY    D++ +WKS  +W+++  +  +Y + +      +       S 
Sbjct: 67  TS-----PTFIIEYNEIYDSFYVWKSEGKWEMTDIVTQIYNTQSQPKAKTKTPNGATKSW 121

Query: 124 HI-FMVRNLLKEFNIRDTMK-------IDWDSIATDLMIFFEARELKKPIDPY-----EL 170
            + F     LK    +D +K       +DW  +  D+  F+   +    ID +       
Sbjct: 122 EVQFKNDPRLKSHRKKDILKLALNNLNVDWSMV--DINEFWNQLDNICQIDSHMGNESSC 179

Query: 171 KTSMALSLLRSMVDLNKRELGSTLLSYDVKVHQ----------------DNSPVSSPPSA 214
           K+ + ++L R+ +  NK+ L   +  Y  +                   ++SP++  P  
Sbjct: 180 KSFIVMALFRTRISRNKKLLQKLISEYGERCRNNSTEAITSDNSAELAIEDSPLADLPIE 239

Query: 215 STKANKNITFQSDYTHMPST---------QLQSNFNTFFQSMAENFETYDTERQPST-RS 264
                 + + Q    H PST         Q+ SNFN  F+  AE++E +D + +    R 
Sbjct: 240 EEGLKTSSSNQHYSYHQPSTRDSKDIVAKQVFSNFNRHFKVTAEDYELFDLKTKAGIPRK 299

Query: 265 LRLPSFAKNKKTPAGQVHK 283
           LR  S    K T    +++
Sbjct: 300 LRRNSSKITKDTRTKHINR 318

>YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protein
           of unknown function [1062 bp, 353 aa]
          Length = 353

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 168/365 (46%), Gaps = 96/365 (26%)

Query: 1   MDKIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNX 60
           ++ +Y+YAGE +P+V+LT IK    + ++I+++H +Q+++ ++L+  ETIT NLKI    
Sbjct: 4   LETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKIDC-- 61

Query: 61  XXXXXXXXXKP-----FYILEYCVAEDTYSLWKSRSEWKLSSAIATLYGSNTLTDLPD-R 114
                    KP     FYILEY    DT+ +WKS   W+L+   A LY  N    + +  
Sbjct: 62  ----APAYLKPNCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDNDANVVKNTS 117

Query: 115 LVEALKDSQHI------FMVRNLLKEFNIRDTMKID-------WDSIATDLMIFFEAREL 161
             E  ++ Q          ++N L++ N RD  K++       +D I   +     A++ 
Sbjct: 118 WKEVFQNDQRFKNYDKRAWLQNCLEKMN-RDLSKLNVEQFWSQYDKICQSI-----AKQK 171

Query: 162 KKP----IDPYE-LKTSMALSLLRSMVDLNKRELGSTLLSYD------VKVHQDN----- 205
           KK     ++ ++  K  ++++++++ V  NKR L +TL +Y         + + N     
Sbjct: 172 KKQEQFNMEVFDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENS 231

Query: 206 --------------------SPVS--SPPSAST--------------KANKNITFQSDYT 229
                               SPV+  SP S ST              ++  N+ F     
Sbjct: 232 LASCSNNEPSASLESESRHFSPVNSLSPSSLSTDDEAVSTDYIYKGPESKPNVNF----M 287

Query: 230 HMPSTQ--LQSNFNTFFQSMAENFETYD----TERQPSTRSLRLPSFAKNKKTPAGQVHK 283
           H  +T   ++SNF ++F+ MAE++ET+D    + ++P  R  +L    K  K P    H 
Sbjct: 288 HSSATNDLIKSNFESYFKLMAEDYETFDLRAWSRQRP--RKFQLVEKKKITKNPPNS-HH 344

Query: 284 PARKG 288
           P + G
Sbjct: 345 PHKNG 349

>CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5, hypothetical
           start
          Length = 318

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 131/296 (44%), Gaps = 57/296 (19%)

Query: 4   IYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNXXXX 63
           +YV  GEN   V L+++      +E++ Y   +QD   ++ +  ETI  NLK++      
Sbjct: 6   VYV-RGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEV-FLGN 63

Query: 64  XXXXXXKPFYILEYCVAEDTYSLWKSRSEWKLSSAIA-----TLYGSN-----TLTDLPD 113
                  PFYI+E+  +++ +S+W+S  +W    A+      TL+G++     T +D   
Sbjct: 64  THIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSDDWR 123

Query: 114 RLVEALKDSQH--IFMVRNLLKEFNIRDTMKIDWDSIATDLMIFFEARELKKPIDPYEL- 170
             V   +  +H     + N LK+ N      +DW +   +  +F++  +    +D  +  
Sbjct: 124 EFVGTKRMQEHPNKIELENSLKKLN------VDWSN--CNASVFWKEIDNHCRVDAKQAS 175

Query: 171 KTSMA----------LSLLRSMVDLNKRELGSTLLSYDVKV--------HQDNSPVSSPP 212
           K + A          L+L+++ +  NK  + + + ++  ++         + +S + S  
Sbjct: 176 KHATASTEGFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFRKSRKDSIMESIS 235

Query: 213 SASTKANKNITFQS---DY---THMP----------STQLQSNFNTFFQSMAENFE 252
             S +  + I  +S   +Y   TH P          S Q+ SNFN  F+ + ENFE
Sbjct: 236 EDSCEDEEMIRVRSLSPNYTTATHSPRAVEDIDNETSKQIMSNFNMLFKPIVENFE 291

>Scas_720.74
          Length = 2231

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 230  HMPSTQLQSNFNTFFQSMA-ENFETYDTERQPSTRSLRLPSFAKNKKTP 277
            H P T+L  +F T  + +  EN E  + ER+P   S+ + +F    KTP
Sbjct: 1523 HSPETKLTDSFFTANELIEDENGELTEVEREPGANSIGMVAFKVTVKTP 1571

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (HFA1)
            - SH] complement(466791..473486) [6696 bp, 2231 aa]
          Length = 2231

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 230  HMPSTQLQSNFNTFFQSMA-ENFETYDTERQPSTRSLRLPSFAKNKKTP 277
            H P  QL  +F    + ++ EN E  + +R+P T S+ + +F    KTP
Sbjct: 1524 HSPKMQLSDDFFIANELISDENGELTEVDREPGTNSIGMVAFKVTVKTP 1572

>Scas_720.42
          Length = 719

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%)

Query: 212 PSASTKANKNITFQSDYTHMPSTQLQSNFNTFFQSMAE 249
           PS ST AN N+      T  P   ++ N N    SM+E
Sbjct: 371 PSTSTSANPNLNLNVPITDTPMNNVEPNINHLIHSMSE 408

>Sklu_1935.2 YIL136W, Contig c1935 2747-4441
          Length = 564

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 78  CVAEDTYSLWKSRSEWKLSSAIATL-----YGSNTLTDLPDRLVEALKDSQHIFMVR 129
             AED  S WKS ++ KL+S ++ L      G+  + D   +  + ++D Q +++ R
Sbjct: 60  TTAEDKLSTWKSSADEKLTSKMSELEKTKGQGAGWIGDKLGQAQDFIQDKQDVYLER 116

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,215,314
Number of extensions: 371074
Number of successful extensions: 1506
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1493
Number of HSP's successfully gapped: 28
Length of query: 290
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 189
Effective length of database: 13,099,691
Effective search space: 2475841599
Effective search space used: 2475841599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)