Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C08393g1148113158270.0
Sklu_2193.11143114743030.0
YIL048W (NEO1)1151115241630.0
Kwal_23.57891133114041480.0
Scas_704.381161115941230.0
CAGL0L00715g1144114040940.0
ADL079C1166116039830.0
Scas_89.127125511631e-151
KLLA0A04015g1343100311201e-132
Kwal_26.70701315100911051e-130
CAGL0G06270g1328102811001e-129
YAL026C (DRS2)135599510791e-126
ADR350W131186410191e-118
YER166W (DNF1)15719328262e-91
YDR093W (DNF2)16128917953e-87
CAGL0L11814g15768997581e-82
CAGL0G08085g15785546051e-63
Scas_636.1615545605943e-62
KLLA0C17644g15765175891e-61
Scas_576.815915175756e-60
AGR120C15475125702e-59
CAGL0H04477g16264515651e-58
Kwal_23.355615973905391e-55
YMR162C (DNF3)16564425372e-55
KLLA0E01650g15503865311e-54
AFL191W15753885212e-53
Scas_669.316384415033e-51
Scas_505.410253003361e-31
YDR038C (ENA5)10918342388e-20
YDR039C (ENA2)10918342371e-19
AFR567W14497872333e-19
YDR040C (ENA1)10918342324e-19
KLLA0B08217g14395922281e-18
CAGL0K12034g10878102226e-18
Kwal_26.920714696552219e-18
CAGL0I04312g9517532154e-17
Scas_665.3014396562154e-17
Kwal_23.316011008072136e-17
AEL301W9576502137e-17
YOR291W14723082031e-15
CAGL0A00517g11227812003e-15
KLLA0E14630g10826001993e-15
AGL097C10967551913e-14
KLLA0A08910g12807641913e-14
CAGL0M11308g14525811851e-13
Kwal_47.1754712404081814e-13
KLLA0F20658g10825111771e-12
AFL011W12427681762e-12
Kwal_14.14989397781743e-12
YGL167C (PMR1)9506481708e-12
KLLA0A03157g9386781653e-11
Scas_707.48*7416701618e-11
CAGL0J01870g9464671573e-10
YGL006W (PMC1)11733481555e-10
AFR354C12102921181e-05
YGL008C (PMA1)9181651134e-05
Scas_688.19132431082e-04
YPL036W (PMA2)9472461072e-04
KLLA0A09031g8992431020.001
AGL085C9092431010.001
KLLA0F07447g9752111010.001
Kwal_47.175228992491000.001
Scas_710.41904242970.003
CAGL0A00495g902204940.007
KLLA0E22352g1206428930.009
CAGL0L01419g1214424920.014
Scas_569.0d468158870.043
Scas_297.1800189870.049
KLLA0D04092g115254860.059
Kwal_55.2157598943840.11
Scas_583.14*875427810.27
AGL041C123343800.32
YBR295W (PCA1)1216191770.72
Scas_227.0d30780760.73
YDR270W (CCC2)100452760.96
ADL254W60396741.4
Scas_615.994242713.5
CAGL0M08602g101283713.6
KLLA0D02772g46194703.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C08393g
         (1131 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...  2249   0.0  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement        1662   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...  1608   0.0  
Kwal_23.5789                                                         1602   0.0  
Scas_704.38                                                          1592   0.0  
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...  1581   0.0  
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...  1538   0.0  
Scas_89.1                                                             452   e-151
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   436   e-132
Kwal_26.7070                                                          430   e-130
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   428   e-129
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   420   e-126
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   397   e-118
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   322   2e-91
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   310   3e-87
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   296   1e-82
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   237   1e-63
Scas_636.16                                                           233   3e-62
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   231   1e-61
Scas_576.8                                                            226   6e-60
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   224   2e-59
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   222   1e-58
Kwal_23.3556                                                          212   1e-55
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   211   2e-55
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   209   1e-54
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   205   2e-53
Scas_669.3                                                            198   3e-51
Scas_505.4                                                            134   1e-31
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    96   8e-20
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    96   1e-19
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    94   3e-19
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    94   4e-19
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    92   1e-18
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    90   6e-18
Kwal_26.9207                                                           90   9e-18
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    87   4e-17
Scas_665.30                                                            87   4e-17
Kwal_23.3160                                                           87   6e-17
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    87   7e-17
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    83   1e-15
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    82   3e-15
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    81   3e-15
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    78   3e-14
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    78   3e-14
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    76   1e-13
Kwal_47.17547                                                          74   4e-13
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    73   1e-12
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    72   2e-12
Kwal_14.1498                                                           72   3e-12
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    70   8e-12
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    68   3e-11
Scas_707.48*                                                           67   8e-11
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    65   3e-10
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    64   5e-10
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    50   1e-05
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    48   4e-05
Scas_688.1                                                             46   2e-04
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    46   2e-04
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    44   0.001
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    44   0.001
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    44   0.001
Kwal_47.17522                                                          43   0.001
Scas_710.41                                                            42   0.003
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    41   0.007
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    40   0.009
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    40   0.014
Scas_569.0d                                                            38   0.043
Scas_297.1                                                             38   0.049
KLLA0D04092g complement(344666..348124) some similarities with s...    38   0.059
Kwal_55.21575                                                          37   0.11 
Scas_583.14*                                                           36   0.27 
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    35   0.32 
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    34   0.72 
Scas_227.0d                                                            34   0.73 
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    34   0.96 
ADL254W [1487] [Homologous to ScYNL061W (NOP2) - SH] complement(...    33   1.4  
Scas_615.9                                                             32   3.5  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    32   3.6  
KLLA0D02772g complement(234761..236146) similar to sp|P07236 Sac...    32   3.8  

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 2249 bits (5827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1087/1131 (96%), Positives = 1087/1131 (96%)

Query: 1    MSFSPPPGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQLPEHSHRRENSTV 60
            MSFSPPPGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQLPEHSHRRENSTV
Sbjct: 1    MSFSPPPGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQLPEHSHRRENSTV 60

Query: 61   FEDFEMKSMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNSDRNAQNTNNITVWSKAKSW 120
            FEDFEMKSMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNSDRNAQNTNNITVWSKAKSW
Sbjct: 61   FEDFEMKSMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNSDRNAQNTNNITVWSKAKSW 120

Query: 121  FEHSFTKAKXXXXXXXXXXXXXXVDGNKIELNDHNVEREIHPATTPIYDRKKYPSNVISN 180
            FEHSFTKAK              VDGNKIELNDHNVEREIHPATTPIYDRKKYPSNVISN
Sbjct: 121  FEHSFTKAKSKPSSLSVYSSTNSVDGNKIELNDHNVEREIHPATTPIYDRKKYPSNVISN 180

Query: 181  AKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKE 240
            AKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKE
Sbjct: 181  AKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKE 240

Query: 241  AMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPN 300
            AMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPN
Sbjct: 241  AMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPN 300

Query: 301  GESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDS 360
            GESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDS
Sbjct: 301  GESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDS 360

Query: 361  TSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKI 420
            TSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKI
Sbjct: 361  TSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKI 420

Query: 421  LCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHD 480
            LCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHD
Sbjct: 421  LCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHD 480

Query: 481  KQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIVTDFI 540
            KQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIVTDFI
Sbjct: 481  KQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIVTDFI 540

Query: 541  QXXXXXXXXXXXXXXXKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKF 600
            Q               KNISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKF
Sbjct: 541  QSMNSRTSNSTPTTTRKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKF 600

Query: 601  TESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQ 660
            TESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQ
Sbjct: 601  TESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQ 660

Query: 661  KGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMD 720
            KGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMD
Sbjct: 661  KGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMD 720

Query: 721  REVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARC 780
            REVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARC
Sbjct: 721  REVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARC 780

Query: 781  VSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFF 840
            VSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFF
Sbjct: 781  VSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFF 840

Query: 841  DIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKE 900
            DIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKE
Sbjct: 841  DIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKE 900

Query: 901  GKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMF 960
            GKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMF
Sbjct: 901  GKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMF 960

Query: 961  EPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPELYKELTLGKSLSFKTFFV 1020
            EPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPELYKELTLGKSLSFKTFFV
Sbjct: 961  EPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPELYKELTLGKSLSFKTFFV 1020

Query: 1021 WVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNELIMVGLEINTWNKIMAIT 1080
            WVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNELIMVGLEINTWNKIMAIT
Sbjct: 1021 WVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNELIMVGLEINTWNKIMAIT 1080

Query: 1081 EVVTLLIYLGSIPFLGEYFDLSYVSTTKFXXXXXXXXXXXXXXXWAAKSIY 1131
            EVVTLLIYLGSIPFLGEYFDLSYVSTTKF               WAAKSIY
Sbjct: 1081 EVVTLLIYLGSIPFLGEYFDLSYVSTTKFPLRVLVILVISVVPVWAAKSIY 1131

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 1662 bits (4303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 814/1147 (70%), Positives = 931/1147 (81%), Gaps = 37/1147 (3%)

Query: 1    MSFSPPPGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQLPEHSHRRENSTV 60
            MSFSPPPGS   N+   SN  ++     DSFDLQFEDSLDAALESLQ+         +T 
Sbjct: 1    MSFSPPPGSNKLNQAPSSNNGRSSI---DSFDLQFEDSLDAALESLQI-----NNSLNTS 52

Query: 61   FEDFEMKSMH--GDHQTGMLHSDADTAPLITNHSNNGRMLSNSD------------RNAQ 106
             E+FEM+++   GD      HS   +   + + + N  + S  D             N Q
Sbjct: 53   GENFEMRTIDQDGDDTQSFKHSRVSS---LNDSAKNTHLSSGRDTQPLIGTTQEPWSNNQ 109

Query: 107  NTNNITVWSKAKSWFEHSFTKAKXXXXXXXXXXXXXXVDGNKIELNDHNVEREIHPATTP 166
              +N + WSK     +   T                    + IEL D +VEREIHP TTP
Sbjct: 110  QGSNQSPWSKFIRLIKTPTT----------TDLSKYRSTNSSIELTDQHVEREIHPDTTP 159

Query: 167  IYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYI 226
            IYD+ KYPSN ISNAKYNP TFIP+ILYEQFKFFFNLYFL+VALSQAIP LRIGYLSSYI
Sbjct: 160  IYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYI 219

Query: 227  VPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGAR 286
            VPLAFVL VTMSKEAMDDI RR+RD+E+NNELYEV+NK   +PSKDLKVGD+IK+ KG R
Sbjct: 220  VPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTR 279

Query: 287  VPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEH 346
            +PAD+V+LQ++EP+GESFIKTDQLDGETDWKLR+ACSLTQ+L+ +DLLN I+ITAS+PE 
Sbjct: 280  IPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEK 339

Query: 347  SIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAK 406
            SIH FLGK+TYKDS+S+ LSVDNTMW NTVLAS  +CI C+VYTG +TRQA+NTT S  K
Sbjct: 340  SIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVK 399

Query: 407  TGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNL 466
            TGLLELEIN LSKILCACVF+LSI+LVAFAGF N DWYVDIMRYLILFSTIIPVSLRVNL
Sbjct: 400  TGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNL 459

Query: 467  DLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTV 526
            DLGKSVYA +IEHD  I DTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLGTV
Sbjct: 460  DLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTV 519

Query: 527  SYTNETMDIVTDFIQXXXXXXXXXXX--XXXXKNISDRVIDLVTTLAICHNVTPTFEDGE 584
            SYT +TMDIVTD++Q                 K++ +RV DLV TLAICHNVTPTFEDGE
Sbjct: 520  SYTMDTMDIVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFEDGE 579

Query: 585  LTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRM 644
            LTYQAASPDEIAIVKFTESVGLSLF+RDRHS+SLFH HS    EYDI  +FPFNSD+KRM
Sbjct: 580  LTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRM 639

Query: 645  GVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLF 704
            G+I++DK+K E+WF+QKGADTVM+ IV  NDWL+EE  NMA EGLRTLVIGRKKLS   +
Sbjct: 640  GIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSY 699

Query: 705  EQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAG 764
            EQF KEY +ASL+M++R+  M +V++K LE++LELLGLTGVEDKLQ DVKSSIELLRNAG
Sbjct: 700  EQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAG 759

Query: 765  IKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLID 824
            +KIWMLTGDKVETARCVSISAKLISRGQYVHTVTK+++PEGAL+ LEYL++N++SCLLID
Sbjct: 760  VKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLID 819

Query: 825  GESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDV 884
            GESLG++L Y+  EFFDIVV+LP V+ACRCTPQQKADVA+ IR+ TGKRVCCIGDGGNDV
Sbjct: 820  GESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDV 879

Query: 885  SMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRG 944
            SMIQCADVGVGIVGKEGKQASLAADFS+TQFCHLTKLLLWHGRNSYK SAKL+QFVIHRG
Sbjct: 880  SMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRG 939

Query: 945  LIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPELY 1004
            LIISVCQAVYS+CS FEP+ALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLT +YPELY
Sbjct: 940  LIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELY 999

Query: 1005 KELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNELI 1064
            KELT G SLS+KTFFVWV LS+FQGC IQ  SQ+FTSL++ DF K+VA+SFTALV+NELI
Sbjct: 1000 KELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINELI 1059

Query: 1065 MVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFXXXXXXXXXXXXXXX 1124
            MV LEI TWNK M ITE+VT LIY+ S+PFL EYFDL++VS   F               
Sbjct: 1060 MVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVFPV 1119

Query: 1125 WAAKSIY 1131
            WAAK+I+
Sbjct: 1120 WAAKAIH 1126

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 1608 bits (4163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/1152 (69%), Positives = 940/1152 (81%), Gaps = 47/1152 (4%)

Query: 6    PPG--SQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQL---PEHSHRRENSTV 60
            PP   S   N ++ +N   A S D  SFDL  +DS DAAL+SLQ+   PE   +      
Sbjct: 4    PPSFKSHKQNLFNSNNNQHANSVD--SFDLHLDDSFDAALDSLQINNNPEPLSKHNTVGD 61

Query: 61   FEDFEMKSMH-----GDHQTGMLH--SDADTAPLITNHSNNGRMLSNSDRNAQNTN---- 109
             E FEM+++       +H +      S+ DT PL+ ++    R+  + D N + TN    
Sbjct: 62   RESFEMRTVDDLDNFSNHSSDSHRKSSNTDTHPLMYDN----RL--SQDDNFKFTNIASS 115

Query: 110  ----NITVWSKAKSWFEHSFTKAKXXXXXXXXXXXXXXVDGNKIELNDHNVEREIHPATT 165
                +  ++SKA S+ + S TK                  G+ IEL+D ++EREIHP TT
Sbjct: 116  PPSSSNNIFSKALSYLKVSNTKNWSKF-------------GSPIELSDQHIEREIHPDTT 162

Query: 166  PIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSY 225
            P+YDR +Y SN +SNAKYN  TF+P +LYEQFKFF+NLYFL+VALSQA+P LRIGYLSSY
Sbjct: 163  PVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSY 222

Query: 226  IVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGA 285
            IVPLAFVLTVTM+KEA+DDI RR+RDRE+NNELY V+ +   IPSKDLKVGD+IK+ KG 
Sbjct: 223  IVPLAFVLTVTMAKEAIDDIQRRRRDRESNNELYHVITRNRSIPSKDLKVGDLIKVHKGD 282

Query: 286  RVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPE 345
            R+PAD+V+LQ++EP+GESFIKTDQLDGETDWKLR+AC LTQ+L+ENDL+N I+ITASAPE
Sbjct: 283  RIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPE 342

Query: 346  HSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKA 405
             SIH FLGK+TYKDSTS+PLSVDNT+W NTVLASS  CI C+VYTGR+TRQA+NTT +K 
Sbjct: 343  KSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKV 402

Query: 406  KTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVN 465
            KTGLLELEIN +SKILCACVF LSI+LVAFAGF+N+DWY+DI+RYLILFSTIIPVSLRVN
Sbjct: 403  KTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVN 462

Query: 466  LDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGT 525
            LDL KSVYA++IEHDK I +TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGT
Sbjct: 463  LDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGT 522

Query: 526  VSYTNETMDIVTDFIQXXXXXX------XXXXXXXXXKNISDRVIDLVTTLAICHNVTPT 579
            VSYT+ET+DIV+D++Q                     K++S RV D++ TLAICHNVTPT
Sbjct: 523  VSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPT 582

Query: 580  FEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNS 639
            FED ELTYQAASPDEIAIVKFTESVGLSLF+RDRHSISL H+HSG  L Y+I  +FPFNS
Sbjct: 583  FEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNS 642

Query: 640  DSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKL 699
            DSKRMG+I+ D+   EYWF+QKGADTVMS IV  NDWLEEET NMA EGLRTLVIGRKKL
Sbjct: 643  DSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKL 702

Query: 700  STNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIEL 759
            +  ++EQF+KEY++ASL+M++R+  M  V+ K+LE+DLELLGLTGVEDKLQKDVKSSIEL
Sbjct: 703  NKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIEL 762

Query: 760  LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNS 819
            LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHT+TKV +PEGA + LEYL++N+N+
Sbjct: 763  LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNA 822

Query: 820  CLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGD 879
            CLLIDGESLG++L+++  EFFD+VV+LPTV+ACRCTPQQKADVA+ IR+ TGKRVCCIGD
Sbjct: 823  CLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGD 882

Query: 880  GGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQF 939
            GGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLT+LLLWHGRNSYK SAKL+QF
Sbjct: 883  GGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQF 942

Query: 940  VIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTL 999
            V+HRGLII++CQAVYSICS+FEP+ALYQGWLMVGYATCYTMAPVFSLTLDHDI+ESLT +
Sbjct: 943  VMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKI 1002

Query: 1000 YPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALV 1059
            YPELYKELT GKSLS+KTFFVWV LS+FQG VIQ+ SQ FTSL D+DFT+MVAISFTALV
Sbjct: 1003 YPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALV 1062

Query: 1060 LNELIMVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFXXXXXXXXXX 1119
            +NELIMV LEI TWNK M +TE+ TLL Y+ S+PFLG+YFDL Y++T  +          
Sbjct: 1063 VNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLI 1122

Query: 1120 XXXXXWAAKSIY 1131
                 W AK+IY
Sbjct: 1123 SIFPVWTAKAIY 1134

>Kwal_23.5789
          Length = 1133

 Score = 1602 bits (4148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 801/1140 (70%), Positives = 915/1140 (80%), Gaps = 34/1140 (2%)

Query: 1    MSFSPPPGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQLPEHSHRRENSTV 60
            MSFSPPPGS   NK  +S  H  +    D  D Q EDSLDAALESLQ+  H+     S  
Sbjct: 1    MSFSPPPGS---NK--ESIPHNNRHNSFDLLDPQLEDSLDAALESLQI--HTG---GSPA 50

Query: 61   FEDFEMKSMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNS-------DRNAQNTNNITV 113
             EDFEM S+  + ++      +DT PLI    NNG    NS       D +    +    
Sbjct: 51   REDFEMTSLRSN-ESQKNARQSDTEPLI----NNGATAPNSWSHDPRHDSDRSTASGSPF 105

Query: 114  WSKAKSWFEHSFTKAKXXXXXXXXXXXXXXVDGNKIEL-NDHNVEREIHPATTPIYDRKK 172
            WS+   +   S +                    N I+L +D  ++REIHP+TTP+YDR K
Sbjct: 106  WSRITKFMRSSHSPK----------VSTYKATSNSIQLKDDQQLDREIHPSTTPVYDRYK 155

Query: 173  YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232
            Y  N ISNAKYNP TFIP ILYEQFKFFFNLYFL+VALSQAIP LRIGYLSSYIVPLAFV
Sbjct: 156  YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215

Query: 233  LTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVV 292
            LTVTMSKEA+DDI RR+RDRE+NNELYEV++K   +PSKDLKVGD+IK+ KGAR PAD+V
Sbjct: 216  LTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLV 275

Query: 293  VLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFL 352
            +LQ++EP+GE FIKTDQLDGETDWKLR+AC LTQ L+++DLL  I+ITAS PE SI+NFL
Sbjct: 276  LLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFL 335

Query: 353  GKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLEL 412
            GK+T+ +  S PLSVDNTMW NTV AS+   I C+VYTG +TRQA+NT+ S  KTGLLEL
Sbjct: 336  GKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLEL 395

Query: 413  EINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSV 472
            EIN LSKILCACVF+LS+ LVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSV
Sbjct: 396  EINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSV 455

Query: 473  YAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNET 532
            YA++IEHD  I +TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+LKK+HLGTVSYT +T
Sbjct: 456  YAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDT 515

Query: 533  MDIVTDFIQXXX-XXXXXXXXXXXXKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAAS 591
            MDIVTD+++                K++  RV DLV TLA+CH VTPTFEDGELTYQAAS
Sbjct: 516  MDIVTDYVRAMSDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAAS 575

Query: 592  PDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDK 651
            PDEIAIVKFTESVGL+LFRRDRHSI+L HD SG   EYDI  +FPFNSD+KRMG++IFDK
Sbjct: 576  PDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDK 635

Query: 652  LKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEY 711
             K EYWFLQKGAD VMS IV +NDWLEEET N+A EGLRTLVIGRK+LS  L + F K+Y
Sbjct: 636  QKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDY 695

Query: 712  SEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 771
             +ASL M++REV M NV+ K LE+DLE+LGLTGVEDKLQ+DVKSSIELLRNAGIKIWMLT
Sbjct: 696  EDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLT 755

Query: 772  GDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLY 831
            GDKVETARCVSISAKL+SRGQYVHTVTKVNKPEGAL HLE L++N NSCLLIDGESLGLY
Sbjct: 756  GDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLY 815

Query: 832  LQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCAD 891
            L+Y+  +FF+IVVNLP V+ACRCTPQQKADVA FIR+ TGKRVCCIGDGGNDVSMIQ AD
Sbjct: 816  LEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSAD 875

Query: 892  VGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQ 951
            VGVGIVGKEGKQASLAADFSITQFCHL+KLLLWHGRNSYK SAKL+QFVIHRGL+ISVCQ
Sbjct: 876  VGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQ 935

Query: 952  AVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPELYKELTLGK 1011
            AVYSI S FEP+ALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLT  YPELYKELT GK
Sbjct: 936  AVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGK 995

Query: 1012 SLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNELIMVGLEIN 1071
            SLS+KTFFVWV LS+FQGCVIQ  SQ FTSL++ DF ++VA+SFT L+LNELIMV +EI 
Sbjct: 996  SLSYKTFFVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIY 1055

Query: 1072 TWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFXXXXXXXXXXXXXXXWAAKSIY 1131
            TWNK M ++EVVT LI++GS+P L EYFDL+Y+S  ++               WAAK+++
Sbjct: 1056 TWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALH 1115

>Scas_704.38
          Length = 1161

 Score = 1592 bits (4123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 778/1159 (67%), Positives = 922/1159 (79%), Gaps = 43/1159 (3%)

Query: 1    MSFSPP--PGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQLPEHSHRRENS 58
            M FSP   P  Q  N     N         DSFDLQFEDS DA L++++L   +  + N+
Sbjct: 1    MPFSPSLNPDRQKSNSIGPRNS-------ADSFDLQFEDSFDAVLDNIELNTDTRNQNNT 53

Query: 59   ----------------TVFEDFEMKSMHGDHQTGMLHS----DADTAPLITNHSNNGRML 98
                             + E FEMKS++     G+ HS    + D  PL+ + ++N    
Sbjct: 54   LPNNQNINKASSENKDKLQESFEMKSLNA-RNGGLGHSRNSSNGDRQPLMHDSASNP--- 109

Query: 99   SNSDRNAQNTNNITVWSKAKSWFEHSFTKAKXXXXXXXXXXXXXXVDGNKIELNDHNVER 158
              S     N +   +   + + F +  TK K                   +EL+D ++ER
Sbjct: 110  DGSPYKYTNVSESALNLHSNNRFSNWITKLKMVGAQKWKKFHTM----GSVELDDRHMER 165

Query: 159  EIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLR 218
            EIHP+TTP+YDR +YP N ISNAKYN FTFIP +LYEQFKFF+NLYFL+VALSQAIP LR
Sbjct: 166  EIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALR 225

Query: 219  IGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDI 278
            IGYLSSY+VPLAFVLTVTMSKEAMDDI RR+RD E+N+ELY V+N+   +PSKDLKVGD+
Sbjct: 226  IGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDL 285

Query: 279  IKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNIT 338
            IK+ KG R+PAD+V+LQ++EP+GE+FIKTDQLDGETDWKLR+A +LTQ+LTE DL+N ++
Sbjct: 286  IKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVS 345

Query: 339  ITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQAL 398
            ITASAPE +IHNFLGK+TYKD++S+PLS+DNT+W NTVLAS+  CI C+VYTGR+TRQA+
Sbjct: 346  ITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAM 405

Query: 399  NTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTII 458
            NTT +  KTGLLELEIN +SKILCA VF LSI+LV FAGF+N+DWY+D+MRYLILFSTII
Sbjct: 406  NTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTII 465

Query: 459  PVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQL 518
            PVSLRVNLDL KSVYA++IEHD  I +TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQL
Sbjct: 466  PVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQL 525

Query: 519  KKIHLGTVSYTNETMDIVTDFIQXXXXXXXXX------XXXXXXKNISDRVIDLVTTLAI 572
            KKIHLGTVSYT+ET+DIV+D++                      K++S RV D+V TLAI
Sbjct: 526  KKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAI 585

Query: 573  CHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIK 632
            CHNVTPTFED ELTYQAASPDEIAIVKFTESVGLSLF+RDRHSISL H HSG  L Y+I 
Sbjct: 586  CHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHGHSGSILTYEIL 645

Query: 633  ILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRTL 692
             +FPFNSDSKRMG+I+ D+ K EYWF+QKGADTVM+ IV  NDWLEEET NMA EGLRTL
Sbjct: 646  QVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTL 705

Query: 693  VIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKD 752
            V+GRKKLS N+++QF+K+Y +ASL+M++R+  M  V+ K+LE DLELLGLTGVEDKLQ D
Sbjct: 706  VVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQND 765

Query: 753  VKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEY 812
            VKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH +TK+ KPEGAL+ LEY
Sbjct: 766  VKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEY 825

Query: 813  LQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGK 872
            L+VN+ +CLLIDGESLG++L+Y+  EFFD+V+ LPTVVACRCTPQQKADVA+ IR+ TGK
Sbjct: 826  LKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGK 885

Query: 873  RVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKS 932
            RVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT+FCHLT+LLLWHGRNSYK 
Sbjct: 886  RVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKR 945

Query: 933  SAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHDI 992
            SAKL+QF++HRGL+I++CQAVYSICS FEP+ LYQG+LMVGYATCYTMAPVFS+TLDHDI
Sbjct: 946  SAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDI 1005

Query: 993  DESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVA 1052
            +ESLT +YPELYK+LT GKSLS+KTFFVW ALS+FQGCVIQ  SQ F+SL + DFTKMVA
Sbjct: 1006 EESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVA 1065

Query: 1053 ISFTALVLNELIMVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFXXX 1112
            I FTAL+LNELIMV LEI TWNKIM  TE++T L Y+ S+PFLGEYFDL Y+ T +F   
Sbjct: 1066 IGFTALILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGE 1125

Query: 1113 XXXXXXXXXXXXWAAKSIY 1131
                        WAAK+I+
Sbjct: 1126 LLFILLVSVFPVWAAKAIH 1144

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 1581 bits (4094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 777/1140 (68%), Positives = 915/1140 (80%), Gaps = 41/1140 (3%)

Query: 18   SNQHQAQSTDRDSFDLQFEDSLDAALESLQL-PEHSHRRENS----------TVFEDFEM 66
            ++ H   S +  S D  FE+S D AL+++++ P   +  +NS           + E+FEM
Sbjct: 3    ASPHNLNSRNSVSLD-SFENSFDEALDNIEINPVRGYHIDNSLNNSNRITDFDIDENFEM 61

Query: 67   KSMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNSDRNAQN----TNNITVWSKA----- 117
            +S+  D +    H D D  PL+ + + +     NS  N  N    + ++T ++ +     
Sbjct: 62   RSVLEDEE----HFDNDGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIGVG 117

Query: 118  -KSWFEHSFTKAKXXXXXXXXXXXXXXVDGNKIELNDHNVEREIHPATTPIYDRKKYPSN 176
             K WF +  T                      + L D + ERE+HP TT +YDR ++PSN
Sbjct: 118  LKKWFVNVKTAISSGWKDY----------STSVALGDEHTEREVHPGTTQVYDRHRFPSN 167

Query: 177  VISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVT 236
             +SNAKYN  TF+P +LYEQFKFFFNLYFL+VALSQAIP LRIGYLSSY+VPLAFVLTVT
Sbjct: 168  EVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVT 227

Query: 237  MSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQT 296
            M+KEA DDI RR+RDRE+N ELYEV+ +P P+ SKDLKVGD+IK+ KGARVPAD+++LQ+
Sbjct: 228  MAKEASDDIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQS 287

Query: 297  NEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKIT 356
            +EP+GE+FIKTDQLDGETDWKLR+AC+LTQ+L E+DLL  ITITASAPE SIH+FLG++T
Sbjct: 288  SEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVT 347

Query: 357  YKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEING 416
            YKD+ +S L++DNT+W NTVLASS  CI C++YTGR+TRQA+NTT +K KTGLLELEIN 
Sbjct: 348  YKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEIND 407

Query: 417  LSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYK 476
            +SKILCACVF+LSI+LV FAG +N+DWYVDIMRYLILFSTIIPVSLRVNLDL KSVYA++
Sbjct: 408  ISKILCACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQ 467

Query: 477  IEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIV 536
            IEHDK I +TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG VSYT ET DIV
Sbjct: 468  IEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIV 527

Query: 537  TDFIQXXXXXXXXXXX-----XXXXKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAAS 591
            +D+IQ                    K+ +  VIDL+TTLAICHNVTPTFED ELTYQAAS
Sbjct: 528  SDYIQGMIESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAAS 587

Query: 592  PDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDK 651
            PDEIAIVKFTESVGLSLF+RDRHS+SL H+HSG  L YD+  +FPFNSD+KRMG+I++DK
Sbjct: 588  PDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDK 647

Query: 652  LKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEY 711
             K +YWFLQKGADTVM+ IV  NDWLEEET NMA EGLRTLVIGRKKL+  ++EQF+KEY
Sbjct: 648  QKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEY 707

Query: 712  SEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 771
             E S +M +RE  M N + K+LE+DLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT
Sbjct: 708  EEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 767

Query: 772  GDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLY 831
            GDKVETARCVSISAKLISRGQYVH VTK++KPEGA + LEYL+VN+N+CLLIDGESLG++
Sbjct: 768  GDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMF 827

Query: 832  LQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCAD 891
            L+Y+  EFFD+VV+LPTV+ACRCTPQQKADVA+ IR+ TGKRVCCIGDGGNDVSMIQCAD
Sbjct: 828  LKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCAD 887

Query: 892  VGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQ 951
            VGVGIVGKEGKQASLAADFSITQFCHLT+LLLWHGRNSYK SAKL+QFV+HRGLII++CQ
Sbjct: 888  VGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQ 947

Query: 952  AVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPELYKELTLGK 1011
            AV+S+CS FEP+ALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLT +YPELYK+LT GK
Sbjct: 948  AVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGK 1007

Query: 1012 SLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNELIMVGLEIN 1071
            SLS+KTFFVWVALS +QG VIQ  SQ FTSL + DFTKMVAI FTAL+ NELIMV LEI 
Sbjct: 1008 SLSYKTFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIY 1067

Query: 1072 TWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFXXXXXXXXXXXXXXXWAAKSIY 1131
            TWNK M ITE+VTL IY+ S+PFLGEYFDL Y+ST KF               W  K+IY
Sbjct: 1068 TWNKTMIITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIY 1127

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 1538 bits (3983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 771/1160 (66%), Positives = 903/1160 (77%), Gaps = 40/1160 (3%)

Query: 1    MSFSPPPGSQIPNKY-------SKSNQHQAQSTDR---------DSFDLQFEDSLDAALE 44
            MSF+PPP +     Y       S   Q    S+ R         DSF+L+F+DSLDAALE
Sbjct: 1    MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRARQERRGSLDSFELEFDDSLDAALE 60

Query: 45   SLQLPEHSHRRENSTV--FEDFEMKSM----HGDHQTGMLHSDADTAPLITNHS---NNG 95
            SLQ+   +    +S +   EDFE+KSM     G H    + ++ DT PLI+  S      
Sbjct: 61   SLQIKRSASHERHSGIRGAEDFELKSMGRVDDGGHSPSGVLTNQDTQPLISQDSWDYGQV 120

Query: 96   RMLSNSDRNAQNTNNITVWSKAKSWFEHSFTKAKXXXXXXXXXXXXXXVDGNKIELNDHN 155
            + L +     Q++     W + KSW       AK                 + IEL D +
Sbjct: 121  KRLRSGWLGPQSS-----WQRLKSWV---LPGAKAGAPLLGVTATYSST--HSIELTDQH 170

Query: 156  VEREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIP 215
            V+REIH  TTPIYD++KYP+N ISNAKYN  TF+P++LYEQFKFFFNLYFL+V+LSQ+IP
Sbjct: 171  VDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIP 230

Query: 216  QLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKV 275
             LRIGYLSSYIVPLAFVL VTMSKEAMDDI RR+RDRE NNELYEV+N    +PSK+L+V
Sbjct: 231  ALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRV 290

Query: 276  GDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLN 335
            GD++KL K +R+PAD+++LQ++EP+GE+F+KTDQLDGETDWKLR+A SLTQ+LT++++L 
Sbjct: 291  GDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLT 350

Query: 336  NITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETR 395
             + ITASAPE SIH F GK+TYK S S+PLSVDNT+W NTVLASS  C+ C++YTG +TR
Sbjct: 351  KVHITASAPEKSIHMFTGKLTYKGS-SAPLSVDNTLWANTVLASSGTCVACVIYTGTDTR 409

Query: 396  QALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFS 455
            QA+NT+KS  KTGLLELEIN LSKILC CVF LSI+LV   G +++ WYVDIMRYLILFS
Sbjct: 410  QAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFS 469

Query: 456  TIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 515
            TIIPVSLRVNLDLGKSVYA +IE DK I DTIVRTSTIPEDLGRIEYLLSDKTGTLTQND
Sbjct: 470  TIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 529

Query: 516  MQLKKIHLGTVSYTNETMDIVTDFIQXXXX----XXXXXXXXXXXKNISDRVIDLVTTLA 571
            MQL+KIHLGTVSYT ETMD+VTD+IQ                   K +S RV DLV TLA
Sbjct: 530  MQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLA 589

Query: 572  ICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDI 631
             CHNVTP FED EL YQAASPDEIAIVKFTE VGLSLF+RDRHS++LFH++SG+ L+YDI
Sbjct: 590  TCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDI 649

Query: 632  KILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRT 691
              +FPF SD+KRMG+I+ D+ K E WFLQKGADTVMS IV  NDWLEEE SNMA EGLRT
Sbjct: 650  LHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNMAREGLRT 709

Query: 692  LVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQK 751
            LVI RKKLST L+EQF KEY +ASL+M++R+  M  VV++ LE++LELLGLTGVEDKLQK
Sbjct: 710  LVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQK 769

Query: 752  DVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLE 811
            DVK+SIELLRNAG+KIWMLTGDKVETARCV +SAKLISRGQYVHT+TK+ + +GAL  LE
Sbjct: 770  DVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLE 829

Query: 812  YLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATG 871
            YL+ N+NSCLLIDG+SL +Y+ ++  EFF+IV+ LP V+ACRCTPQQKADVA+ IR+ TG
Sbjct: 830  YLKANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTG 889

Query: 872  KRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYK 931
            KRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD+SITQFCHLTKLLLWHGRNSYK
Sbjct: 890  KRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYK 949

Query: 932  SSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHD 991
             SAKLSQFVIHRGL+ISVCQAVYSI S  +P+ALYQGWLMVGYATCYTMAPVFSLTLDHD
Sbjct: 950  RSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTLDHD 1009

Query: 992  IDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMV 1051
            IDESLT  YPELYKELT G+SLS+KTFFVWV LS+FQG VIQ  SQ F  +    F KMV
Sbjct: 1010 IDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGSEVFKKMV 1069

Query: 1052 AISFTALVLNELIMVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFXX 1111
            A+SFTALV+NELIMV LEI TWNK MAI+E+VT  IY+ SIP LGEYFDL+ +    F  
Sbjct: 1070 ALSFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLALPFFI 1129

Query: 1112 XXXXXXXXXXXXXWAAKSIY 1131
                         WAAK+I+
Sbjct: 1130 QLTIILTVSIFPVWAAKTIH 1149

>Scas_89.1
          Length = 271

 Score =  452 bits (1163), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 208/255 (81%), Positives = 240/255 (94%)

Query: 704 FEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNA 763
           +++FEKEY +ASL+M++ +  M +V++K LE++LELLGLTGVEDKLQ DVKSSIELLRNA
Sbjct: 2   YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 764 GIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLI 823
           G+KIWMLTGDKVETARCVSISAKLISRGQYVHTVTK+++PEGAL+ LEYL++N++SCLLI
Sbjct: 62  GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLI 121

Query: 824 DGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGND 883
           DGESLG++L Y+  EFFDIVV+LP V+ACRCTPQQKADVA+ IR+ TGKRVCCIGDGGND
Sbjct: 122 DGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGND 181

Query: 884 VSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHR 943
           VSMIQCADVGVGIVGKEGKQASLAADFS+TQFCHLTKLLLWHGRNSYK SAKL+QFVIHR
Sbjct: 182 VSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHR 241

Query: 944 GLIISVCQAVYSICS 958
           GLIISVCQAVYS+CS
Sbjct: 242 GLIISVCQAVYSVCS 256

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  436 bits (1120), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 322/1003 (32%), Positives = 499/1003 (49%), Gaps = 76/1003 (7%)

Query: 170  RKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPL 229
            R  Y  N IS  KYN  TF+P  L+++F  + NL+FL  ++ Q +P +      + I  L
Sbjct: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258

Query: 230  AFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCP--IPSK--DLKVGDIIKLKKGA 285
              VL V+  KE+++D+ R   D+E N+ L +V+++     +  K  D+ VGDII+++   
Sbjct: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318

Query: 286  RVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNI--TITASA 343
             +PAD+++L ++EP G  +I+T  LDGET+ K++ A   T +  +   L  +   + +  
Sbjct: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378

Query: 344  PEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKS 403
            P  S++ + G +T   ST  PLS D  +     L ++A     IV+TG ET+   N T +
Sbjct: 379  PNSSLYTYEGTMTLNGSTF-PLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437

Query: 404  KAKTGLLELEINGLSKILCACVFLLSIMLVAFAG---FNNND-----------------W 443
              K   +E  IN   +IL     L+ + L++  G       D                 +
Sbjct: 438  PIKRTAVERVIN--MQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLF 495

Query: 444  YVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIE------HDKQIEDTIVRTSTIPEDL 497
            + DI+ + ILFS ++P+SL V +++ K   AY I       H++    T+VRTS++ E+L
Sbjct: 496  FKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEEL 555

Query: 498  GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY----TNETMDIVTDFIQXXXXXXXXXXXX 553
            G+IEY+ SDKTGTLT+N M+ K + +    Y      +    V D I+            
Sbjct: 556  GQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDK 615

Query: 554  XXXKNISDR--VIDLVTTLAICHNVTP-TFEDGELTYQAASPDEIAIVKFTESVGLSLFR 610
                   +   VI+ +T LA CH V P T  DG + YQAASPDE A+V+    +G     
Sbjct: 616  MTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDI 675

Query: 611  RDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSI 670
            R  +S+S+    S  +LEY +  +  FNS  KRM  I F           KGADTV   I
Sbjct: 676  RRPNSVSISTPFS-EQLEYQLLNICEFNSTRKRMSAI-FRMPDGSIKLFCKGADTV---I 730

Query: 671  VVR-----NDWLEEETSNM---ATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDRE 722
            + R     N +++    ++   A EGLRTL I  + +    +E++ K Y  AS TM DR 
Sbjct: 731  LERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRT 790

Query: 723  VHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVS 782
              +     + +E+DL  LG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD+ ETA  + 
Sbjct: 791  EELDRAA-ELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIG 849

Query: 783  ISAKLISRGQYVHTVTKVNKP------EGALHHLEYLQVNQNS----CLLIDGESLGLYL 832
            +S +L+S    +  V +  K       +  L+ +E  Q++Q       L+IDG+SLG  L
Sbjct: 850  MSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYAL 909

Query: 833  QY-FPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCAD 891
            +    D+F  I      V+ CR +P QKA V   +++ T   +  IGDG NDVSMIQ A 
Sbjct: 910  EEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAH 969

Query: 892  VGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQ 951
            VGVGI G EG QA+ +ADF+I QF  L KLL+ HG  SY+  +    +  ++ + + + Q
Sbjct: 970  VGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQ 1029

Query: 952  AVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTTLYPELYKELTLG 1010
              Y   + F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK    G
Sbjct: 1030 FWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKG 1089

Query: 1011 KSLSFKTFFVWVALSVFQGCVIQMASQFF----TSLNDSDFTKMVAISFTALVLNELIMV 1066
            +  S   F+ WV    +   V+ + S  F      LN    T    +    +    +I+V
Sbjct: 1090 QFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIV 1149

Query: 1067 ----GLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVS 1105
                 L  + W K   +    +L+I+L   PF    F    VS
Sbjct: 1150 LGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVS 1192

>Kwal_26.7070
          Length = 1315

 Score =  430 bits (1105), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 321/1009 (31%), Positives = 499/1009 (49%), Gaps = 70/1009 (6%)

Query: 152  NDHNVEREIHPATTPIYDR-----KKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFL 206
            ND++ + +  P    I D+     + + SN IS  KYN  TFIP  L+++F  + NL+FL
Sbjct: 171  NDYSDDDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFL 230

Query: 207  IVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPC 266
              +  Q +P +      + I  L  VL V+  KE ++D+ R + D E N+   +V ++  
Sbjct: 231  FTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQL 290

Query: 267  P--IPSK--DLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLAC 322
                 SK  ++ VGDIIK+     +PADV+V+ ++EP G  +I+T  LDGET+ K++ A 
Sbjct: 291  QDFTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQAR 350

Query: 323  SLTQSLTENDLLNNI--TITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASS 380
              T    + D L  +   + +  P  S++ + G +       S LS +  +     L ++
Sbjct: 351  IETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNIS-LSPEQMVLRGATLRNT 409

Query: 381  AACICCIVYTGRETRQALNTTKSKAKTGLLELEIN----GLSKILCACVFLLSI------ 430
            A     +V+TG ET+   N T +  K   +E  IN     L  +L     + SI      
Sbjct: 410  AWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKV 469

Query: 431  -------MLVAFAGFNN-NDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQ 482
                     +   G N    ++ DI+ Y ILFS ++P+SL V +++ K   AY I  D  
Sbjct: 470  TSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLD 529

Query: 483  IED------TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTN----ET 532
            + D      T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y      + 
Sbjct: 530  LYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDK 589

Query: 533  MDIVTDFIQXXXXXXXXXXXXXXXKNISDRVI--DLVTTLAICHNVTPTF-EDGELTYQA 589
                 D I+                   D  I  D +T LA CH V P F EDG + YQA
Sbjct: 590  AATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQA 649

Query: 590  ASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIF 649
            ASPDE A+V+   S+G     R  +S+S+  +  G + EY +  +  FNS  KRM  I F
Sbjct: 650  ASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAI-F 708

Query: 650  DKLKQEYWFLQKGADTVMSSIVV--RNDWLEEETSNM---ATEGLRTLVIGRKKLSTNLF 704
                 E     KGADTV+   +    N ++E    ++   A EGLRTL +  + ++ + +
Sbjct: 709  RLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEY 768

Query: 705  EQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAG 764
             +++  Y  AS T+ DR   + +   + +E DL LLG T +EDKLQ  V  +I  L++AG
Sbjct: 769  AEWKDIYDAASTTLDDRAQKLDDAA-ELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAG 827

Query: 765  IKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYL------QVNQN 818
            IK+W+LTGD+ ETA  + +S +L+S    +  + + +K     +  E L      Q++Q 
Sbjct: 828  IKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQ 887

Query: 819  S----CLLIDGESLGLYLQYFPDEFFDIVVNL-PTVVACRCTPQQKADVAVFIRQATGKR 873
                  L+IDG+SLG  L+   +++   +  L   V+ CR +P QKA V   +++ T   
Sbjct: 888  DMNSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSL 947

Query: 874  VCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSS 933
            +  IGDG NDVSMIQ A VGVGI G EG QA+ +ADF+I QF +L KLLL HG  SY+  
Sbjct: 948  LLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRI 1007

Query: 934  AKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSL-TLDHDI 992
            ++   +  ++ + + + Q  Y   + +   ++ + W M  Y   +T+ P F +   D  +
Sbjct: 1008 SQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFV 1067

Query: 993  DESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFF----TSLNDSDFT 1048
               L   YP+LYK    G+  S + F+ WV    +   V  + S  F      LN    T
Sbjct: 1068 SSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGET 1127

Query: 1049 K-MVAISFTALVLNELIMVG---LEINTWNKIMAITEVVTLLIYLGSIP 1093
                A   +    + +I++G   L  N W K  A     +L+ +L   P
Sbjct: 1128 ADHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFP 1176

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  428 bits (1100), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 321/1028 (31%), Positives = 501/1028 (48%), Gaps = 73/1028 (7%)

Query: 147  NKIELNDHNVEREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFL 206
            N  +  D    REIH +     +R  Y  N IS  KYN  TF+P  L+++F  + NL+FL
Sbjct: 155  NTSDGQDSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFL 214

Query: 207  IVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANN---ELY-EVV 262
              +  Q +P +      + I  L  VL V+  KE+++D+ R   D E NN   E+Y E  
Sbjct: 215  CTSAIQQVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAE 274

Query: 263  NKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLAC 322
                     D+KVGDII++     +PAD+++L ++EP G  +I+T  LDGET+ K++ A 
Sbjct: 275  GDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQAR 334

Query: 323  SLTQSLTENDLLNNI--TITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASS 380
            + T  + ++  L NI   I++  P  S++ + G +   + T  PLS +  +     L ++
Sbjct: 335  TETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEM-NGTKIPLSPEQMILRGATLRNT 393

Query: 381  AACICCIVYTGRETRQALNTTKSKAKTGLLELEIN----GLSKILCACVFLLSIMLVAFA 436
                  +++TG ET+   N T +  K   +E  IN     L  +L   + + SI  V  +
Sbjct: 394  GWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMS 453

Query: 437  -------------GFNNND-WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQ 482
                         G N    ++ D + + ILFS ++P+SL V ++L K   A+ I  D  
Sbjct: 454  TADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLD 513

Query: 483  I------EDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMD-- 534
            +        T+V+TS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  
Sbjct: 514  LYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDK 573

Query: 535  --IVTDFIQXXXXXXXXXXXXXXXKNISDRVID-LVTTLAICHNVTPTFE-DGELTYQAA 590
                 D I+                +   ++ID  +T LA CH V P F+ DG + YQAA
Sbjct: 574  AATFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAA 633

Query: 591  SPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIF- 649
            SPDE A+V+    +G     R  +S+++  +    + EY +  +  FNS  KRM  I   
Sbjct: 634  SPDEGALVEGGALLGYKFLIRKPNSVTILINEEEER-EYQLLNICEFNSTRKRMSAIFRF 692

Query: 650  --DKLKQEYWFLQKGADTVMSSIVVR--NDWLEEETSNM---ATEGLRTLVIGRKKLSTN 702
              D +K     L KGAD+V+   +    N +++  T ++   ATEGLRTL +  K +  +
Sbjct: 693  PDDSIK----LLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPED 748

Query: 703  LFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRN 762
             +  + K+Y +A+ T +D      + V + +E+ L L+G T +EDKLQ+ V  +I  L+ 
Sbjct: 749  EYNAWNKKYMDAA-TTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQE 807

Query: 763  AGIKIWMLTGDKVETARCVSISAKLISR-------GQYVHTVTKVNKPE--GALHHLEYL 813
            AGIKIW+LTGDK ETA  + +S +L+S         +     T+ N  E   ALH     
Sbjct: 808  AGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLS 867

Query: 814  QVNQNS-CLLIDGESLGLYLQY-FPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATG 871
            + + N+  L+IDG SL   L+    D F  I      V+ CR +P QKA V   +++ T 
Sbjct: 868  EHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTN 927

Query: 872  KRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYK 931
              +  IGDG NDVSMIQ A VGVGI G EG QA+ +AD S+ QF  L KLLL HG  SY+
Sbjct: 928  SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQ 987

Query: 932  SSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSL-TLDH 990
              +    +  ++   + + Q  Y   + F   ++ + W M  Y   +T+ P F +   D 
Sbjct: 988  RISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQ 1047

Query: 991  DIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLN------- 1043
             ++  L   YP+LYK    G+  S   F+ W+    +   V+ + +  F           
Sbjct: 1048 FVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHG 1107

Query: 1044 --DSDFTKMVAISFTALVLNELIMVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDL 1101
                 ++  +AI +T+ V+  L    L  N W K        +L  +L   P  G  F  
Sbjct: 1108 ETADHWSWGIAI-YTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPY 1166

Query: 1102 SYVSTTKF 1109
            + +S   F
Sbjct: 1167 AKISREYF 1174

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  420 bits (1079), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 309/995 (31%), Positives = 489/995 (49%), Gaps = 65/995 (6%)

Query: 173  YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232
            Y  N IS  KYN  TF+P  L+++F  + NL+FL  +  Q +P +      + I  L  V
Sbjct: 198  YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257

Query: 233  LTVTMSKEAMDDINRRKRDREANNELYEVVNKPCP--IPSK--DLKVGDIIKLKKGARVP 288
            L V+  KE ++DI R   D+E NN   E+ ++     +  +  D++VGDII++K    +P
Sbjct: 258  LIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPIP 317

Query: 289  ADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNIT--ITASAPEH 346
            AD ++L ++EP G  +I+T  LDGET+ K++ +   T    +   L N+   + +  P  
Sbjct: 318  ADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPNS 377

Query: 347  SIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAK 406
            S++ + G +T  D    PLS D  +     L ++A     +++TG ET+   N T +  K
Sbjct: 378  SLYTYEGTMTLNDR-QIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIK 436

Query: 407  TGLLELEING----LSKILCACVFLLSIMLVAFA-------------GFNNND-WYVDIM 448
               +E  IN     L  +L   + + SI  V  +             G N    ++ D +
Sbjct: 437  RTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLYLEGTNKAGLFFKDFL 496

Query: 449  RYLILFSTIIPVSLRVNLDLGKSVYAYKIEHD------KQIEDTIVRTSTIPEDLGRIEY 502
             + ILFS ++P+SL V ++L K   A+ I  D      K    T+VRTS++ E+LG+IEY
Sbjct: 497  TFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEY 556

Query: 503  LLSDKTGTLTQNDMQLKKIHLGTVSYTNETMD----IVTDFIQXXXXXXXXXXXXXXXKN 558
            + SDKTGTLT+N M+ K   +    Y ++  +     V D I+                +
Sbjct: 557  IFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKFDDLKKKLNDPS 616

Query: 559  ISDRVI--DLVTTLAICHNVTPTFE-DGELTYQAASPDEIAIVKFTESVGLSLFRRDRHS 615
              D  I  D +T LA CH V P F+ DG + YQAASPDE A+V+    +G     R  +S
Sbjct: 617  DEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGYKFIIRKGNS 676

Query: 616  ISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIV--VR 673
            +++  + +G + EY +  +  FNS  KRM  I F           KGADTV+   +    
Sbjct: 677  VTVLLEETGEEKEYQLLNICEFNSTRKRMSAI-FRFPDGSIKLFCKGADTVILERLDDEA 735

Query: 674  NDWLEEETSNM---ATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVR 730
            N ++E    ++   A+EGLRTL +  + +S   +E++   Y+EA+ T+ +R   +     
Sbjct: 736  NQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAA- 794

Query: 731  KFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 790
              +E +L L+G T +EDKLQ  V  +I  L+ AGIKIW+LTGD+ ETA  + +S +L+S 
Sbjct: 795  NLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSE 854

Query: 791  GQ---YVHTVTKVNKPEGALHHLEYLQVNQNS-------CLLIDGESLGLYLQYFPDEFF 840
                  ++  T+ +     L  +  L  +Q S        L+IDG+SLG  L+   +++ 
Sbjct: 855  DMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYL 914

Query: 841  DIVVNL-PTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGK 899
              V  L   V+ CR +P QKA V   +++ +   +  I  G NDVSMIQ A VGVGI G 
Sbjct: 915  LTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGM 974

Query: 900  EGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSM 959
            EG QA+ +AD ++ QF  L KLLL HG  SY+  +    +  ++   + + Q  Y   + 
Sbjct: 975  EGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANA 1034

Query: 960  FEPLALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTTLYPELYKELTLGKSLSFKTF 1018
            F   ++ + W M  Y   +T+ P F +   D  +   L   YP+LYK    G+  S   F
Sbjct: 1035 FSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIF 1094

Query: 1019 FVWVALSVFQGCVIQMAS----QFFTSLND----SDFTKMVAISFTALVLNELIMVGLEI 1070
            + W+    F   ++ + +    ++  +LN     +D        +T  V+  L    L  
Sbjct: 1095 WGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVT 1154

Query: 1071 NTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVS 1105
            N W K   I    +LL +L   P     F  + +S
Sbjct: 1155 NQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANIS 1189

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  397 bits (1019), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 281/864 (32%), Positives = 445/864 (51%), Gaps = 58/864 (6%)

Query: 173  YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232
            Y  N IS  KYN  TF+P  L+++F  + NL+FL  ++ Q +P +      + I  L  V
Sbjct: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVV 253

Query: 233  LTVTMSKEAMDDINRRKRDREANNELYEVVNKPCP--IPSK--DLKVGDIIKLKKGARVP 288
            L V+  KE+++D+ R   D+E N+   +V +      I  K  D+ VGDII+++    +P
Sbjct: 254  LVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313

Query: 289  ADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNI--TITASAPEH 346
            AD++VL ++EP G  +I+T  LDGET+ K++ A   T  + +   L+ +   I +  P  
Sbjct: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373

Query: 347  SIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAK 406
            S++ + G +   ++   PLS D  +     L ++      +++TG ET+   N T +  K
Sbjct: 374  SLYTYEGTMILHNN-RIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432

Query: 407  TGLLE----LEINGLSKILCACVFLLSIMLVAFAGFNNND---------------WYVDI 447
               +E    L+I  L  +L  C+ L+S        +N  +               ++ +I
Sbjct: 433  RTAVERVINLQIVALFGVLI-CLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNI 491

Query: 448  MRYLILFSTIIPVSLRVNLDLGKSVYAYKIE------HDKQIEDTIVRTSTIPEDLGRIE 501
            + + ILFS ++P+SL V +++ K   AY I       H++    T+VRTS++ E+LG+IE
Sbjct: 492  LTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIE 551

Query: 502  YLLSDKTGTLTQNDMQLKKIHLGTVSYTN---ETMDIVTD-FIQXXXXXXXXXXXXXXXK 557
            Y+ SDKTGTLTQN M+ K   +    Y     E  D   D  I+                
Sbjct: 552  YIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELLHTP 611

Query: 558  NISDRVI--DLVTTLAICHNVTPTF-EDGELTYQAASPDEIAIVKFTESVGLSLFRRDRH 614
               D  I  + +T L+ICH V P F E+G + YQAASPDE A+V+    +G     R  +
Sbjct: 612  GSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIRKPN 671

Query: 615  SISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSS--IVV 672
            S+++  +    ++ Y++  +  FNS  KRM  I F         L KGADTV+       
Sbjct: 672  SVTILREDITEEVVYELLNICEFNSTRKRMSAI-FRFPDNSIRLLCKGADTVILERLAAT 730

Query: 673  RNDWLEEETSNM---ATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVV 729
             N ++     ++   A EGLRTL I  + +  + +E++ K Y  A+ TM +R   +  V 
Sbjct: 731  SNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVA 790

Query: 730  RKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLIS 789
             + +E  L LLG T +EDKLQ  V  +I  L+ AGIK+W+LTGD+ ETA  + +S KL+S
Sbjct: 791  -EMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLS 849

Query: 790  RGQYVHTVTKVNKPEGALHHLEYL------QVNQNS----CLLIDGESLGLYLQYFPDEF 839
                +  V +  K     + ++ L      Q++Q       L+IDG+SLG  L+   +EF
Sbjct: 850  EDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEF 909

Query: 840  FDIVVNL-PTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVG 898
               +  +   V+ CR +P QKA V   +++ T   +  IGDG NDVSMIQ A VGVGI G
Sbjct: 910  LLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISG 969

Query: 899  KEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICS 958
             EG QA+ +ADF++ QF +L KLLL HG  SY+  ++   +  ++ + + + Q  Y + +
Sbjct: 970  MEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYN 1029

Query: 959  MFEPLALYQGWLMVGYATCYTMAP 982
             F   ++ + W +  Y    T AP
Sbjct: 1030 AFSGQSIMESWTLTFYNWGGTAAP 1053

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  322 bits (826), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 250/932 (26%), Positives = 441/932 (47%), Gaps = 143/932 (15%)

Query: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328
            K +KVGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R  L C+ T   
Sbjct: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458

Query: 329  TENDLLNNITITASAPEHSIHNFLGKITYKDST-----SSPLSVDNTMWENTVLASSAAC 383
            +++       I +  P  +++ + G + +++       + P++++N +     L ++   
Sbjct: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518

Query: 384  ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLL--------------- 428
            +  +++TG +T+  LN+  +  K   +  E+N    I    +F+L               
Sbjct: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578

Query: 429  -----SIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQI 483
                 S      AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638

Query: 484  EDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIVT 537
             +  +      ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY     + + 
Sbjct: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698

Query: 538  DFIQXXXXXXXXXXXXXXXKNISDR--VIDLVTTL------------------------- 570
               +               +   DR  +ID +  L                         
Sbjct: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758

Query: 571  ----------------AICHNV----TPTFEDGELTYQAASPDEIAIVKFTESVGLSLFR 610
                            A+CH+V     P     +L  +A SPDE A+V     VG S   
Sbjct: 759  SGEVQQRCCEHFMLALALCHSVLVEANPD-NPKKLDLKAQSPDEAALVATARDVGFSFVG 817

Query: 611  RDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKL-------KQEYWFLQKGA 663
            + +  + +  +  G++ E++I  +  FNS  KRM  I+  K+       +     + KGA
Sbjct: 818  KTKKGLII--EMQGIQKEFEILNILEFNSSRKRMSCIV--KIPGLNPGDEPRALLICKGA 873

Query: 664  DTVMSSIVVRNDWLEEET---------SNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEA 714
            D+++ S + R      E             ATEGLRTL I +++LS + +E++ ++Y  A
Sbjct: 874  DSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIA 933

Query: 715  SLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK 774
            + ++ +RE  ++ VV   +E +L LLG T +ED+LQ  V   IELL  AGIK+W+LTGDK
Sbjct: 934  AASLANREDELE-VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDK 992

Query: 775  VETARCVSISAKLISRGQYVHTVTKV--------NKPEGALHHL------EYLQV----- 815
            VETA  +  S  L++    +  +           ++P   +  L      EY  +     
Sbjct: 993  VETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEE 1052

Query: 816  ------------NQNSCLLIDGES--LGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKAD 861
                          N  ++IDG++  L LY +    +F  +  N   V+ CR +P QKA 
Sbjct: 1053 EIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAA 1112

Query: 862  VAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKL 921
            V   ++ +       IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +L +L
Sbjct: 1113 VVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARL 1172

Query: 922  LLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMA 981
            +L HGR SYK  A++     ++ +I ++    Y I + F+   LY+   M+ Y   +T  
Sbjct: 1173 VLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSL 1232

Query: 982  PVFSL-TLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFT 1040
            PV  L  LD D++++++ + P+LY+   L K  + + F  ++   ++Q  +      FF 
Sbjct: 1233 PVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII----CFFFP 1288

Query: 1041 SLNDSDFTKMVAISFTALVLNELIMVGLEINT 1072
             L    + K + ++   L L+    VG+ + T
Sbjct: 1289 YLV---YHKNMIVTSNGLGLDHRYFVGVYVTT 1317

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 102/257 (39%), Gaps = 40/257 (15%)

Query: 13  NKYSKS----NQHQAQSTDRDSFDLQFEDSLDAALESLQ-LPEHSHRRENSTVFEDFEMK 67
           NKYS+     N    ++   D+ +  F D  +    S Q  P+ ++    S  F+D E+ 
Sbjct: 45  NKYSRPQVSFNDETPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNN---GSGTFDDVEL- 100

Query: 68  SMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNSDRNAQNTNNITVWSKAKSW------- 120
               D+ +G  H         TN+    R    + RN +  N I   SK   W       
Sbjct: 101 ----DNDSGEPH---------TNYDGMKRFRMGTKRNKKG-NPIMGRSKTLKWARKNIPN 146

Query: 121 -FEHSFTKAKXXXXXXXXXXXXXXVDGNKIELNDHNVEREIHPATTPIYDRKKYPSNVIS 179
            FE  FTK                V  N + L    ++ E +P         +YP N I 
Sbjct: 147 PFE-DFTKDDIDPGAINRAQELRTVYYN-MPLPKDMIDEEGNPIM-------QYPRNKIR 197

Query: 180 NAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSK 239
             KY P TF+P  +  QF  F N+YFL++ +  A     +       VPL  ++ +T  K
Sbjct: 198 TTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIK 257

Query: 240 EAMDDINRRKRDREANN 256
           +A++D  R   D E NN
Sbjct: 258 DAIEDSRRTVLDLEVNN 274

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  310 bits (795), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 251/891 (28%), Positives = 434/891 (48%), Gaps = 138/891 (15%)

Query: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328
            K++KVGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R  L CS     
Sbjct: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503

Query: 329  TENDLLNNITITASAPEHSIHNFLGKITYKDSTSS-----PLSVDNTMWENTVLASSAAC 383
            + +       + +  P  +++++ G   ++D+ +      P++++N +     L ++   
Sbjct: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563

Query: 384  ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDW 443
            +  +++TG +T+  +N   +  K   +  E+N  S IL    F+L  +L   AG  N  +
Sbjct: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619

Query: 444  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEH 479
            Y                        V     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679

Query: 480  DKQIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETM 533
            D  + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739

Query: 534  DIVTDFIQXXXXXXXXXXXXXXXKNISDR--VIDLVTTLA-------------------- 571
            + +    +               +   DR  +ID + +++                    
Sbjct: 740  EALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVED 799

Query: 572  ---------------------ICHN--VTPTFED-GELTYQAASPDEIAIVKFTESVGLS 607
                                 +CH+  V P  +D  +L  +A SPDE A+V     +G S
Sbjct: 800  LKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYS 859

Query: 608  LFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVII-----FDKLKQEYWFLQKG 662
                 +    L  +  G++ E+ +  +  FNS  KRM  II       K + +   + KG
Sbjct: 860  FVGSSKS--GLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKG 917

Query: 663  ADTVMSSIVVR--NDW-LEEETS----NMATEGLRTLVIGRKKLSTNLFEQFEKEYSEAS 715
            AD+V+ S + R  ND  L E+T+      ATEGLRTL + +++L+ + +E++ K Y  A+
Sbjct: 918  ADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAA 977

Query: 716  LTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 775
             ++ +RE  +  V    +E +L LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDKV
Sbjct: 978  ASVTNREEELDKVT-DVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKV 1036

Query: 776  ETARCVSISAKLI----------SRGQYV------------HTVTKVNKPE----GALHH 809
            ETA  +  S  ++          + G+ V            + VTK  + +    G+   
Sbjct: 1037 ETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEE 1096

Query: 810  L-----EYLQVNQNSCLLIDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTPQQKADV 862
            L     E+     N  ++IDG++L + L  +    +F  +  N   V+ CR +P QKA V
Sbjct: 1097 LKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAV 1156

Query: 863  AVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLL 922
               +++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++T+L+
Sbjct: 1157 VKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1216

Query: 923  LWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAP 982
            L HG+  YK  A++     ++ +I ++    Y I + F+   L++   +  Y   +T  P
Sbjct: 1217 LVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVP 1276

Query: 983  VFSLT-LDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVAL-SVFQGCV 1031
            V  L  LD D+ ++++ L P+LY+   L K  + +T F+W  L  V+Q  +
Sbjct: 1277 VILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYMLDGVYQSVI 1326

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 41/84 (48%)

Query: 173 YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232
           YP N I   KY P TF P  +  QF  F N+YFLI+ +  A     +       VPL  +
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 233 LTVTMSKEAMDDINRRKRDREANN 256
           + +T  K+ ++D  R   D E NN
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNN 312

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  296 bits (758), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 240/899 (26%), Positives = 419/899 (46%), Gaps = 134/899 (14%)

Query: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328
            K +KVGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R  L CS     
Sbjct: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454

Query: 329  TENDLLNNITITASAPEHSIHNFLGKITYKDSTSS-----PLSVDNTMWENTVLASSAAC 383
            + +       I +  P  +++++ G + +KDST++     P++++N +     L ++   
Sbjct: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514

Query: 384  ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIM------------ 431
            +  +V+TG +T+  LN   +  K   +  E+N    I    +F+L  +            
Sbjct: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574

Query: 432  --------LVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQI 483
                        AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634

Query: 484  EDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIVT 537
             +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     + + 
Sbjct: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694

Query: 538  DFIQXXXXXXXXXXXXXXXKNISDRVIDLVTTLAICHNVTPTFEDGELTY---------- 587
               +               +   DR + ++  L    N T  F D E+T+          
Sbjct: 695  GLRKRQGIDVEAEGRREKEEIAKDRDV-MINDLRNLSNNTQFFPD-EITFISKEIVQDFK 752

Query: 588  ----------------------------QAASPDEIAI-VKFTESVGLSLFRRDRHSISL 618
                                           +P+++ +  +  +   L    RD     +
Sbjct: 753  GRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFM 812

Query: 619  FHDHSGMKLE-------YDIKILFPFNSDSKRMGVII-----FDKLKQEYWFLQKGADTV 666
                +GM +E       ++I  +  FNS  KRM  II         +     + KGAD+V
Sbjct: 813  GKTKTGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSV 872

Query: 667  MSSIVVRNDWLEEET---------SNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLT 717
            + S +       +ET            ATEGLRTL + +++L+ + + ++   Y  A+ +
Sbjct: 873  IYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAAS 932

Query: 718  MMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 777
            + +RE  ++ +V   +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDKVET
Sbjct: 933  LTNREEQLE-IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVET 991

Query: 778  ARCVSISAKLISRGQYVHTVTKVNK--------PEGALHHL--EYLQ------------- 814
            A  +  S  L++    +  V    +        P   ++ L  +YL+             
Sbjct: 992  AINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELD 1051

Query: 815  --------VNQNSCLLIDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTPQQKADVAV 864
                       +  ++IDG++L + L       +F  +  N   V+ CR +P QKA V  
Sbjct: 1052 NAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVK 1111

Query: 865  FIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLW 924
             ++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I QF +LT+LLL 
Sbjct: 1112 LVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV 1171

Query: 925  HGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVF 984
            HGR SYK  +++     ++ +I ++    Y I + F+   L++   ++ Y   +T  PV 
Sbjct: 1172 HGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVI 1231

Query: 985  SL-TLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSL 1042
             L  LD D++++++ + P+LY+   L    + +T F+W    +F G    +   FF  L
Sbjct: 1232 LLGILDQDVNDTISLVVPQLYRVGILRLEWN-QTKFLWY---MFDGLYQSVICFFFPYL 1286

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (50%)

Query: 172 KYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAF 231
           +YP N I   KY P +F P  L  QF+ F N+YFL++ +  A     +       VPL  
Sbjct: 183 EYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIV 242

Query: 232 VLTVTMSKEAMDDINRRKRDREANN 256
           ++ +T  K+ ++D  R   D E NN
Sbjct: 243 IVIITAIKDGIEDSRRTILDLEVNN 267

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  237 bits (605), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 173/554 (31%), Positives = 281/554 (50%), Gaps = 64/554 (11%)

Query: 569  TLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGM 625
             LA+CH+V   P+ ED  +L  +A SPDE A+V     +G S  ++ +  + L  +  G+
Sbjct: 780  ALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVL--EVQGI 837

Query: 626  KLEYDIKILFPFNSDSKRMGVIIFDKL-------KQEYWFLQKGADTVMSSIVVRNDWLE 678
            + E+ I  +  FNS  KRM  I+  K+       K +   + KGAD+V+ S + +    E
Sbjct: 838  EKEFQILNILEFNSSRKRMSCIV--KIPGDDANGKPKALLICKGADSVIYSRLDKTGLNE 895

Query: 679  E--------ETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVR 730
            E             ATEGLRTL + +++LS   +E++ K+Y  A+  ++DRE  ++ V  
Sbjct: 896  ESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSD 955

Query: 731  KFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 790
            + +E  L LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDKVETA  +  S  L++ 
Sbjct: 956  E-IERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNN 1014

Query: 791  -----------------------------GQYVHTVTKVNKPEGALHHL--EYLQVNQNS 819
                                          QY+H    +   E  L     E+       
Sbjct: 1015 DMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEF 1074

Query: 820  CLLIDGESL--GLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCI 877
             ++IDGE+L   L  +    +F  +  N  +V+ CR +P QKA V   ++         I
Sbjct: 1075 AVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAI 1134

Query: 878  GDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLS 937
            GDG NDV+MIQ A++GVGI G+EG+QA +++D++I QF +LT+LLL HG+  YK  A++ 
Sbjct: 1135 GDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMI 1194

Query: 938  QFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESL 996
                ++ +I ++    + I + ++   L++   +  Y   +T  PV  L + D D+ +++
Sbjct: 1195 PQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTI 1254

Query: 997  TTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFT 1056
            + ++P+LY+   L K  S +T F+W  L      VI     FF  L    + + + ++  
Sbjct: 1255 SLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVIAF---FFPYLL---YRRHMIVTSN 1307

Query: 1057 ALVLNELIMVGLEI 1070
             L L+    VG+ +
Sbjct: 1308 GLGLDHRYYVGVPV 1321

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 149/291 (51%), Gaps = 33/291 (11%)

Query: 271 KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTE 330
           K++KVGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R +   T  +  
Sbjct: 406 KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465

Query: 331 N-DLLN-NITITASAPEHSIHNFLGKITY---KDS--TSSPLSVDNTMWENTVLASSAAC 383
           + D+      I +  P  +++++ G   +   +D+   + P++++N +     L ++   
Sbjct: 466 SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525

Query: 384 ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNN-- 441
           +  + +TG +T+  LN   +  K   +  E+N       A +F+L  +   + G  +N  
Sbjct: 526 MGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585

Query: 442 ------------------DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQI 483
                               +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 586 PRSRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMM 645

Query: 484 EDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY 528
            +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY
Sbjct: 646 YNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 696

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 42/84 (50%)

Query: 173 YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232
           YP N I   KY P TF+P  +  QF  F N+YFLI+ +  A     +       VPL  +
Sbjct: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLIVI 255

Query: 233 LTVTMSKEAMDDINRRKRDREANN 256
           + +T  K+ ++D  R   D E NN
Sbjct: 256 IIITAIKDGIEDSRRTVLDLEVNN 279

>Scas_636.16
          Length = 1554

 Score =  233 bits (594), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 172/560 (30%), Positives = 279/560 (49%), Gaps = 61/560 (10%)

Query: 562  RVIDLVTTLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISL 618
            R    +  LA+CH+V   P   D  +L   A SPDE A+V     +G S   + +    L
Sbjct: 745  RCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQG--L 802

Query: 619  FHDHSGMKLEYDIKILFPFNSDSKRMGVII-----FDKLKQEYWFLQKGADTVMSSIVVR 673
              +  G++ E+ I  +  FNS  KRM  I+      +K +     + KGAD+V+ S + R
Sbjct: 803  LVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSR 862

Query: 674  NDWLEEET---------SNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVH 724
                 +ET            ATEGLRTL +G++++S + ++++ ++Y+ A+ ++  RE  
Sbjct: 863  KPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEE 922

Query: 725  MQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS 784
            + +V    +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDKVETA  +  S
Sbjct: 923  LDHVA-DLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFS 981

Query: 785  AKLI----------SRGQYV-----------------HTVTKVN----KPEGALHHLEYL 813
              L+          + G+ V                 + + K N    + E A    ++ 
Sbjct: 982  CNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHS 1041

Query: 814  QVNQNSCLLIDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATG 871
                   ++IDGE+L + L       +F  +  N   V+ CR +P QKA V   ++    
Sbjct: 1042 PPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLD 1101

Query: 872  KRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYK 931
                 IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++T+L+L HG+  YK
Sbjct: 1102 VMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYK 1161

Query: 932  SSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSL-TLDH 990
              A++     ++ +I ++    Y + + F+   L++   +  Y   +T  PV  L  LD 
Sbjct: 1162 RLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQ 1221

Query: 991  DIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKM 1050
            D+  +++ + P+LY+   L +  + +T F+W    +F G    +   FF  L    + K 
Sbjct: 1222 DVSATVSMIVPQLYRSGILRQEWN-QTKFLWY---MFDGIYQSVICYFFPYLI---YRKT 1274

Query: 1051 VAISFTALVLNELIMVGLEI 1070
              I+   L L+    VG+ +
Sbjct: 1275 NIITQNGLGLDHRYYVGIPV 1294

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 152/293 (51%), Gaps = 37/293 (12%)

Query: 271 KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSL-- 328
           K+++VGDI+++     +PADV++L T++ +G  +++T  LDGE++ K+R +   T ++  
Sbjct: 378 KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437

Query: 329 TENDLLNNITITASAPEHSIHNFLGKITYKDST-----SSPLSVDNTMWENTVLASSAAC 383
           + +       + +  P  +++ + G + + DS      + P++++N +     L ++   
Sbjct: 438 SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497

Query: 384 ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVA--------- 434
           +  +V+TG +T+  +N   +  K   +  E+N    +L   VFL  + L+A         
Sbjct: 498 MGIVVFTGDDTKTMINAGVTPTKKSRISRELN--FSVLINFVFLFILCLIAGVANGAYYR 555

Query: 435 -------------FAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDK 481
                         AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D 
Sbjct: 556 KKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV 615

Query: 482 QIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY 528
            + +  +      ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY
Sbjct: 616 LLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 668

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (48%)

Query: 172 KYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAF 231
           +YP N I   KY P TF P  +  QF  F N+YFLI+ +  A     +       VPL  
Sbjct: 167 EYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIV 226

Query: 232 VLTVTMSKEAMDDINRRKRDREANNELYEVVNKP 265
           ++ +T  K+A++D  R   D E NN    ++  P
Sbjct: 227 IIILTAIKDAIEDSRRTLLDMEVNNTRTHILQGP 260

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  231 bits (589), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 161/517 (31%), Positives = 273/517 (52%), Gaps = 55/517 (10%)

Query: 565  DLVTTLAICHNV--TPTFEDGE-LTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHD 621
            + +  LA+CH V      +D E + ++A SPDE A+V     +G S   R ++ + +  D
Sbjct: 814  NFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRTKNGVIV--D 871

Query: 622  HSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQE-------YWFLQKGADTVMSSIVVRN 674
              G++ EY +  +  FNS  KRM  I+  K+  E          + KGAD+++ S + +N
Sbjct: 872  IQGVQKEYRLLNVLEFNSTRKRMSCIL--KIPSENPNEEPRALLICKGADSIIYSRLSKN 929

Query: 675  --DWLEEETS----NMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNV 728
              + L E+T+      ATEGLRTL I +++LS   ++++ +++  A+  ++DRE  M+ V
Sbjct: 930  NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKV 989

Query: 729  VRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 788
                +E +L LLG T +ED+LQ  V  SI  L  AGIK+W+LTGDKVETA  +  S  L+
Sbjct: 990  A-DVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLL 1048

Query: 789  SRGQYVHTVTKV--------NKPEGALHH--LEYLQ---------------------VNQ 817
            +    +  +           +KP   + +  L+YLQ                        
Sbjct: 1049 NNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTG 1108

Query: 818  NSCLLIDGESLGLYLQY--FPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVC 875
            N  ++IDG++L L L+      EF  +      V+ CR +P QKA V   ++        
Sbjct: 1109 NFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTL 1168

Query: 876  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAK 935
             IGDG NDV+MIQ AD+GVGI G+EG+QA +++D++I QF +LT+L+L HGR SYK  A+
Sbjct: 1169 AIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWSYKRMAE 1228

Query: 936  LSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSL-TLDHDIDE 994
            +     ++ +I ++    Y + + ++   L++   +  +   +T  PV  L  LD D+++
Sbjct: 1229 MIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGILDQDVND 1288

Query: 995  SLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCV 1031
             ++ + P+LY+   L    +   F++++  +++Q  +
Sbjct: 1289 IVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVI 1325

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 148/295 (50%), Gaps = 41/295 (13%)

Query: 271 KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328
           K + VGDI+++     +PAD+++L +++ +G  +++T  LDGET+ K+R  L CS     
Sbjct: 444 KSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRN 503

Query: 329 TENDLLNNITITASAPEHSIHNFLGKITYKDSTSS-----PLSVDNTMWENTVLASSAAC 383
           + N       + +  P  +++++ G + + D  +      P++++N +     L ++   
Sbjct: 504 SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563

Query: 384 ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDW 443
           +  +V+TG +T+  LN   +  K   +  E+N LS  +    F L  +L   AG  N  +
Sbjct: 564 MGIVVFTGPDTKIMLNAGVTPTKVSRISRELN-LSVFMN---FALLFVLCFAAGIVNGVY 619

Query: 444 Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEH 479
           Y                        V     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 620 YRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYG 679

Query: 480 DKQIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY 528
           D  + +  +      ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY
Sbjct: 680 DVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 734

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 41/84 (48%)

Query: 173 YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232
           YP N I   KY P TF P  +  QFK   N+YFL++ +        +       VPL  +
Sbjct: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299

Query: 233 LTVTMSKEAMDDINRRKRDREANN 256
           + +T  K+A++D  R   D E NN
Sbjct: 300 VVLTSFKDAIEDSRRTILDMEVNN 323

>Scas_576.8
          Length = 1591

 Score =  226 bits (575), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 167/517 (32%), Positives = 268/517 (51%), Gaps = 60/517 (11%)

Query: 569  TLAICHNV--TPTFEDGE-LTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGM 625
             LA+CH+V   P   D + L  +A SPDE A+V     VG S   + +    L  +  G+
Sbjct: 789  ALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGKTK--TGLIIEVQGV 846

Query: 626  KLEYDIKILFPFNSDSKRMGVIIFDKL-------KQEYWFLQKGADTVMSSIV-----VR 673
            + E+ I     FNS  KRM  I+  K+       +     + KGAD+++ S +       
Sbjct: 847  QKEFQILNTLEFNSTRKRMSCIV--KIPGANPDDEPRALLICKGADSIIYSRLGTKNGAN 904

Query: 674  NDWLEEETS----NMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVV 729
            ++ L E+T+      ATEGLRTL I +++LS   + ++ K Y  A+ ++ +RE  ++ V 
Sbjct: 905  SENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVS 964

Query: 730  RKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI- 788
             + +E +L LLG T +ED+LQ  V  SI +L  AGIK+W+LTGDKVETA  +  S  L+ 
Sbjct: 965  DE-IERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLLN 1023

Query: 789  ---------SRGQYVHT------------VTKVNKPEGAL--HHLEYLQVNQNS------ 819
                     + G  V              +TK  + +  L    +E     +N       
Sbjct: 1024 NDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELADAKKNHDFPRGD 1083

Query: 820  -CLLIDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCC 876
              ++IDGE+L L L  +    +F  +  N   V+ CR +P QKA V   +  +       
Sbjct: 1084 FAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLDVMTLA 1143

Query: 877  IGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKL 936
            IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF +LT+L+L HGR SY+  A++
Sbjct: 1144 IGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLVHGRWSYRRLAEM 1203

Query: 937  SQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPV-FSLTLDHDIDES 995
                 ++ +I ++    Y I + F+   L++   ++ Y   +T  PV F   +D D+ ++
Sbjct: 1204 IPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLPVIFMGIMDQDVSDT 1263

Query: 996  LTTLYPELYKELTLGKSLSFKTFFVWVAL-SVFQGCV 1031
            ++ + P+LY+   L    + +T F+W  L  ++Q C+
Sbjct: 1264 VSLVMPQLYRSGILRLDWN-QTKFLWYMLDGLYQSCI 1299

 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 152/296 (51%), Gaps = 43/296 (14%)

Query: 271 KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328
           K++KVGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R  L CS +   
Sbjct: 415 KNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRN 474

Query: 329 TENDLLNNITITASAPEHSIHNFLGKITYKDS-----TSSPLSVDNTMWENTVLASSAAC 383
           + +       + +  P  +++++ G + + DS      + P++++N +     L ++   
Sbjct: 475 SRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWA 534

Query: 384 ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAF-------- 435
           +  +V+TG +T+  LN+  +  K   +  E+N     L   +  L + ++ F        
Sbjct: 535 MGMVVFTGDDTKIMLNSGATPTKKSRISRELN-----LSVSLNFLFLFIICFISAIINGV 589

Query: 436 -----------------AGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIE 478
                            AG  + + +V     +IL+ +++P+SL +++++ K+  A  I 
Sbjct: 590 DYDKHPRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIY 649

Query: 479 HDKQIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY 528
            D  + +  +      ++  I +D+G+IEY+ SDKTGTLTQN M+ KK  +  +SY
Sbjct: 650 GDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISY 705

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 3/91 (3%)

Query: 166 PIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSY 225
           PI D   YP N I   KY+P  F P  +  QF+ F N+YFL++ +  A     +      
Sbjct: 197 PITD---YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGVTNPGLA 253

Query: 226 IVPLAFVLTVTMSKEAMDDINRRKRDREANN 256
            VPL  ++ +T  K+A++D  R   D E NN
Sbjct: 254 AVPLIVIVIITAIKDAIEDSRRTLLDMEVNN 284

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  224 bits (570), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 162/512 (31%), Positives = 263/512 (51%), Gaps = 52/512 (10%)

Query: 569  TLAICHNVTPTFEDG---ELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGM 625
            +LA+CH+V          +L  +A SPDE A+V+    +G S   R ++ + +  +  G+
Sbjct: 780  SLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNGVII--EIQGV 837

Query: 626  KLEYDIKILFPFNSDSKRMGVIIF-----DKLKQEYWFLQKGADTVMSSIV--VRND-WL 677
            + E+ I  +  FNS  KRM  I+      +  K +   L KGAD+V+ S +   RND  L
Sbjct: 838  QKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRSRNDPKL 897

Query: 678  EEETS----NMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFL 733
             E T+      ATEGLRTL + ++++  + +  + +    A+ ++ +RE  ++ V    +
Sbjct: 898  LERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERVADA-I 956

Query: 734  ENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI----- 788
            E  L LLG T +ED+LQ  V  SI +L +AGIK+W+LTGDKVETA  +  S  L+     
Sbjct: 957  ERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNLLGSDME 1016

Query: 789  -----SRGQYV---------------------HTVTKVNKPEGALHHLEYLQVNQNSCLL 822
                 S G+ V                     H   K +  E A    ++        ++
Sbjct: 1017 LLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEELAAARKDHTPPQSAFGVV 1076

Query: 823  IDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDG 880
            IDG++L L L  +    +F  +  N   V+ CR +P QKA V   ++++       IGDG
Sbjct: 1077 IDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESLDVVTLAIGDG 1136

Query: 881  GNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFV 940
             NDV+MIQ ADVG+GI G+EG+QA ++AD++I QF +LT+L+L HGR SYK  A++    
Sbjct: 1137 SNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLVLVHGRWSYKRLAEMIPQF 1196

Query: 941  IHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTTL 999
             ++ +  ++    + ICS ++   L++   ++ Y   +T  PV  L  +D D  + L+ +
Sbjct: 1197 FYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLPVIFLGIMDQDASDVLSVV 1256

Query: 1000 YPELYKELTLGKSLSFKTFFVWVALSVFQGCV 1031
             P+LYK   L    +   F+ +    V+Q  +
Sbjct: 1257 VPQLYKVGILRTEWTQNKFWWYCFDGVYQSII 1288

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 150/295 (50%), Gaps = 41/295 (13%)

Query: 271 KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR--LACSLTQSL 328
           KD++VGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R  L CS     
Sbjct: 406 KDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRN 465

Query: 329 TENDLLNNITITASAPEHSIHNFLGKITYKDSTSS-----PLSVDNTMWENTVLASSAAC 383
           +++       + +  P  +++++ G   + DS +      P++++N +     L ++   
Sbjct: 466 SKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWA 525

Query: 384 ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDW 443
           +  +++TG +T+  LN   +  K   +  E+N    ++   VFL  + L A  G  N  +
Sbjct: 526 MGIVMFTGTDTKIMLNAGVTPTKRSRISRELN--YSVILNFVFLFVLCLAA--GLVNGIY 581

Query: 444 Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEH 479
           Y                        +     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 582 YRRDATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYG 641

Query: 480 DKQIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY 528
           D  + +  +      RT  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY
Sbjct: 642 DVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 696

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%)

Query: 173 YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232
           YP N I   KY P +F+P  L  QFK   N+YFL++     +    +   +   +PL  +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 233 LTVTMSKEAMDDINRRKRDREANN 256
           + +T  K+A +D  R   D E NN
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVNN 286

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  222 bits (565), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 156/451 (34%), Positives = 234/451 (51%), Gaps = 35/451 (7%)

Query: 679  EETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLE 738
            E+  + +TEGLRTL+   K +S   FEQ+   Y EA  ++ +R+  +  V  + +E++L 
Sbjct: 963  EDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQ-IEDELY 1021

Query: 739  LLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVT 798
            LLG T +EDKLQ+ V  +IE +R AGIK+WMLTGDK ETA  +  S KLI    Y   V 
Sbjct: 1022 LLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIH--DYSTVVI 1079

Query: 799  KVNKPEGALHHLEYLQVNQNS------CLLIDGESLGLYLQYFPDE------FFDIVVNL 846
                 E  +  +  +    +S       ++IDG +L +    F D       F ++    
Sbjct: 1080 LTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAM----FEDNPTLMSVFTELCTKT 1135

Query: 847  PTVVACRCTPQQKADVAVFIRQATGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQAS 905
             +VV CR +P QKA +   IR      V   IGDG ND++MIQ AD+GVGI GKEG QAS
Sbjct: 1136 DSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQAS 1195

Query: 906  LAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLAL 965
             +AD+SI QF  + KLLL HGR +Y  +AK      ++ L   + Q +Y   +MF   +L
Sbjct: 1196 RSADYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSL 1255

Query: 966  YQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVAL 1024
            Y+ W +  Y T +T  PV  + + + D+        PELY    L K+ ++  F  WV L
Sbjct: 1256 YEPWSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFL 1315

Query: 1025 SVFQGCVI---QMASQFFTSLNDSDFTKMVAISFTALVLNELIMVGLE-INTWNK-IMAI 1079
                  +I    + +   TSL+D+    +  ++F+A V   LI V  + I   N+  +A 
Sbjct: 1316 GTANALIITFLNIVAWGETSLSDNTLYPLGFVNFSATV--ALINVKAQFIEMRNRNWLAF 1373

Query: 1080 TEVV----TLLIYLGSIPFLGE---YFDLSY 1103
            T V+      L++  ++P L      +D++Y
Sbjct: 1374 TSVILSCGGWLVWCCALPILNRSDGIYDVTY 1404

 Score =  188 bits (478), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 137/438 (31%), Positives = 222/438 (50%), Gaps = 76/438 (17%)

Query: 173 YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232
           Y +N+I++++Y   +F P  LY QF    N+YF IVA+ Q IP        + IVPL   
Sbjct: 123 YCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCVF 182

Query: 233 LTVTMSKEAMDDINRRKRDREANNELYEVV---------------------NKPCPIPS- 270
           + ++M++EA DD  R K D+E NN+L +V+                     N P  I + 
Sbjct: 183 MAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDLDLENNAQHSANNPESISNL 242

Query: 271 ---------------------KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQ 309
                                KD++VGD + L++   VPAD+++L ++  N E FI+T  
Sbjct: 243 YFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIETMA 302

Query: 310 LDGETDWKLRLACSLTQSLTEN--DLLN-NITITASAPEHSIHNFLGKITYKDSTSS--- 363
           LDGET+ K ++       LT++   L N N  +T   P + ++NF G +     +SS   
Sbjct: 303 LDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLELNSGSSSKKK 362

Query: 364 -PLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKS-KAKTGLLELEINGLSKIL 421
            PL  DN ++  +++ ++  C+  +++TG E++  +N  ++ + K   L+ +IN +   +
Sbjct: 363 YPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVVFM 422

Query: 422 C---ACVFLLS-----IMLVAFAGFNNNDWYV---------DIMRYLILFSTIIPVSLRV 464
               AC+ L S     I +  +   NN  WY+          IM ++I+++TIIP+SL V
Sbjct: 423 VFVVACMSLFSYLGHTIQIKRYVN-NNKAWYLLQEDAGTAPTIMSFIIMYNTIIPLSLYV 481

Query: 465 NLDLGKSVYAYKIEHDKQI----EDT--IVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQL 518
            ++L K   +  +E D  +     DT   VRT+TI E+LG++ Y+ SDKTGTLT N M  
Sbjct: 482 TMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLF 541

Query: 519 KKIHL-GTVSYTNETMDI 535
           +K+   GT    N T DI
Sbjct: 542 RKLSFCGTSWVHNATQDI 559

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 12/114 (10%)

Query: 566 LVTTLAICHNVTPTF------EDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLF 619
            + +LAICH   P        ED  + YQ++SPDE+A+V     +G  ++ R+ + ++L 
Sbjct: 678 FILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLK 737

Query: 620 HDHSGM----KLE-YDIKILFPFNSDSKRMGVII-FDKLKQEYWFLQKGADTVM 667
               G     + E ++I  L  FNS  KRM VI+   + K       KGAD V+
Sbjct: 738 TFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVI 791

>Kwal_23.3556
          Length = 1597

 Score =  212 bits (539), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 136/390 (34%), Positives = 207/390 (53%), Gaps = 16/390 (4%)

Query: 683  NMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGL 742
            + +T GLRTL+   K + +  +E++ K+Y  A  ++ +R+  M +V  + +E  L LLG 
Sbjct: 966  DFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSV-GELVETSLHLLGA 1024

Query: 743  TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNK 802
            T +EDKLQ+ V  +I+ +R AGIK+WMLTGDK ETA  +  S  LI    Y   V    K
Sbjct: 1025 TAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIH--DYSTVVILSAK 1082

Query: 803  PEGALHHL-----EYLQVNQNSCLL-IDGESLGLYLQ--YFPDEFFDIVVNLPTVVACRC 854
             E     L     E  + N   C++ IDG +L  +         F ++     +V+ CR 
Sbjct: 1083 DENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSVICCRA 1142

Query: 855  TPQQKADVAVFIRQATGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT 913
            +P QKA +   IR    K V   IGDG ND++MIQ AD+GVGI GKEG QAS ++D+SI 
Sbjct: 1143 SPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSIA 1202

Query: 914  QFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVG 973
            QF  L KLLL HGR +Y  + K      ++ L+  + Q +Y   +MF   +LY+ W +  
Sbjct: 1203 QFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLSM 1262

Query: 974  YATCYTMAPVFSLTL-DHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVI 1032
            + T +T  PV  + + + D+        PELY    L +S + + F  W+ L+     +I
Sbjct: 1263 FNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALNSLII 1322

Query: 1033 QMAS---QFFTSLNDSDFTKMVAISFTALV 1059
               +      +SL+D+    +  I+FTA++
Sbjct: 1323 TFLNWKIWAVSSLSDNTVYPIGVINFTAII 1352

 Score =  135 bits (340), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 118/460 (25%), Positives = 205/460 (44%), Gaps = 109/460 (23%)

Query: 171 KKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLA 230
           K Y SN+I++++Y  +TF+P  LY QF    N YF +VA+ Q IP        + IVPL 
Sbjct: 106 KPYISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLL 165

Query: 231 FVLTVTMSKEAMDDINRRKRDREANNELYEVV----------NKPCPIPS---------- 270
             + ++MS+EA DD  R K DRE N++   V+          ++P  + S          
Sbjct: 166 IFMGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYSLPQWQQSATS 225

Query: 271 --------------------KDLKVGDIIKLKKGARV---------PADVVVLQTNE--- 298
                                D    D++K K G              D VVL+ +E   
Sbjct: 226 TSMLTNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVP 285

Query: 299 ----------PNGESFIKTDQLDGETDWK-----------LRLACSLTQSLTENDLLNNI 337
                        E F++T  LDGET+ K           ++ A  LT+   +       
Sbjct: 286 ADMLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAK------- 338

Query: 338 TITASAPEHSIHNFLGKIT-YKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQ 396
            +T   P   +HNF G +    ++    +  D+ ++  +++ +++  +  +V+TG ET+ 
Sbjct: 339 -VTVEDPNIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKI 397

Query: 397 ALNTTKS-KAKTGLLELEINGLSKILCACVFLLSIMLVAFAGF---------NNNDWYV- 445
            +N  K+ + K   L+  IN +  +L     + S+ L +  G          NN  WY+ 
Sbjct: 398 RMNAIKNPRIKAPKLQRAINLI--VLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLF 455

Query: 446 --------DIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIV------RTS 491
                    +M ++I+++T+IP+SL V +++ K++ +  +E D  +           RT+
Sbjct: 456 NSDAGLAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTA 515

Query: 492 TIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNE 531
           TI E+LG++ Y+ SDKTGTLT N M  + + +   S+ ++
Sbjct: 516 TILEELGQVSYIFSDKTGTLTDNKMVFRALSVCGSSWIHD 555

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 15/123 (12%)

Query: 558 NISDRVIDLVTTLAICHNVTPTFEDGE-----LTYQAASPDEIAIVKFTESVGLSLFRRD 612
           + + +V   + +LA+CH   P    G      + YQA+SPDE+A+V     +G ++  R+
Sbjct: 660 HFAKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRN 719

Query: 613 RHSISLFHDHSGMKLE-----YDIKILFPFNSDSKRMGVIIFDKLKQE---YWFLQKGAD 664
              +++    +G   E     Y+I     F+S  KRM V++  +L  E      + KGAD
Sbjct: 720 SDVLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLV--RLPHEENRILLICKGAD 777

Query: 665 TVM 667
            V+
Sbjct: 778 NVI 780

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  211 bits (537), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 145/442 (32%), Positives = 227/442 (51%), Gaps = 29/442 (6%)

Query: 685  ATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTG 744
            +TEGLRTLV   K +    +E + K Y +A  ++ DR++ +     + +E+ L LLG+T 
Sbjct: 1029 STEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAE-IEDGLNLLGVTA 1087

Query: 745  VEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPE 804
            +EDKLQ  V  +IE +R AGIK+WMLTGDK ETA  +  S  LI    Y   V      E
Sbjct: 1088 IEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIK--DYSTVVILTTTDE 1145

Query: 805  GALHHLEYLQVNQNS------CLLIDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTP 856
              +  +  +    +S       ++IDG ++ ++     +   F ++     +V+ CR +P
Sbjct: 1146 NIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASP 1205

Query: 857  QQKADVAVFIRQATGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF 915
             QKA +   IR      V   IGDG ND++MIQ AD+GVGI GKEG QAS  +D+SI QF
Sbjct: 1206 SQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQF 1265

Query: 916  CHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYA 975
              L KLL  HGR +Y  ++K      ++ +     Q +Y   +MF   +LY+ W +  + 
Sbjct: 1266 RFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFN 1325

Query: 976  TCYTMAPVFSLTL-DHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQM 1034
            T +T  PV  + + + D+        PELY    L +  ++  F  WV L+     +I  
Sbjct: 1326 TLFTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITF 1385

Query: 1035 ASQF---FTSLNDSDFTKMVAISFTALVLNELIMVG---LEINTWNKIMAITEVV----T 1084
             +      +SL+D+    +  I+FTA+V   LI V    +E++  N  +A T VV     
Sbjct: 1386 LNVVMWGMSSLSDNTMYPLGLINFTAIV--ALINVKSQFVEMHNRN-WLAFTSVVLSCGG 1442

Query: 1085 LLIYLGSIPFLG---EYFDLSY 1103
             L++  ++P L    + +D++Y
Sbjct: 1443 WLVWCCALPILNNTDQIYDVAY 1464

 Score =  159 bits (401), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 131/483 (27%), Positives = 217/483 (44%), Gaps = 103/483 (21%)

Query: 144 VDGNKIELNDHNVEREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNL 203
           +D N IE      +R+ H         K Y  N I++++Y  ++F+P  LY QF    N 
Sbjct: 111 LDHNAIEYKQAATKRDGHLIDERF--NKPYCDNRITSSRYTFYSFLPRQLYAQFSKLANT 168

Query: 204 YFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDRE---------- 253
           YF IVA+ Q IP        + I+PL   + ++M++EA DD  R + D+E          
Sbjct: 169 YFFIVAVLQMIPGWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVLV 228

Query: 254 --ANNELYEVVNKPCPIPS----------------------------------------- 270
              NN+  EV   P  + S                                         
Sbjct: 229 KDGNNDAQEVYTLPSSVVSSTAYLTKSAAAENNPPLNDDRNSSQGHFLDTHFNNFELLKN 288

Query: 271 -----------KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR 319
                      + L+VGD + L +   VPAD+++L  +  N E F++T  LDGET+ K +
Sbjct: 289 KYNVHIHQKKWEKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSK 348

Query: 320 LACSLTQSLTE--NDLLN-NITITASAPEHSIHNFLGKITYKDSTSS-----PLSVDNTM 371
                   LT+  + L N N  +T   P   ++NF G +  K+  +      PL  DN +
Sbjct: 349 QPHPELNKLTKAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVI 408

Query: 372 WENTVLASSAACICCIVYTGRETRQALNTTKS-KAKTGLLELEINGLSKILCACVFLLS- 429
           +  ++L ++   +  ++++G ET+  +N  K+ + K   L+ +IN    I+   VF+++ 
Sbjct: 409 YRGSILRNTQNVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKIN---MIIVFMVFVVAT 465

Query: 430 IMLVAFAGF---------NNNDWYV---------DIMRYLILFSTIIPVSLRVNLDLGKS 471
           I L ++ G           N  WY+          IM ++I+++T+IP+SL V +++ K 
Sbjct: 466 ISLFSYLGHVLHKKKYIDQNKAWYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKV 525

Query: 472 VYAYKIEHDKQIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGT 525
           V +  +E D  +           RT+TI E+LG++ Y+ SDKTGTLT N M  +K  L  
Sbjct: 526 VQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCG 585

Query: 526 VSY 528
            S+
Sbjct: 586 SSW 588

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 110/260 (42%), Gaps = 52/260 (20%)

Query: 569 TLAICHNVTP------TFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRH--SISLFH 620
           +LA+CH+  P      +  +  + YQ++SPDE+A+V     +G  +  R+    +I  F 
Sbjct: 734 SLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIKTFP 793

Query: 621 D--HSGMKLE-YDIKILFPFNSDSKRMGVII-FDKLKQEYWFLQKGADTVMSSIVVRNDW 676
           D      KLE Y+I     FNS  KRM V++       +   + KGAD V+         
Sbjct: 794 DGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVI--------- 844

Query: 677 LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLEND 736
                     E L    +  KK++       E++ +EA L +  R+  ++ +V      D
Sbjct: 845 ---------MERLHDRELAAKKMADICTSTKERKDAEAELVLQQRK-SLERMV------D 888

Query: 737 LELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHT 796
            E +  T + + L    ++S+ L     ++  +     ++ +R      ++ S  Q++ T
Sbjct: 889 EEAMARTSLRNSLSSVPRASLSL---QAVRKSL----SMKNSRTRDPEKQIDSIDQFLET 941

Query: 797 VTK--------VNKPEGALH 808
           V K        VNK   +LH
Sbjct: 942 VKKSDQEIGSVVNKSRKSLH 961

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  209 bits (531), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 207/386 (53%), Gaps = 14/386 (3%)

Query: 685  ATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTG 744
            +TEGLRTL+   K +    ++ +E +Y EA  ++ +R   +  V    +E DLELLG T 
Sbjct: 948  STEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEV-GGHIETDLELLGATA 1006

Query: 745  VEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTK----- 799
            +EDKLQ+ V  +I+ +R AGIK+WMLTGDK ETA  +  + KLI     V  + K     
Sbjct: 1007 IEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYSTVVILKKNDDNL 1066

Query: 800  VNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQ--YFPDEFFDIVVNLPTVVACRCTPQ 857
            ++K       L+  ++  +  L+IDG SL ++         F ++     +V+ CR +P 
Sbjct: 1067 ISKMTALGEELDTGKI-AHCVLVIDGASLAVFENNPTMMSVFIELCTKTDSVICCRASPS 1125

Query: 858  QKADVAVFIRQATGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFC 916
            QKA +   IR      V   IGDG ND++MIQ AD+GVGI GKEG QAS ++D+SI QF 
Sbjct: 1126 QKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGITGKEGLQASRSSDYSIAQFR 1185

Query: 917  HLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYAT 976
            +L KLL  HGR +Y  ++K      ++ ++  + Q +Y   +MF   +LY+ W +  + T
Sbjct: 1186 YLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSLSMFNT 1245

Query: 977  CYTMAPVFSLTL-DHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMA 1035
             +T  PV  + + + D+        PELY      ++ + K F VW+  +     +I   
Sbjct: 1246 LFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFNLKIFLVWMLTAAGISVLITFL 1305

Query: 1036 S---QFFTSLNDSDFTKMVAISFTAL 1058
            +     FT+ +D+    +  I+FT++
Sbjct: 1306 NFEIWGFTAQSDNSIYPIGVINFTSI 1331

 Score =  129 bits (324), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 160/295 (54%), Gaps = 43/295 (14%)

Query: 271 KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLR-----LACSLT 325
           KDLKVG+ + L     VPAD+++L T+  N E+F++T  LDGET+ K +     LA  +T
Sbjct: 275 KDLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMT 334

Query: 326 QSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACIC 385
            +   +  +++ T T   P + ++NF G +   D    PL  DN ++  ++L ++ + + 
Sbjct: 335 SATGLS--MHSATTTLEDPNNDLYNFEGTVEI-DGELYPLGSDNVVYRGSILRNTQSIVG 391

Query: 386 CIVYTGRETRQALNTTKS-KAKTGLLELEINGLSKILCACVFLLSIM-LVAFAGF----- 438
            +++TG ET+  +N  K+ + K   L+ +IN    I+   VF+++ M + ++ G      
Sbjct: 392 IVIFTGEETKIRMNAIKNPRTKAPKLQGKIN---LIVLFMVFVVAAMAMFSYLGQHILKK 448

Query: 439 ----NNNDWYV---------DIMRYLILFSTIIPVSLRVNLDLGKSVYA---------YK 476
               NN  WY+          IM ++I+++T+IP+SL V  ++ K++ +         Y 
Sbjct: 449 NYVDNNRAWYLFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYH 508

Query: 477 IEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNE 531
           IE D   E    RT+TI E+LG++ Y+ SDKTGTLT N M  +K  +   S+ +E
Sbjct: 509 IESDTPCES---RTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGSSWLHE 560

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 58/92 (63%)

Query: 171 KKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLA 230
           + Y  NVI++++Y  ++F+P  LY QF    N YFL+VA+ Q IP        + IVPL+
Sbjct: 114 RPYRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLS 173

Query: 231 FVLTVTMSKEAMDDINRRKRDREANNELYEVV 262
             L+++M++EA DD  R + D+E NN+  +V+
Sbjct: 174 IFLSISMAREAWDDFKRHRLDKEENNKSTKVL 205

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 87/208 (41%), Gaps = 42/208 (20%)

Query: 566 LVTTLAICHNVTPT-FEDG--ELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISL---- 618
            + +LA+CH   P    DG   + YQ++SPDE+A+V     +G  +  R+  ++S+    
Sbjct: 672 FILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSIATYP 731

Query: 619 --FHDHSGMKLEYDIKILFPFNSDSKRMGVII-FDKLKQEYWFLQKGADTVMSSIVVRND 675
             F D   ++ +Y++     F+S  KRM V +           + KGAD           
Sbjct: 732 NGFDDQPIVE-DYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGAD----------- 779

Query: 676 WLEEETSNMATEGLRTLVIGRKKL--STNLFEQFEKEYSEASLTMMDREVHMQNVVRKFL 733
                  N+  E LR   + + K+    NL EQ + E +E  L             RK L
Sbjct: 780 -------NVILERLRNSELAQNKVLEQQNLIEQRKLEEAEMILHQ-----------RKSL 821

Query: 734 ENDLELLGLTGVEDKLQKDVKSSIELLR 761
           E      G+TG+    Q   +SSI  L+
Sbjct: 822 ELTNMRDGITGLARNSQLQNRSSISTLK 849

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  205 bits (521), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/388 (34%), Positives = 203/388 (52%), Gaps = 16/388 (4%)

Query: 686  TEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGV 745
            TEGLRTL+   K +    +E +   YS A   +++R   M + V + +E DL LLG  G+
Sbjct: 950  TEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQM-DTVGEIIERDLTLLGTIGI 1008

Query: 746  EDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEG 805
            EDKLQ+ V  +I+ LR AGIK+WMLTGDK ETA  +  S +LI    Y   +      E 
Sbjct: 1009 EDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH--DYSTVIILAPNDEN 1066

Query: 806  ALHHL-----EYLQVNQNSCLL-IDGESLGLYLQYFP--DEFFDIVVNLPTVVACRCTPQ 857
                +     E    N   C++ IDG +L ++         F ++     +V+ CR +P 
Sbjct: 1067 MASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPS 1126

Query: 858  QKADVAVFIRQATGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFC 916
            QKA +   IR+   K V   IGDG ND++MIQ AD+GV I GKEG QAS ++D+SI QF 
Sbjct: 1127 QKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFR 1186

Query: 917  HLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYAT 976
            +L KLLL HGR +Y  ++K      ++  +  + Q ++ I +MF   + Y+ W +  + T
Sbjct: 1187 YLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNT 1246

Query: 977  CYTMAPVFSLTLDHDIDESLTTL-YPELYKELTLGKSLSFKTFFVWVALSVFQG---CVI 1032
             +T  PV  + +     +S+T L  PELY      ++ +   F  W+A++       C  
Sbjct: 1247 LFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVIICFT 1306

Query: 1033 QMASQFFTSLNDSDFTKMVAISFTALVL 1060
                   T+ +D+    +  I++TA+V+
Sbjct: 1307 NWQCWSLTAQSDNTLYPIGLINYTAVVV 1334

 Score =  155 bits (392), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 122/422 (28%), Positives = 211/422 (50%), Gaps = 73/422 (17%)

Query: 169 DRKK---YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSY 225
           DR+    Y  N I++++Y+ ++F+P  L  QF    N YF  +A+ Q +P        + 
Sbjct: 103 DRRSGLPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTT 162

Query: 226 IVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVV----------NKPCPIPS----- 270
           IVPL+  + +++++E  +D  R K DRE NN+L +V+          NK     +     
Sbjct: 163 IVPLSIFMGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASF 222

Query: 271 -------------------KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLD 311
                              KD++VG+ + L +   VPAD+ +L T+  N E +++T  LD
Sbjct: 223 TDFETLQANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALD 282

Query: 312 GETDWKLR--LACSLTQSLTENDL--LNNITITASAPEHSIHNFLGKITYK----DSTSS 363
           GET+ K +  L    +Q+ T + L     +T T   P   ++NF GKI  +    +  + 
Sbjct: 283 GETNLKCKHVLPKIASQTRTASGLATFRGMT-TVEDPNIDLYNFEGKIEVETDSGEQQAY 341

Query: 364 PLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKS-KAKTGLLELEIN--GLSKI 420
            + +DN ++  +++ ++   +  +V+TG ET+  +N  K+ + K+  L+ +IN   L  I
Sbjct: 342 SIGLDNVLFRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMI 401

Query: 421 LCACVF-LLSIMLVAFAGFNNND------WYV---------DIMRYLILFSTIIPVSLRV 464
           L   +F  LS  L  F  F N +      WY+          IM ++I+++T+IP+SL V
Sbjct: 402 LVVAIFSFLSFGLQRF--FKNREVDSDRAWYLMKVDAGLAPTIMSFIIMYNTLIPLSLYV 459

Query: 465 NLDLGKSVYAYKIEHDKQI------EDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQL 518
            +++ K + +  +E D  +           RT+TI E+LG++ Y+ SDKTGTLT N M  
Sbjct: 460 TMEIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIF 519

Query: 519 KK 520
           +K
Sbjct: 520 RK 521

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 80/184 (43%), Gaps = 31/184 (16%)

Query: 560 SDRVIDLVTTLAICHNVTPTFEDG-------ELTYQAASPDEIAIVKFTESVGLSLFRRD 612
           S R    +  LA+CH   P    G        + YQ++SPDE+A+V     +G  +  R+
Sbjct: 647 SQRAKFFILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRN 706

Query: 613 RHSISLFHDHSGMKLE-----YDIKILFPFNSDSKRMGVII-FDKLKQEYWFLQKGADTV 666
              +++     G + +     Y++     F+SD KRM V++   +  ++   + KGAD V
Sbjct: 707 GDELTIKTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNV 766

Query: 667 MSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQ 726
           +   +  +D  +++ + + T        G++K+             EA L +  R+   Q
Sbjct: 767 ILERLHNSDLAQQKLNEINTSA------GQRKI------------EEAELVLQHRKSLEQ 808

Query: 727 NVVR 730
            + R
Sbjct: 809 AITR 812

>Scas_669.3
          Length = 1638

 Score =  198 bits (503), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 143/441 (32%), Positives = 228/441 (51%), Gaps = 27/441 (6%)

Query: 685  ATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTG 744
            +TEGLRTLV   K +    ++Q+E  Y +A +++ +R+  +  V  + +E DL+LLG T 
Sbjct: 1003 STEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEE-IEQDLQLLGATA 1061

Query: 745  VEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPE 804
            +EDKLQ+ V  +IE +R AGIKIWMLTGDK ETA  +  S KLI    Y   V      E
Sbjct: 1062 IEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIY--DYSTVVILAKGDE 1119

Query: 805  GALHHLEYLQVNQNS------CLLIDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTP 856
              +  +  +    +S       ++IDG +L ++         F ++     +V+ CR +P
Sbjct: 1120 NIISKMNAISQEVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRASP 1179

Query: 857  QQKADVAVFIRQATGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF 915
             QK+ +   IR +    V   IGDG ND++MIQ AD+G+GI GKEG QAS  AD+SI QF
Sbjct: 1180 SQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQF 1239

Query: 916  CHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYA 975
              + KLLL HGR +Y  +AK       + +   + Q ++   +MF   +LY+ W +  + 
Sbjct: 1240 RFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMFN 1299

Query: 976  TCYTMAPVFSLTL-DHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQM 1034
            T +T  PV  + + + D+        PELY    L +  +   F  WV  +     +I  
Sbjct: 1300 TLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLITF 1359

Query: 1035 ASQFF---TSLNDSDFTKMVAISFTALVLNELIMVG---LEINTWNKIMAITEVVTL--- 1085
             +      T+L+D     +  I+FTA+V   L+ V    +E+N  N ++  + +++    
Sbjct: 1360 LNIIIWGETALSDHTMYPLGVINFTAIV--ALVNVKCQFIEMNNRNWVVFTSVILSCGGW 1417

Query: 1086 LIYLGSIPFLGE---YFDLSY 1103
            L++  ++P L      +D+ Y
Sbjct: 1418 LVWCCALPILNRSDVIYDVPY 1438

 Score =  177 bits (448), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 132/449 (29%), Positives = 221/449 (49%), Gaps = 99/449 (22%)

Query: 173 YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232
           Y +N I++++Y  ++F P  LY QF    N+YF +VA+ Q IP        + IVPL   
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 233 LTVTMSKEAMDDINRRKRDREANNELYEVV-----NKPCP----IPSK------------ 271
           + ++M++EA DD  R + D+E NN+   ++     NKP P    +PS+            
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNT 259

Query: 272 ---------------------------DLKVGDIIKLKKGARVPADVVVLQTNEPNGESF 304
                                      +L VGD + LK+   VPAD++VL ++  N E F
Sbjct: 260 DYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECF 319

Query: 305 IKTDQLDGETDWKL--------RLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKIT 356
           ++T  LDGET+ K+        +LACS +     N L     IT   P   ++NF G + 
Sbjct: 320 VETMALDGETNLKVKQPHPELNKLACSASGLANINAL-----ITVEDPNSDLYNFEGNLE 374

Query: 357 YKDSTSS-----PLSVDNTMWENTVLASSAACICCIVYTGRETR---QALNTTKSKAKTG 408
             D+ ++     P+  DN  +  +++ ++   I  ++YTG+ET+    ALN  ++KA   
Sbjct: 375 LTDNNNNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPK- 433

Query: 409 LLELEINGLSKILCACVFLLSIM-LVAFAGF---------NNNDWYV---------DIMR 449
            L+  IN    I+   VF+++++ L ++ G           N  WY+          IM 
Sbjct: 434 -LQKNIN---IIITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMS 489

Query: 450 YLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIV------RTSTIPEDLGRIEYL 503
           ++I+++TIIP+SL V +++ K++ +  +E D  +  +        RT+TI E+LG++ Y+
Sbjct: 490 FIIMYNTIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYM 549

Query: 504 LSDKTGTLTQNDMQLKKIHLGTVSYTNET 532
            SDKTGTLT N M  +K  +   S+ + T
Sbjct: 550 FSDKTGTLTDNKMIFRKFSICGSSWLHST 578

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 11/94 (11%)

Query: 566 LVTTLAICHNVTPTF----EDGE--LTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLF 619
            + +LA+CH   P      E GE  + YQ++SPDE+A+V     +G  +  ++   +++ 
Sbjct: 702 FILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADVLTIK 761

Query: 620 HDHSGMKLE-----YDIKILFPFNSDSKRMGVII 648
               G + E     Y I     FNS  KRM V++
Sbjct: 762 TYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLV 795

>Scas_505.4
          Length = 1025

 Score =  134 bits (336), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/300 (29%), Positives = 140/300 (46%), Gaps = 10/300 (3%)

Query: 820  CLLIDGESLGLYLQYFPDEFFDIVVNL-PTVVACRCTPQQKADVAVFIRQATGKRVCCIG 878
             L+IDG+SL   L+   +++   +  +   VV CR +P QKA V   +++ T   +  IG
Sbjct: 559  ALVIDGKSLSYALESDLEDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIG 618

Query: 879  DGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQ 938
            DG NDVSMIQ A VGVGI G EG QA+ +AD ++ QF  L KLLL HG  SY+  +    
Sbjct: 619  DGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVAIL 678

Query: 939  FVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLT 997
            +  ++   + + Q  +   + F   ++ + W M  Y   +T+ P F +   D  +   L 
Sbjct: 679  YSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLL 738

Query: 998  TLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFF----TSLND----SDFTK 1049
              YP+LYK    GK  S + F+ W+    +   V+ + +  F     +LN     +D   
Sbjct: 739  ERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVADHWS 798

Query: 1050 MVAISFTALVLNELIMVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKF 1109
                 +T+ +L  L    L  N W K        + + ++   P     F  + +S   F
Sbjct: 799  WGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISREYF 858

 Score =  128 bits (322), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 149/294 (50%), Gaps = 11/294 (3%)

Query: 153 DHNVEREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQ 212
           D    REI+           Y  N IS  KYN  TF+P  L+++F  + NL+FL  A  Q
Sbjct: 217 DDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQ 276

Query: 213 AIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCP--IPS 270
            +P +      + +  L  VL V+  KE+++DI R   D+E NN   E+ ++     I  
Sbjct: 277 QVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIER 336

Query: 271 K--DLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSL 328
           +  D++ GD+I++K    +PAD++V+ ++EP G  +I+T  LDGET+ K++ A   T  +
Sbjct: 337 RWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEM 396

Query: 329 TENDLLNNI--TITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICC 386
            ++  LNN    + +  P  S++ + G + + ++   PLS +  +     L +++     
Sbjct: 397 MDSRKLNNFKGKVISEQPNSSLYTYEGTLEF-NNRKIPLSPEQMILRGATLRNTSWMFGL 455

Query: 387 IVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNN 440
           +++TG ET+   N T +  K   +E  IN    +    +F + I+LV  +   N
Sbjct: 456 VIFTGHETKLMRNATATPIKRTAVERVIN----LQIVALFGVLIVLVLISSLGN 505

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 96.3 bits (238), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 190/834 (22%), Positives = 332/834 (39%), Gaps = 129/834 (15%)

Query: 191 LILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKR 250
           ++L++       +  + +A+S A+     G + S+++ +  ++ +    +A   +N  K 
Sbjct: 65  MVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKN 124

Query: 251 DREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQT-NEPNGESFIKTDQ 309
               N  +     K   I SKD+  GDI  +K G  +PAD+ +++T N    ES +  + 
Sbjct: 125 LSSPNAHVIRN-GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGES 183

Query: 310 LDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLS-VD 368
           L    D  L        S+   D LN +  ++SA    +      I  K + +S +  + 
Sbjct: 184 LPVSKDANLVFGKEEETSV--GDRLN-LAFSSSA---VVKGRAKGIVIKTALNSEIGKIA 237

Query: 369 NTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLL 428
            ++  ++ L S       +  T   T++             L  +++ L+ +L     L 
Sbjct: 238 KSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLF 297

Query: 429 SIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIV 488
           +I+++A   F+  D  V I    +  S +IP SL V L +  SV A  +       + IV
Sbjct: 298 AIIVMASQKFDV-DKRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVMVS----RNVIV 351

Query: 489 RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTNE---------TMDIV 536
           R     E LG +  + SDKTGTLTQ  M  ++I     GT++ +N           + ++
Sbjct: 352 RKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLI 411

Query: 537 TDFIQXXXXXXXXXXXXXXXKNISDRV--------IDL--------VTTLAICHNVTPTF 580
             F                 +N  DR+        ID+          TLA   N+   F
Sbjct: 412 PRF-SPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLA---NIATVF 467

Query: 581 EDGELTYQAA--SPDEIAIVKFTESVGL------------SLFRRDRHSISLFHDHSGMK 626
           +D       A   P EIAI  F   + L                 D+ S+S  ++  G  
Sbjct: 468 KDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPG-S 526

Query: 627 LEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDW---------- 676
            +++    FPF+S  KRM  + ++   + Y    KGA    S I   + W          
Sbjct: 527 AQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGA--FESIISCCSSWYGKDGVKITP 584

Query: 677 --------LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNV 728
                   + +   +++ EGLR L    K  + +               + D ++     
Sbjct: 585 LTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKD--------------QVNDDQLKNITS 630

Query: 729 VRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 788
            R   E+DL  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++
Sbjct: 631 NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL 690

Query: 789 SRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPT 848
               Y                  Y Q   +S ++   +  GL      +E  D +  LP 
Sbjct: 691 PTNLY-----------------HYSQEIVDSMVMTGSQFDGL-----SEEEVDDLPVLPL 728

Query: 849 VVACRCTPQQKADVAVFIRQATGKRVCCI-GDGGNDVSMIQCADVGVGIVGKEGKQASLA 907
           V+A RC+PQ K  +   + +   K+ C + GDG ND   ++ A+VG+ + G  G   S  
Sbjct: 729 VIA-RCSPQTKVRMIEALHRR--KKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDVSKE 784

Query: 908 ADFSITQFCHLTKLL--LWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSM 959
           A   +    +   +L  +  GR   + +  + +FV+   L  +V QA+Y I  +
Sbjct: 785 ASDIVLSDDNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQALYLIIGL 834

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 190/834 (22%), Positives = 332/834 (39%), Gaps = 129/834 (15%)

Query: 191 LILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKR 250
           ++L++       +  + +A+S A+     G + S+++ +  ++ +    +A   +N  K 
Sbjct: 65  MVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKN 124

Query: 251 DREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQT-NEPNGESFIKTDQ 309
               N  +     K   I SKD+  GDI  +K G  +PAD+ +++T N    ES +  + 
Sbjct: 125 LSSPNAHVIRN-GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGES 183

Query: 310 LDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLS-VD 368
           L    D  L        S+   D LN +  ++SA    +      I  K + +S +  + 
Sbjct: 184 LPVSKDANLVFGKEEETSV--GDRLN-LAFSSSA---VVKGRAKGIVIKTALNSEIGKIA 237

Query: 369 NTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLL 428
            ++  ++ L S       +  T   T++             L  +++ L+ +L     L 
Sbjct: 238 KSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLF 297

Query: 429 SIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIV 488
           +I+++A   F+  D  V I    +  S +IP SL V L +  SV A  +       + IV
Sbjct: 298 AIIVMASQKFDV-DKRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVMVS----RNVIV 351

Query: 489 RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTNE---------TMDIV 536
           R     E LG +  + SDKTGTLTQ  M  ++I     GT++ +N           + ++
Sbjct: 352 RKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLI 411

Query: 537 TDFIQXXXXXXXXXXXXXXXKNISDRV--------IDL--------VTTLAICHNVTPTF 580
             F                 +N  DR+        ID+          TLA   N+   F
Sbjct: 412 PRF-SPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLA---NIATVF 467

Query: 581 EDGELTYQAA--SPDEIAIVKFTESVGL------------SLFRRDRHSISLFHDHSGMK 626
           +D       A   P EIAI  F   + L                 D+ S+S  ++  G  
Sbjct: 468 KDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPG-S 526

Query: 627 LEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDW---------- 676
            +++    FPF+S  KRM  + ++   + Y    KGA    S I   + W          
Sbjct: 527 AQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGA--FESIISCCSSWYGKDGVKITP 584

Query: 677 --------LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNV 728
                   + +   +++ EGLR L    K  + +               + D ++     
Sbjct: 585 LTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKD--------------QVNDDQLKNITS 630

Query: 729 VRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 788
            R   E+DL  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++
Sbjct: 631 NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL 690

Query: 789 SRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPT 848
               Y                  Y Q   +S ++   +  GL      +E  D +  LP 
Sbjct: 691 PTNLY-----------------HYSQEIVDSMVMTGSQFDGL-----SEEEVDDLPVLPL 728

Query: 849 VVACRCTPQQKADVAVFIRQATGKRVCCI-GDGGNDVSMIQCADVGVGIVGKEGKQASLA 907
           V+A RC+PQ K  +   + +   K+ C + GDG ND   ++ A+VG+ + G  G   S  
Sbjct: 729 VIA-RCSPQTKVRMIEALHRR--KKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDVSKE 784

Query: 908 ADFSITQFCHLTKLL--LWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSM 959
           A   +    +   +L  +  GR   + +  + +FV+   L  +V QA+Y I  +
Sbjct: 785 ASDIVLSDDNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQALYLIIGL 834

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 174/787 (22%), Positives = 307/787 (39%), Gaps = 157/787 (19%)

Query: 268  IPSKDLKVGDIIKLKKGAR--VPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLT 325
            +PS DL  GDI +L   +   +P D +++     +G+  +    L GE+    ++A +  
Sbjct: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606

Query: 326  QSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACIC 385
              L    LL++                    + D+  S     + ++  T L    A   
Sbjct: 607  TML---QLLDD--------------------FMDTQLSSFVSKSFLFNGTKLIRVRATAG 643

Query: 386  CIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNN---- 441
              +  G   R   +TTK      ++  +  G      +  ++  I ++A  GF  +    
Sbjct: 644  QSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQF 703

Query: 442  -----DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPED 496
                 D    I+R L + + ++P +L  +L +G      +++       +  R +     
Sbjct: 704  LRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV---- 759

Query: 497  LGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDI------VTDFIQXXXXXXXXX 550
             G+I+ +  DKTGTLT++ + +  +H+  V    + M I      V D +Q         
Sbjct: 760  GGKIDVMCFDKTGTLTEDGLDVLGVHV--VQPLQQEMKISKLVTDVKDLLQSLSLSDCVS 817

Query: 551  XXXXXXKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFT-----ESVG 605
                  KN        + +L  CH++     DGEL      P +  +V+FT     E  G
Sbjct: 818  TRDMKAKN-------FLVSLLTCHSLR--MVDGELL---GDPFDFKMVQFTKWSDEEETG 865

Query: 606  ---LSLFRRDRHSISLFHDHS------------GMKLEYD----IKIL--FPFNSDSKRM 644
               +     +RH  S   ++S            G  +E +    I I+  F F S+ +RM
Sbjct: 866  NRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRM 925

Query: 645  GVIIFDKLKQEYWFLQKGADTVMSSIVVRNDW---LEEETSNMATEGLRTLVIGRKKLST 701
             VI+    +  +    KGA  V+  +  +       E    +    G R +    KKL+ 
Sbjct: 926  SVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTR 985

Query: 702  NLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLR 761
              +                  ++ Q V R+ +E++LE LG    E+KL+   K ++E L 
Sbjct: 986  QSW------------------LYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLH 1027

Query: 762  NAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHTVTKVN-KPEGALHHLEYLQVNQNS 819
             A I+  M TGD V TA  V   A L+   + +V  +  ++   EG +  + +  V  +S
Sbjct: 1028 RADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDI--ITWQNVANSS 1085

Query: 820  ------------------CLLIDGESLGLYLQYFPDEFFDIVVN--LPTVVACRCTPQQK 859
                               L + GE   L  +    +  +++ N  L T +  R +P +K
Sbjct: 1086 DTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEK 1145

Query: 860  ADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---C 916
             ++   + Q+ G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+   F   C
Sbjct: 1146 HELVERL-QSIGYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLFEISC 1201

Query: 917  HLTKLLLWHGRNS---------YKSSAKLSQFVI-----HRGLIISVCQAVYSICSMFEP 962
             L   ++  GR +         Y S    +QFV       RG  +   Q +Y    +  P
Sbjct: 1202 VLD--VMKEGRAALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVP 1259

Query: 963  LALYQGW 969
            LA++  W
Sbjct: 1260 LAVFMSW 1266

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 189/834 (22%), Positives = 331/834 (39%), Gaps = 129/834 (15%)

Query: 191 LILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKR 250
           ++L++       +  + + +S A+     G + S+++ +  ++ +    +A   +N  K 
Sbjct: 65  MVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKN 124

Query: 251 DREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQT-NEPNGESFIKTDQ 309
               N  +     K   I SKD+  GDI  +K G  +PAD+ +++T N    ES +  + 
Sbjct: 125 LSSPNAHVIRN-GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGES 183

Query: 310 LDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLS-VD 368
           L    D  L        S+   D LN +  ++SA    +      I  K + +S +  + 
Sbjct: 184 LPVSKDANLVFGKEEETSV--GDRLN-LAFSSSA---VVKGRAKGIVIKTALNSEIGKIA 237

Query: 369 NTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLL 428
            ++  ++ L S       +  T   T++             L  +++ L+ +L     L 
Sbjct: 238 KSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLF 297

Query: 429 SIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIV 488
           +I+++A   F+  D  V I    +  S +IP SL V L +  SV A  +       + IV
Sbjct: 298 AIIVMASQKFDV-DKRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVMVS----RNVIV 351

Query: 489 RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTNE---------TMDIV 536
           R     E LG +  + SDKTGTLTQ  M  ++I     GT++ +N           + ++
Sbjct: 352 RKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLI 411

Query: 537 TDFIQXXXXXXXXXXXXXXXKNISDRV--------IDL--------VTTLAICHNVTPTF 580
             F                 +N  DR+        ID+          TLA   N+   F
Sbjct: 412 PRF-SPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLA---NIATVF 467

Query: 581 EDGELTYQAA--SPDEIAIVKFTESVGL------------SLFRRDRHSISLFHDHSGMK 626
           +D       A   P EIAI  F   + L                 D+ S+S  ++  G  
Sbjct: 468 KDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPG-S 526

Query: 627 LEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDW---------- 676
            +++    FPF+S  KRM  + ++   + Y    KGA    S I   + W          
Sbjct: 527 AQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGA--FESIISCCSSWYGKDGVKITP 584

Query: 677 --------LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNV 728
                   + +   +++ EGLR L    K  + +               + D ++     
Sbjct: 585 LTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKD--------------QVNDDQLKNITS 630

Query: 729 VRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 788
            R   E+DL  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++
Sbjct: 631 NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL 690

Query: 789 SRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPT 848
               Y                  Y Q   +S ++   +  GL      +E  D +  LP 
Sbjct: 691 PTNLY-----------------HYSQEIVDSMVMTGSQFDGL-----SEEEVDDLPVLPL 728

Query: 849 VVACRCTPQQKADVAVFIRQATGKRVCCI-GDGGNDVSMIQCADVGVGIVGKEGKQASLA 907
           V+A RC+PQ K  +   + +   K+ C + GDG ND   ++ A+VG+ + G  G   S  
Sbjct: 729 VIA-RCSPQTKVRMIEALHRR--KKFCTMTGDGVNDSPSLKMANVGIAM-GINGSDVSKE 784

Query: 908 ADFSITQFCHLTKLL--LWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSM 959
           A   +    +   +L  +  GR   + +  + +FV+   L  +V QA+Y I  +
Sbjct: 785 ASDIVLSDDNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQALYLIIGL 834

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 139/592 (23%), Positives = 242/592 (40%), Gaps = 107/592 (18%)

Query: 442  DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIE 501
            ++ V I+R L + + ++P +L   L +G S    +++       +  R +      G+++
Sbjct: 708  EYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV----GGKVD 763

Query: 502  YLLSDKTGTLTQNDMQLKKIHLGTVSYTNETM---DIVTD---FIQXXXXXXXXXXXXXX 555
             +  DKTGTLT+  + +  IH      ++  +   D++TD    +Q              
Sbjct: 764  MMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFK 823

Query: 556  XKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESV---GLSLFR-- 610
             KN        + +L  CH++     DGEL      P ++ + +FT+     G   ++  
Sbjct: 824  AKN-------FLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYESWKFK 871

Query: 611  --RDRHSIS--LFHDHSGMK-LEYDIKIL------FPFNSDSKRMGVIIFDKLKQEYWFL 659
               D+  IS  + H  S    +E D   L      F F S+ +RM VI+    +  YW  
Sbjct: 872  NAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSF 931

Query: 660  QKGADTVMSSI----VVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEAS 715
             KGA  V++ I     +  D+  E   +    G R +    K L  + +           
Sbjct: 932  TKGAPEVIADICNPATIPKDF-HELLHHYTHNGFRIIACAGKTLPKSSW----------- 979

Query: 716  LTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 775
                   ++ Q V R+ +E++LE LG    E+KL+   K++++ L+NA I+  M TGD V
Sbjct: 980  -------LYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNV 1032

Query: 776  ETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLL------------- 822
             TA  V   + LIS  +        N  E + H L +  V++   +L             
Sbjct: 1033 LTAVSVGRDSGLISSERVFIPFLNDNLEE-SRHLLSWRDVDEEGSVLDAVTLKPLNDPEK 1091

Query: 823  -----IDGESLGLYL---QYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRV 874
                 I G+   +     +  PD++   V+   ++ A R +P +K ++   + Q     V
Sbjct: 1092 SYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYA-RMSPDEKHELVEQL-QKLDYNV 1149

Query: 875  CCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CHLTKLLLWHGRNS-- 929
               GDG ND   ++ A++G+ +   E   AS+AA F+   F   C L   ++  GR S  
Sbjct: 1150 GFCGDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVFDISCVLD--VIKEGRASLV 1204

Query: 930  -------YKSSAKLSQFVI-----HRGLIISVCQAVYSICSMFEPLALYQGW 969
                   Y S     QF+       RG  +   Q +Y    +  P+A+   W
Sbjct: 1205 TSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSW 1256

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 194/810 (23%), Positives = 321/810 (39%), Gaps = 160/810 (19%)

Query: 268 IPSKDLKVGDIIKLKKGARVPADV-VVLQTNEPNGESFIKTDQL----------DGETDW 316
           + S D+  GD++ +K G  +PAD+ +V Q N    E+ +  + L          D ET  
Sbjct: 137 VDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPV 196

Query: 317 KLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPL-SVD--NTMWE 373
             R+  + + S         I I     +  ++  +GKI       + L S D   T ++
Sbjct: 197 GDRINLAFSSSTVVKGRAQGIAI-----KTGLNTEIGKIAKSLRGGNELISRDPAKTWYQ 251

Query: 374 NTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLV 433
           N  ++           T R     L TT+       L  +++ L+ +L     + +I+++
Sbjct: 252 NAWIS-----------TKRTVGAFLGTTQGTP----LHRKLSKLAVLLFWIAVVFAIVVM 296

Query: 434 AFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTI 493
           A   F+  D  V I    +  S +IP SL V L +  SV A  +       + I+R    
Sbjct: 297 ASQKFDV-DRGVAIYAVCVALS-MIPSSLVVVLTITMSVGAAVMAS----RNVIIRKLDS 350

Query: 494 PEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGT--VSYTNETM-----DI-------- 535
            E LG +  + SDKTGTLTQ  M  K+I     GT  V  +NE +     DI        
Sbjct: 351 LEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSP 410

Query: 536 ------VTDFIQXXXXXXXXXXXXXXXKNISDRVIDLVTTLAICHNVTPTFEDGELTYQA 589
                  T+ +                 N   ++ D     A   N+   F D E     
Sbjct: 411 YEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWK 470

Query: 590 A--SPDEIAIVKFTESVGLSLF----RRD-------RHSISLFH-DHSGMKLEYDIKILF 635
           A   P EIAI  F   + L        RD         S+SL   D +    ++     F
Sbjct: 471 AHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEF 530

Query: 636 PFNSDSKRMGVIIFDKLKQEYWFLQKGA------------------DTVMSSIVVRNDWL 677
           PF+S  KRM  +   +  + Y    KGA                   TVM+   V  D +
Sbjct: 531 PFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADV--DTI 588

Query: 678 EEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDL 737
           +E   +M++EGLR L    K          + + +E  L  + +E       R + E  L
Sbjct: 589 KENIDSMSSEGLRVLAFANKSYP-------KSDVNEEKLQKILKE-------RDYAETGL 634

Query: 738 ELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTV 797
             LGL G+ D  +++   +++    AGI + MLTGD   TA+ ++    ++    Y ++ 
Sbjct: 635 TFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSK 694

Query: 798 TKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQ 857
             V+                   +++ G+    +     DE  ++ V LP V+A RC+PQ
Sbjct: 695 EVVD------------------IMVMTGKQ---FDNLSEDEIDNLPV-LPLVIA-RCSPQ 731

Query: 858 QKADVAVFIRQATGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKEGKQASLAADFSITQ 914
            K  +   + +   ++ C + GDG ND   ++ A+VG+  GI G +  + +     S   
Sbjct: 732 TKVRMIEALHRR--EKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDN 789

Query: 915 FCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSM-FE--------PLAL 965
           F  +   +   GR   + S  + +FV+   L  +V QA+Y I  + F+        PLA 
Sbjct: 790 FASILNAVE-EGR---RMSDNIQKFVLQL-LAENVAQALYLIVGLAFQDKEGKSVFPLAP 844

Query: 966 YQGWLMVGYATCYTMAPVFSLTLD---HDI 992
            +   ++   +C+   P   L L+   HD+
Sbjct: 845 VEVLWIIVVTSCF---PAMGLGLEKAAHDL 871

>Kwal_26.9207
          Length = 1469

 Score = 89.7 bits (221), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 142/655 (21%), Positives = 256/655 (39%), Gaps = 119/655 (18%)

Query: 395  RQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNN---------DWYV 445
            R   +TTK      ++  + +G      +  ++  + L+A AGF+ +          + V
Sbjct: 671  RTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKV 730

Query: 446  DIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDK--QIEDTIVRTSTIPEDLGRIEYL 503
             I+R L + + ++P +L   L +G S    +++      I  T V  S      G+I+ +
Sbjct: 731  MILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVS------GKIDVM 784

Query: 504  LSDKTGTLTQNDMQLKKIHLGTV-SYTNETMDIVTDFIQXXXXXXXXXXXXXXXKNISDR 562
              DKTGTLT++ + +  +H+     + N     +   I                  I  +
Sbjct: 785  CFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGAL---ITNVRGLFNKYSLNDCGSPIDFK 841

Query: 563  VIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFT--------ESVGLSLFRRDRH 614
              + + +L  CH++     DGEL      P +  + +FT        +         +R+
Sbjct: 842  SRNFLVSLLTCHSLRVV--DGELL---GDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERN 896

Query: 615  SISLFHDHSGMK---------------LEYDIKIL------FPFNSDSKRMGVIIFDKLK 653
            + S   +++G+                 E D   L      F F S+ +RM VI+    +
Sbjct: 897  NKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGE 956

Query: 654  QEYWFLQKGADTVMSSIVVRNDW---LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKE 710
              +W   KGA  V+S I  ++      E+        G R +    K L    +      
Sbjct: 957  NVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWR----- 1011

Query: 711  YSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWML 770
                           Q V R+ +E+++E LG    E+KL+     ++  L++AGI+  M 
Sbjct: 1012 -------------FAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMC 1058

Query: 771  TGDKVETARCVSISAKLISRGQ-YVHTVTKVNKPEGAL---------------HHLEYLQ 814
            TGD V TA  V   + LI+    +V  +     P   L                 LE + 
Sbjct: 1059 TGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMN 1118

Query: 815  VNQNSCLLIDGESLGLYL---QYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATG 871
             + +  + + G+   L     +  P+ + ++V+ L + +  R +P +K ++ V   Q   
Sbjct: 1119 GSSDYTIAVTGDVFRLLFKNNEVLPESYINMVL-LKSSIYARMSPDEKHEL-VGQLQGLD 1176

Query: 872  KRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CHLTKLLLWHGRN 928
              V   GDG ND   ++ ADVGV +   E   AS+AA F+ + F   C L   ++  GR 
Sbjct: 1177 YVVGFCGDGANDCGALKAADVGVSLSEAE---ASVAAPFTSSVFEISCILD--VIKEGRA 1231

Query: 929  SYKSSAKLSQF--------------VIHRGLIISVCQAVYSICSMFEPLALYQGW 969
            S  +S    Q+              +  RG+ +   Q +Y    +  P+A++  W
Sbjct: 1232 SLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSW 1286

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 159/753 (21%), Positives = 288/753 (38%), Gaps = 169/753 (22%)

Query: 198 KFFFNLY---FLIVALSQAIPQLRIGYLSSYI-VPLAFVLTVTMSKEAMDDINRRKRDRE 253
           KF  N      +++ +  AI  + +G +   I + +A V+ VT+         +  R  +
Sbjct: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVG------FVQEYRSEK 148

Query: 254 ANNELYEVVNKPC---------PIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESF 304
           +   L ++V + C          + + +L  GD+++ + G R+PAD+ +++ N+      
Sbjct: 149 SLEALNKLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLT---- 204

Query: 305 IKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSS- 363
           I    L GETD                            P H  +  L + +Y D  +S 
Sbjct: 205 IDESNLTGETD----------------------------PVHKSYKALSRDSYNDQPNSI 236

Query: 364 -PLSVDNTMWENTVLASSAACICCIVYTGRETRQA----LNTTKSKAKTGLLELEINGLS 418
            P++    +     L         +V TGRET       + ++  K KT L +L ++ L 
Sbjct: 237 VPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPL-QLTMDKLG 295

Query: 419 KILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIE 478
           K L    F++  ++          W       + L    IP  L + + +  ++   ++ 
Sbjct: 296 KDLSLASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 355

Query: 479 HDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI-HLGTVSYTNETMDIVT 537
             K     IVR     E LG +  + SDKTGTLT N M + KI  LG+++     + +  
Sbjct: 356 KRK----AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSL-- 409

Query: 538 DFIQXXXXXXXXXXXXXXXKNISDRVIDLVTTLAICHNV--TPTFEDGELTYQAASPDEI 595
                               N+ + + D V T  +C N+    ++      Y   +P ++
Sbjct: 410 --------------DKNKGGNLKNYLTDDVKTTLLCGNLCNNASYSQEHAKY-LGNPTDV 454

Query: 596 AIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQE 655
           A+++  +   L+  R                 EY       FNS  K M   I D  K+ 
Sbjct: 455 ALLEQLQKFELADVRS----------------EYTKVKELSFNSKRKMMATKIQDNEKKT 498

Query: 656 YWFLQKGADTVM---SSIVVRNDWLEEETSN-----------MATEGLRTLVIGRKKLST 701
             F++   + ++   SS +     +E+ T+            +A+EGLR L   ++ ++ 
Sbjct: 499 TLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTD 558

Query: 702 NLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLR 761
           +  +  E + S                       DL   GL G+ D  +  VK +I+   
Sbjct: 559 SSSKLVEDDIS-----------------------DLVFTGLIGMNDPPRSSVKFAIDQFL 595

Query: 762 NAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCL 821
             GI I M+TGD   TA               V+   ++  P           V      
Sbjct: 596 QGGIHIIMITGDSENTA---------------VNIARQIGIP-----------VIDPKLS 629

Query: 822 LIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGG 881
           ++ G+ L    +   D+  +++ ++   +  R TP+ K ++   +R+  G  V   GDG 
Sbjct: 630 VLSGDKLN---EMTDDQLANVIDHVN--IFARATPEHKLNIVRALRR-RGDVVAMTGDGV 683

Query: 882 NDVSMIQCADVGVGIVGKEGKQ-ASLAADFSIT 913
           ND   ++ AD+GV + G+ G   A  A+D  +T
Sbjct: 684 NDAPALKLADIGVSM-GRMGTDVAKEASDMILT 715

>Scas_665.30
          Length = 1439

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 144/656 (21%), Positives = 251/656 (38%), Gaps = 118/656 (17%)

Query: 395  RQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNN---------DWYV 445
            R   +TTK      ++  +  G      +  ++  + L+A  GF+ +         D   
Sbjct: 441  RTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRT 500

Query: 446  DIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLS 505
             I+R L + + ++P +L   L +G      +++       +  R +      G+I+ L  
Sbjct: 501  MILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNI----GGKIDILCF 556

Query: 506  DKTGTLTQNDMQLKKIHLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXKNISDRVID 565
            DKTGTLT+N + +  + L   S  N       D +Q                    R  +
Sbjct: 557  DKTGTLTENGLDVLGVQLCVPSSHNSFQ--FADLVQDVHKLFPKFSLNDCSSPRDYRAKN 614

Query: 566  LVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFT---------ESVGLSLFRRDRHSI 616
               +L  CH++     D EL      P +  + +FT         E    S +   RH  
Sbjct: 615  FFISLLTCHSLRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDN 669

Query: 617  SL---------------------FHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQE 655
            +L                     F D+        I+  F F S+ +RM VI+    +  
Sbjct: 670  ALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIR-SFEFLSELRRMSVIVKPSNEDV 728

Query: 656  YWFLQKGADTVMSSIVVRNDW---LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYS 712
            YW   KGA  V++ I  +       EE  +    +G R +    + L  N +        
Sbjct: 729  YWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTW-------- 780

Query: 713  EASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTG 772
                      ++ Q V R+ +E+++E LG    E+KL+K+   +++ L+ A I+  M TG
Sbjct: 781  ----------LYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTG 830

Query: 773  DKVETARCVSISAKLI-SRGQYVHTVTK-------------VNKPEGALHHLEYLQVNQN 818
            D V TA  V     LI S+  YV ++ +             V+  +  L     L +N +
Sbjct: 831  DNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNS 890

Query: 819  SC----LLIDGESLGLYLQYFPDEFFDI------VVNLPTVVACRCTPQQKADVAVFIRQ 868
            S     L I G+   ++   F DE   I       V L   +  R +P +K ++   +++
Sbjct: 891  SSTSYTLAITGD---IFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQR 947

Query: 869  ATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF------------- 915
                   C GDG ND   ++ ADVG+ +   E   AS+AA F+   F             
Sbjct: 948  LNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSQVFDISCVLDVIKEGR 1003

Query: 916  -CHLTKLLLWHGRNSYKSSAKLSQFVIH-RGLIISVCQAVYSICSMFEPLALYQGW 969
             C +T    +   + Y +   ++  V++ RG  +   Q +Y    +  P+A++  W
Sbjct: 1004 ACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSW 1059

>Kwal_23.3160
          Length = 1100

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 190/807 (23%), Positives = 323/807 (40%), Gaps = 162/807 (20%)

Query: 268 IPSKDLKVGDIIKLKKGARVPADV-----VVLQTNEP--NGESFIKTDQLDG------ET 314
           IPSK L  GD+  +K G  VPAD+     V  +T+E    GES     +         +T
Sbjct: 147 IPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPATEDT 206

Query: 315 DWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYK-DSTSSPLSVD--NTM 371
               RL  +   S         I +     +  ++  +GKI       +S +S D   T 
Sbjct: 207 PVGDRLNLAFASSTVSKGRATGIVV-----KTGLNTEIGKIAQSLKGDNSLISKDENKTF 261

Query: 372 WENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIM 431
           W N  + + AA I    + G  T   L+   SK            L+ +L     + +I+
Sbjct: 262 WANAGI-TLAATIGS--FLGTTTGTPLHRKLSK------------LAVLLFFIAVVFAIV 306

Query: 432 LVAFAGFNNNDWYVDIMRYLILFS-TIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRT 490
           ++A   F  N    ++  Y I  + ++IP SL V L +  SV A KI   + +   +VR 
Sbjct: 307 VMATQKFVVNK---EVAIYAICVAVSMIPSSLVVVLTITMSVGA-KIMATRNV---VVRK 359

Query: 491 STIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTNET---------MDIVTD 538
               E LG +  + SDKTGTLTQ  M +K+      GT++ +N +         ++++  
Sbjct: 360 LDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPR 419

Query: 539 FI--QXXXXXXXXXXXXXXXKN--ISDRV---------IDLVTTLAICHNVTPTFEDGEL 585
           F   Q               KN   +D++         ++ + T A+  N+   ++D E 
Sbjct: 420 FSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALA-NIAHVYQDPET 478

Query: 586 TYQAA--SPDEIAIVKFTESVGL---SLFRRDR------HSISLFHDHSGMKLEYDIKIL 634
               A   P EIAI  F   + +   +L   D+         +L    S ++  Y     
Sbjct: 479 EEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAE 538

Query: 635 FPFNSDSKRMGVI-----------IFDKLKQEY-------WFLQKGADTVMSSIVVRNDW 676
           FPF+S  KRM  +           +F K   E        W L  G +   +  +   D 
Sbjct: 539 FPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKW-LPDGCNESDAKPMTEEDK 597

Query: 677 LE--EETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLE 734
            E  +    +++EGLR L    K             ++E+    +  ++      R F+E
Sbjct: 598 EEVFKNVETLSSEGLRVLAFATKS------------FTESQALKVSEDLRKN---RDFVE 642

Query: 735 NDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYV 794
           +DL   GL G+ D  +++   +++    AGI + MLTGD   TA+ ++    ++ R  Y 
Sbjct: 643 SDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLY- 701

Query: 795 HTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRC 854
                            Y +   +S ++   +          DE  D ++ LP V+A RC
Sbjct: 702 ----------------HYPKEVVDSMVMTAAQ-----FDQLTDEEIDNLLLLPLVIA-RC 739

Query: 855 TPQQKADVAVFIRQATGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKEGKQASLAADFS 911
            PQ K  +   + +   ++ C + GDG ND   ++ A+VG+  GI G +  + +     S
Sbjct: 740 APQTKVRMIDALHRR--EKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLS 797

Query: 912 ITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVY---SICSMFE------P 962
              F  +   +   GR   + S  + +FV+   L  +V QA+Y    +C + E      P
Sbjct: 798 DDNFASILNAVE-EGR---RMSDNIQKFVLQL-LAENVAQALYLMIGLCFLDEDRLSVFP 852

Query: 963 LALYQGWLMVGYATCYTMAPVFSLTLD 989
           L+  +   ++   +C+   P   L L+
Sbjct: 853 LSPVEVLWIIVVTSCF---PAMGLGLE 876

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 144/650 (22%), Positives = 261/650 (40%), Gaps = 104/650 (16%)

Query: 266 CPIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLT 325
           C +P      GD++  K G R+PADV ++++ + +    +    L GET+  +  +C+  
Sbjct: 174 CLVP------GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE-PVHKSCTPV 222

Query: 326 QSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACIC 385
            S T +D+   I       E +   ++G +           V     +  V+A+    + 
Sbjct: 223 NSATYSDVPGGIIPIG---ERTSIAYMGTL-----------VREGHGKGIVVATGKHTMF 268

Query: 386 CIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYV 445
             V+      + +N+ + K KT L ++ ++ L + L    F+LS ++          W  
Sbjct: 269 GAVF------EMMNSIE-KPKTPL-QMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSWLE 320

Query: 446 DIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLS 505
                + L    IP  L + + +  ++   ++ + K     IVR     E LG +  + S
Sbjct: 321 MFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRK----AIVRRLPSVETLGSVNVICS 376

Query: 506 DKTGTLTQNDMQLKKI-HLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXKNISDRVI 564
           DKTGTLT N M   KI  LG+++  N  +      ++                 +SD V 
Sbjct: 377 DKTGTLTANHMTASKIWCLGSMANKNNVLS-----LEAKSSGGLPGKLPNLKNYLSDDVK 431

Query: 565 DLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSG 624
             +   +IC+N + + E G+      +P +IA+++  +   L   R     +     +S 
Sbjct: 432 ATLRIGSICNNASFSHEHGKYL---GNPTDIALLEVLQKFDLVDERPTTTRVDELTFNSK 488

Query: 625 MKLEYDIKILFPFNSDSKRMGVI-IFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSN 683
            K    +K+  P NS    + V   F+++ +       GA  V          + +   +
Sbjct: 489 RKY-MAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKS 547

Query: 684 MATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLT 743
           +A+EGLRTL   + + STN      K  +++++                   +L  +GL 
Sbjct: 548 LASEGLRTLAFAQLECSTN------KPMNDSTI------------------QNLTFVGLI 583

Query: 744 GVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKP 803
           G++D  +  V+ +IE L   G+ + M+TGD   TA               V+   ++  P
Sbjct: 584 GMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTA---------------VNIARQIGIP 628

Query: 804 EGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVA 863
                      +N    +L      G  L    D+    V++   + A R TP+ K ++ 
Sbjct: 629 ----------VINPEISVLT-----GDRLDQMTDDQLAGVIDHVNIFA-RATPEHKLNI- 671

Query: 864 VFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT 913
           V   Q  G  V   GDG ND   ++ AD+GV +       A  A+D  +T
Sbjct: 672 VRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLT 721

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 134/308 (43%), Gaps = 54/308 (17%)

Query: 635  FPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDW---LEEETSNMATEGLRT 691
            F F S+ +RM VI+       YW   KGA  V+S I  ++      EE        G R 
Sbjct: 932  FEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRV 991

Query: 692  LVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQK 751
            +    K L    +                  ++ Q V R+ +E++LE LG    ++KL+K
Sbjct: 992  IACAGKTLPKRTW------------------LYSQKVSREEVESNLEFLGFIIFQNKLKK 1033

Query: 752  DVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLIS--------------RGQYVHTV 797
            +   +++ L++A I+  M TGD + TA  V   A LI                G+ V   
Sbjct: 1034 ETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVW 1093

Query: 798  TKVNKPEGAL--HHLEYLQVNQNSC---------LLIDGESLGLYLQ---YFPDEFFDIV 843
              VN+P+  L    L+ +++  NS          L + G+   L  +     P+E+ + +
Sbjct: 1094 RDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEI 1153

Query: 844  VNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ 903
            + L + +  R +P +K ++ + + Q     V   GDG ND   ++ ADVG+ +   E   
Sbjct: 1154 L-LNSSIYARMSPDEKHELMIQL-QKLDYTVGFCGDGANDCGALKAADVGISLSEAE--- 1208

Query: 904  ASLAADFS 911
            AS+AA F+
Sbjct: 1209 ASVAAPFT 1216

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 171/781 (21%), Positives = 310/781 (39%), Gaps = 159/781 (20%)

Query: 245 INRRKRDRE------ANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQTNE 298
           +NR++ DR+      A   L  + N         L VGD++KL+ G  VPAD V+++   
Sbjct: 150 LNRKREDRQVVVVRDAAESLISIHN---------LLVGDLLKLQTGDVVPADCVLVR--- 197

Query: 299 PNGESFIKTDQLDGETDW--KLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKIT 356
             GE       L GE++   KL LA +L                     HS H   G   
Sbjct: 198 --GECETDESALTGESNTIKKLPLADALEY-------------------HSAH---GGRD 233

Query: 357 YKDSTSSPLS--VDNTMWENTVLASS-------AACICCIVYTGRETRQALNTTKSKAKT 407
             D+++S  S   D++   + +L S        A+ I   V       + + + K  ++ 
Sbjct: 234 IGDTSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSED 293

Query: 408 GLLELEINGLSKILC--ACVFLLSIMLVAFAGF-----NNNDWYVDI---------MRYL 451
             L++ ++ L+  +    CV  +++ +V FA +      +   Y D+         M   
Sbjct: 294 TPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLSYILPSGGKYHDLPPAEKGSKFMDIF 353

Query: 452 ILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIED-TIVRTSTIPEDLGRIEYLLSDKTGT 510
           I   T+I V++   L L  ++ A      +  +D  +VR     E +G    + SDKTGT
Sbjct: 354 ITAITVIVVAVPEGLPLAVTL-ALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGT 412

Query: 511 LTQNDMQLKKIHLGTVSYTN--------------ETMDIVTDFIQXXXXXXXXXXXXXXX 556
           LT+N M + +  LG   + +              +  D++   I                
Sbjct: 413 LTENIMTVVRGTLGRAGFDDIGADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDY 472

Query: 557 KNISD----------RVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGL 606
           K+ ++          R+I  +T         P  E+  L + A    E  I   TE+  L
Sbjct: 473 KDPNNYNSIDDSQPRRLIRRITQ--TLQKKKPDDEENLLAHAAEGRQEPYIGSKTETALL 530

Query: 607 SLFRRDRH----SISLFHDHSGM--KLEYDIKILFPFNSDSKRMGVIIF------DKLKQ 654
           SL R+       ++  F  H      +E  ++I+ PF S  K   +++       ++ K+
Sbjct: 531 SLARKSFGLKFGALQSFRGHPEKLPTVETIVQII-PFESSRKWSAIVVKLNSNKENEGKK 589

Query: 655 EYWFLQKGADTVMSSIVVRN--------------DWLEEETSNMATEGLRTLVIGRKKLS 700
              +++  A+ V  +  ++N              D +EE+  ++A + LR + +      
Sbjct: 590 FRLYVKGAAEIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFD 649

Query: 701 TNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELL 760
            N  E   KE ++   +     V + +  +  LE  L L  + G++D L+++VK+S+   
Sbjct: 650 VN--EWPPKELADPENSHEALAVKLIDPKKPHLEG-LTLDAIVGIQDPLRENVKNSVAQC 706

Query: 761 RNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSC 820
           + AG+ + M+TGD + TA+ ++ +  ++S                         +N ++C
Sbjct: 707 QKAGVTVRMVTGDNLLTAKAIARNCGILSSK----------------------SLNDSAC 744

Query: 821 LLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDG 880
            + +G +   + +    E   I+  L   V  R +P+ K  + V   +  G+ V   GDG
Sbjct: 745 AM-EGPA---FRKLSDSERKRILPKL--RVLARSSPEDK-KILVRALKEMGEVVAVTGDG 797

Query: 881 GNDVSMIQCADVG--VGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQ 938
            ND   ++ ADVG  +GI G E  + +         F  +   + W GR    S  K  Q
Sbjct: 798 TNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKW-GRCVAASIKKFIQ 856

Query: 939 F 939
           F
Sbjct: 857 F 857

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 144/600 (24%), Positives = 244/600 (40%), Gaps = 129/600 (21%)

Query: 456 TIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 515
           ++IP SL V L +  S  A K+   + +   I+R     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGA-KVMATRHV---IIRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 516 MQLKKI---HLGTVSY--TNETMDIVTDFIQXXXXXXXXXXXXXXXKNI----------- 559
           M  K++     GT++   +NE  +     IQ               +++           
Sbjct: 379 MIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMITDFKSKYY 438

Query: 560 SDRVIDLVTTL-------AICHNVTPTFEDGELTYQAA--SPDEIAIVKFTESVGLSLFR 610
           +D +  L  +L       A   N+   F D E     A   P EIAI  F  +  + L R
Sbjct: 439 ADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTEIAIQVF--ATRMDLPR 496

Query: 611 R--------DRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVI---IFDKLKQEYWFL 659
           R        D  +I     H+ +  E+  +  +PF+S  KRM  I   + +     Y   
Sbjct: 497 RVLTGEDNDDEKNI-----HNDITFEHVAE--YPFDSSVKRMSAIYKNVEEPKAPIYEVF 549

Query: 660 QKGA-DTVMSSIVVRNDW------------------LEEETSNMATEGLRTLVIGRKKLS 700
            KGA + V+      N W                  +++    +++EGLR L   +K   
Sbjct: 550 TKGAFERVLQCC---NSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKT-- 604

Query: 701 TNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELL 760
                     ++E+  T+   ++  +   R F+EN+L  LGL G+ D  +++  ++++  
Sbjct: 605 ----------FNESQFTINKDKLLKE---RDFVENNLTFLGLVGIYDPPRRESLAAVKKC 651

Query: 761 RNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSC 820
             AGI + MLTGD   TA+ ++    ++                  L+H     VN    
Sbjct: 652 HLAGINVHMLTGDFPGTAKSIAQEVGILPHN---------------LYHYPKEVVNFMVM 696

Query: 821 LLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCI-GD 879
              D ++L        D+  D +  LP V+A RC PQ K  +   + +    R C + GD
Sbjct: 697 TATDFDALS-------DKEIDELPVLPLVIA-RCAPQTKVRMIEALHRR--NRFCAMTGD 746

Query: 880 GGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKL-LLWHGRNSYKSSAKLSQ 938
           G ND   ++ A+VG+ +       A  A+D  ++     + L  +  GR   + S  + +
Sbjct: 747 GVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR---RMSDNIQK 803

Query: 939 FVIHRGLIISVCQAVY---SICSMFE------PLALYQGWLMVGYATCYTMAPVFSLTLD 989
           FV+   L  +V QA+Y    +C + E      PL+  +   ++   +C+   P   L L+
Sbjct: 804 FVLQL-LAENVAQALYLMVGLCFLDEEGFSVFPLSPVEVLWVIVVTSCF---PAMGLGLE 859

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 175/755 (23%), Positives = 292/755 (38%), Gaps = 159/755 (21%)

Query: 276 GDIIKLKKGARVPADVVV-----LQTNEP--NGESF-IKTDQ---LDGETDWKLRLACSL 324
           GDI++++ G  VPAD+ +     L+T+E    GE+  +  D     + +T    RL  + 
Sbjct: 153 GDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAF 212

Query: 325 TQSLTENDLLNNITITASAPEHSIHNFLGKITYK-DSTSSPLSVD--NTMWENTVLASSA 381
             S         I +        + + +GKI        S +S D   +  +NTVL   A
Sbjct: 213 ASSTVSKGRATGIVV-----RTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKA 267

Query: 382 ACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNN 441
           +      + G      L+   +K            L+ IL A   L +++++A   F  N
Sbjct: 268 SVGS---FLGTNVGTPLHRKLAK------------LALILFAIAVLFALIVMATQKFIVN 312

Query: 442 DWYVDIMRYLILFS-TIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRI 500
               ++  Y I  + ++IP SL V L +  S  A K+   + +   IVR     E LG +
Sbjct: 313 R---EVAIYAICVALSMIPSSLVVVLTITMSAGA-KVMSTRNV---IVRRLDSLEALGAV 365

Query: 501 EYLLSDKTGTLTQNDMQLKKI---HLGTVSYTN--------------------------- 530
             + SDKTGTLTQ  M LK++     GTV                               
Sbjct: 366 NDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDE 425

Query: 531 -ETMDIVTDFIQXXXXXXXXXXXXXXXKNISDRVIDLVTTLAICHNVTPTFEDGELTYQA 589
            E + I+ +F Q               K ++ R  +     A   N+   F+D +     
Sbjct: 426 EEDVGIIANFKQRWQSNSLP-------KGLNPRKFESWLHTATLANIATVFKDSDSKEWR 478

Query: 590 A--SPDEIAIVKFTESV-----GLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSK 642
           A   P EIAI  F   +      L+  + +  S S   + +    E+  +  FPF+S  K
Sbjct: 479 AHGDPTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAE--FPFDSSIK 536

Query: 643 RMGVI-----------IFDKLKQEY-------WFLQKGADTVMSSIVVRNDW--LEEETS 682
           RM  +           +F K   E        W L  G  T ++  +  +D   +++   
Sbjct: 537 RMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPG--TGVTHPLTEDDLEIIQKNVD 594

Query: 683 NMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGL 742
            ++ EGLR L    K +     E   +  ++                R F+E+DL   GL
Sbjct: 595 TLSNEGLRVLAFATKTIPAEEAESLGERLTKD---------------RDFVESDLIFQGL 639

Query: 743 TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNK 802
            G+ D  + +   +++    AGI + MLTGD   TA+ ++    ++    Y +    V+ 
Sbjct: 640 VGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVD- 698

Query: 803 PEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADV 862
                  +  +   Q   L               DE  D +  LP V+A RC PQ K  +
Sbjct: 699 -------IMVMTATQFDSLT--------------DEELDQLPVLPLVIA-RCAPQTKVRM 736

Query: 863 AVFIRQATGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKEGKQASLAADFSITQFCHLT 919
              + +   ++ C + GDG ND   ++ A+VG+  GI G +  + +     S   F  + 
Sbjct: 737 IDALHRR--EKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASIL 794

Query: 920 KLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVY 954
             +   GR   + S  + +FV+   L  +V QA+Y
Sbjct: 795 NAVE-EGR---RMSDNIQKFVLQL-LAANVAQAIY 824

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 159/764 (20%), Positives = 293/764 (38%), Gaps = 145/764 (18%)

Query: 272 DLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTEN 331
           DL VGD+I L+ G  VPAD V++     +G        L GE+D   ++A        + 
Sbjct: 256 DLLVGDVISLQTGDVVPADAVLI-----SGSCECDESALTGESDTIKKVALKPALEKYKQ 310

Query: 332 DLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTG 391
               + TI            +G     +    PL +  +     +L+     +   V   
Sbjct: 311 IFEKDPTID-----------IGSHGVGEKVPDPLLISGS----KLLSGIGNAVITSVGEN 355

Query: 392 RETRQALNTTKSKAKTGLLELEINGLSKILC--ACVFLLSIMLVAFAGF----NNNDWYV 445
               + +   K+++++  L+  ++ L+  +    C+  L + ++ F  F     N   Y 
Sbjct: 356 SVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLTYLPNGKKYH 415

Query: 446 DI------MRYLILFSTII-------PVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTST 492
           D+       +++ +F T +       P  L + + L  +    ++  D      +VR   
Sbjct: 416 DLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKD----GNLVRVLR 471

Query: 493 IPEDLGRIEYLLSDKTGTLTQNDMQL------------------KKIHLGTVSYTNETMD 534
             E +G    + SDKTGTLT+N M +                  K+I    V  +N    
Sbjct: 472 ACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRSNCDAS 531

Query: 535 IVTDFIQXXXXXXXXXXXXXXXKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAA---- 590
           ++TD +                    D+ +D         ++ P   +   +   A    
Sbjct: 532 LLTDILSNISLNSTAFENKESQHK--DKDVDENPYHKSRKSLFPWSRNNRTSQLIADAMK 589

Query: 591 --------SPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSK 642
                   S  E A++ F +    SL  +D H   L    S + ++  ++++ PF S  K
Sbjct: 590 ENDEQFLGSKTETALLAFAQK---SLGMKDVHK--LRTKPSDLGIDKVVQVI-PFESSRK 643

Query: 643 RMGVIIFDKLKQEYWFLQKGADTVM-----------SSIVVRNDWLEEET----SNMATE 687
              + +     + Y F  KGA  ++           +SIV  N  L +E+     +MA+ 
Sbjct: 644 WGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFKKIQDMASH 703

Query: 688 GLRTLVIGRKKLSTNLFEQFEKEYSEASLT-------MMDREVHMQNVVRKFLENDLELL 740
            LRT+ +  +       E   KE+++++         +M  E+  +N+  + +  D    
Sbjct: 704 ALRTISLVHRDFK----EWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLD---- 755

Query: 741 GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKV 800
            + G++D L++ VK S+E  + AG+ + M+TGD + TAR +S +  ++S   Y       
Sbjct: 756 AMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGY------- 808

Query: 801 NKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTV-VACRCTPQQK 859
           N PE A+    + ++     L +                      +P + V  R +P+ K
Sbjct: 809 NDPECAMEGPTFRKLPYKKMLRV----------------------IPKLRVLARSSPEDK 846

Query: 860 ADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSITQFCH 917
             + V   +  G+ V   GDG ND   ++ ADVG  +GI G E  + +         F  
Sbjct: 847 R-ILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFTA 905

Query: 918 LTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFE 961
           +   + W GR    S  K  QF +   +   +   V ++ S  E
Sbjct: 906 IVNAIKW-GRCVSVSIKKFIQFQLTVNITAVILTFVSAVASAEE 948

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 124/581 (21%), Positives = 228/581 (39%), Gaps = 101/581 (17%)

Query: 395  RQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNN---------DWYV 445
            R   +TTK      ++  + +G      +  ++  + ++AF GF+ +         D   
Sbjct: 653  RTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGLDKRT 712

Query: 446  DIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLS 505
             I+R L + + ++P +L   L +G S    +++          R +      G+I+ +  
Sbjct: 713  MILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKIDVMCF 768

Query: 506  DKTGTLTQNDMQLKKIHLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXKNISDRVID 565
            DKTGTLT++ + +  + +   +  N+     +D I                     +  +
Sbjct: 769  DKTGTLTEDGLDVLGVRVSCAATRNKAS--FSDLISDTHDIFPKFSLKDCSNPDDYKRRN 826

Query: 566  LVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHD-HSG 624
             + +L  CH++     DGEL      P +  + +FT       F+  +   SL+ + H G
Sbjct: 827  FLISLLTCHSLRVV--DGELL---GDPLDFKMFQFTGWSYEEDFQNHQFH-SLYEERHEG 880

Query: 625  MKLEYDIKIL-----------------------------FPFNSDSKRMGVIIFDKLKQE 655
                 +  I+                             F F S+ +RM VI+    +  
Sbjct: 881  QNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENV 940

Query: 656  YWFLQKGADTVMSSI----VVRNDWLEEETSNMATE-GLRTLVIGRKKLSTNLFEQFEKE 710
            YW   KGA  V+  I     + +D+  ++  N  T  G R +    K L  N +      
Sbjct: 941  YWAYTKGAPEVIIDICNPATLPSDY--DDILNFYTHSGYRVIACAGKTLPKNTW------ 992

Query: 711  YSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWML 770
                        ++ Q V R+ +E+++E LG    ++KL+     ++  L+ A I+  M 
Sbjct: 993  ------------LYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMC 1040

Query: 771  TGDKVETARCVSISAKLISRGQ-YVHTVT-------------KVNKPEGALHHLEYLQVN 816
            TGD V TA  V    +LI+  + YV TV              +++  E  L       ++
Sbjct: 1041 TGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPID 1100

Query: 817  QNS---CLLIDGESLGLYLQ---YFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQAT 870
              S    L I GE   +       + +E+ + ++ L   +  R +P +K ++   + Q  
Sbjct: 1101 DYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIFARMSPDEKHELVEQL-QKM 1158

Query: 871  GKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 911
               V   GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 1159 DYTVGFCGDGANDCGALKAADVGISLSEAE---ASVAAPFT 1196

>Kwal_47.17547
          Length = 1240

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 92/408 (22%), Positives = 170/408 (41%), Gaps = 61/408 (14%)

Query: 584 ELTYQAAS--PDEIAIVKFTESVGLSLFRRDRHSISLFH---DHSGMKLEYDIKILFPFN 638
           EL   AA+  P E  +   TE+  L+  +++    +L H   +   + +E  ++I+ PF 
Sbjct: 535 ELVENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEKIVQII-PFE 593

Query: 639 SDSKRMGVIIFDKLKQEYWFLQKGADTVMS------------SIVVRNDWLEEETS--NM 684
           S  K  G+++  K     ++++  A+ ++             +++ + D+ EE  +  N+
Sbjct: 594 SSRKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNL 653

Query: 685 ATEGLRTLVIGRKKLS-------TNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLE--N 735
           A E LR + +  +          + L ++ E E +   L   D      +V     E  +
Sbjct: 654 AAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVS 713

Query: 736 DLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH 795
            + L G+ G++D L+K V+ S+E  + AG+ + M+TGD + TA  ++    ++S  Q   
Sbjct: 714 PMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQ--- 770

Query: 796 TVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCT 855
                  PE ++    + +++                     E   I+ NL   V  R +
Sbjct: 771 ----AENPESSMEGPRFRKLSNK-------------------ERVRILPNLR--VLARSS 805

Query: 856 PQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSIT 913
           P+ K  + V   +  G  V   GDG ND   ++ ADVG  +GI G E  + +        
Sbjct: 806 PEDKR-ILVETLKKMGDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTD 864

Query: 914 QFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFE 961
            F  +   + W GR    S  K  QF +   +   V   V ++ S  E
Sbjct: 865 DFSAIVNAIKW-GRCVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSEE 911

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 60/273 (21%), Positives = 107/273 (39%), Gaps = 38/273 (13%)

Query: 272 DLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTEN 331
           D+ VGDI+ L+ G  VPAD ++++ +    ES      L GE+    + A  +     + 
Sbjct: 203 DILVGDILSLQTGDVVPADCILVKGSCECDES-----ALTGESATIKKAAIDVCYEKYKQ 257

Query: 332 DLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTG 391
               +  I    P              +    P+ +  +     +L+     +   V   
Sbjct: 258 LSATDAAIDIGTP------------GAEKVPDPMLISGS----KLLSGLGRAVVTSVGVN 301

Query: 392 RETRQALNTTKSKAKTGLLELEINGLSKIL-----CACVFLLSIMLVAF-AGFNNNDWYV 445
               + L   K +A+T  L+  ++ L+  +      A + L  I+ + F A         
Sbjct: 302 SMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELH 361

Query: 446 DI---------MRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIED-TIVRTSTIPE 495
           D+         M   I+  T+I V++   L L  ++ A      +  +D  +VR     E
Sbjct: 362 DLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTL-ALAFATTRMAKDGNLVRVLRACE 420

Query: 496 DLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY 528
            +G    + SDKTGTLT+N M + K  LG+  +
Sbjct: 421 TMGSATAVCSDKTGTLTENRMTVVKGFLGSTFF 453

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 127/511 (24%), Positives = 199/511 (38%), Gaps = 119/511 (23%)

Query: 456 TIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 515
           ++IP SL V L +  S  A K+   + +   IVR     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGA-KVMATRNV---IVRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 516 MQLKKI---HLGTVSYTN----------------------------ETMDIVTDFIQXXX 544
           M  K++     GT++                               E + I+ DF     
Sbjct: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDF----- 433

Query: 545 XXXXXXXXXXXXKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAA--SPDEIAIVKFTE 602
                        N+S  + D     A   N+   F+D E     A   P EIAI  F  
Sbjct: 434 -KSKYLAGELGPLNVS--LFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFAT 490

Query: 603 SVGLSLFRRDRHSISLFHDHSGMK-----LEYDIKILFPFNSDSKRMGVI---IFDKLKQ 654
            + L      RH ++   D    K       ++    FPF+S  KRM  I     D    
Sbjct: 491 RMDLP-----RHVLT-GEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATP 544

Query: 655 EYWFLQKGA-DTVMS-------------SIVVRNDW--LEEETSNMATEGLRTLVIGRKK 698
            Y    KGA + V+              S + + D   +++    +++EGLR L   +K 
Sbjct: 545 IYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKS 604

Query: 699 LSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIE 758
            +       E E++     ++          R F+E  L  LGL G+ D  +++  ++++
Sbjct: 605 FN-------ESEFNANKDKLLKE--------RDFVECKLTFLGLIGIYDPPRQESLAAVK 649

Query: 759 LLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQN 818
               AGI + MLTGD   TA+ ++    ++                  L+H     VN  
Sbjct: 650 KCHQAGINVHMLTGDFPGTAKSIAQEVGILPHN---------------LYHYPKEVVNFM 694

Query: 819 SCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCI- 877
                D ++L        D+  D +  LP V+A RC PQ K  +   + + +  + C + 
Sbjct: 695 VMAATDFDALS-------DQEIDDLRVLPLVIA-RCAPQTKVRMIEALHRRS--KFCAMT 744

Query: 878 GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 905
           GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 745 GDGVNDSPSLKIANVGIAMGINGSDVAKDAS 775

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 164/768 (21%), Positives = 289/768 (37%), Gaps = 138/768 (17%)

Query: 245 INRRKRDREANNELYEVVNKPCPIPS-KDLKVGDIIKLKKGARVPADVVVLQTNEPNGES 303
           +NR+K D     E+  V N    + S  DL VGD++ L+ G  VP D ++++      ES
Sbjct: 176 LNRKKED----TEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEGKCECDES 231

Query: 304 FIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSS 363
            I      GE+D   +++ +++  +         T+ A  P   I +        D+  S
Sbjct: 232 GIT-----GESDTIKKVSLAMSLQVYR-------TVAADNPSADIGS-------SDNGHS 272

Query: 364 PLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKIL-- 421
            +     +  + +L+     +   V       + +   KS+ +T  L+  +N L+  +  
Sbjct: 273 LVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISI 332

Query: 422 ---CACVFLLSIMLVAFAGF-NNNDWYVDI------MRYLILFSTII-------PVSLRV 464
               A   L  ++ + F  +      Y D+       R++ +F T +       P  L +
Sbjct: 333 YGSVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPL 392

Query: 465 NLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLG 524
            + L  +    ++  D  +    VR     E +G    + SDKTGTLTQN M + K  LG
Sbjct: 393 AVTLALAFATTRMTKDGNL----VRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLG 448

Query: 525 TVSYTNETMD--------IVTDFIQXXXXXXXXXXXXXXXKNISDRVIDLVTTLAICH-- 574
           +  + + + D        +  D  Q                  + +V D V T    H  
Sbjct: 449 SSHFDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFENKQVADPVITENPYHKP 508

Query: 575 --NVTPTFEDGELTYQAASPDEIAIVKF-----TESVGLSLFRRDR--HSISLFHD---H 622
             ++ P   + +  Y A     +   +F     TE+  LSL +      S+    D   H
Sbjct: 509 RRSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHH 568

Query: 623 SGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGA---------------DTVM 667
            G+     I  + PF S  K  G+++   +   Y F  KGA               D V+
Sbjct: 569 IGIA---SIVQMIPFESSRKWAGLVV-RLVDGNYRFFIKGASETIFKSCHYMRSSNDDVI 624

Query: 668 SSIVVRNDWLEEETSNMATEGLRTLVIGRKKLS-------TNLFEQFEKEYSEASLTMMD 720
                ++  +    +N+A++ LRT+ +  K  +         L +  +   +   L + D
Sbjct: 625 KLSPQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGD 684

Query: 721 REVHMQNVVRKFLEND---LELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 777
             V         + N+   L L G+ G+ D L+  VK S++  + +G+ + M+TGD + T
Sbjct: 685 EYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITT 744

Query: 778 ARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPD 837
            R ++ +  ++S  +Y      +  P                          ++ +    
Sbjct: 745 GRAIARACGILSESEYADHECAMEGP--------------------------VFRKLSRR 778

Query: 838 EFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVG--VG 895
           +  D    L   V  R +P+ K  + V I +   + V   GDG ND   +  ADVG  +G
Sbjct: 779 QMMDAAPKLK--VLARSSPEDKR-IFVDILKKMNEVVAVTGDGTNDAPALTLADVGFSMG 835

Query: 896 IVG----KEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQF 939
           I G    +E     L  D     F  +   + W GR    S  K  QF
Sbjct: 836 ISGTGVAREASDIILMTD----DFTSIVNAIKW-GRCVSLSIKKFIQF 878

>Kwal_14.1498
          Length = 939

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 158/778 (20%), Positives = 303/778 (38%), Gaps = 171/778 (21%)

Query: 170 RKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYI-VP 228
           R +Y  N IS+ +  P      + ++    F     +++ +  A+    +G +   + + 
Sbjct: 63  RAQYGKNEISSEEDEP------LWWKFVTTFVGDPLILLLIGSAVISFIMGNIDDAVSIT 116

Query: 229 LAFVLTVTM-------SKEAMDDINRRKRDR------EANNELYEVVNKPCPIPSKDLKV 275
           LA V+ VT+       S+++++ +NR   D+         ++L   V  P          
Sbjct: 117 LAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLIRCGQESKLLASVLVP---------- 166

Query: 276 GDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLN 335
           GD+++ + G R+PAD+ +++  + +    I+   L GE +   +   ++ +   + +L +
Sbjct: 167 GDVVRFRVGDRIPADLRIIEAVDLS----IEESNLTGENEPVHKSTATVNKEFYKENLGS 222

Query: 336 NITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETR 395
            + ++    E S   F+G +           V        V+ ++       V+   E  
Sbjct: 223 IVPVS----ERSCIAFMGTL-----------VREGHGRGIVIGTAKNTAFGKVF---EMM 264

Query: 396 QALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWY----VDIMRYL 451
            A+   K+  +T +     + L K L    F++  ++          W     + +   +
Sbjct: 265 NAIEKPKTPLQTAM-----DKLGKDLSFMSFIVIGIICLIGVIQGRSWLEMFQISVSLAV 319

Query: 452 ILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTL 511
                 +P+ + V L LG    A +          I+R     E LG +  + SDKTGTL
Sbjct: 320 AAIPEGLPIIVTVTLALGVLRMAKR--------RAIIRRLPSVETLGSVNVICSDKTGTL 371

Query: 512 TQNDMQLKKI-HLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXKNISDRVIDLVTTL 570
           T N M + K+  LG++S  +  + +                     KN+++ +   + T 
Sbjct: 372 TANHMSVNKVWCLGSMSNKSNILKL------------DKATSGSFKKNLTEDLRATLRTG 419

Query: 571 AICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYD 630
            +C+N T + E  +      +P +IA+++     GL     +R  ++   + S       
Sbjct: 420 NLCNNSTYSHEHAKYL---GNPTDIALLEVLHKFGL---EDERPQVTRSDEIS------- 466

Query: 631 IKILFPFNSDSKRMGVII--------------FDKLKQEYWFLQKGADTVMSSIVVRNDW 676
                 FNS  K M V +              ++K+ ++        + V+         
Sbjct: 467 ------FNSKRKFMAVKVKEANGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLRQA 520

Query: 677 LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLEND 736
           + +    +A++GLRTL   + +LS        K+ +E  +                  N 
Sbjct: 521 ITDSADALASDGLRTLAFAQLELSNG----NSKKLTEDDI------------------NG 558

Query: 737 LELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHT 796
           L   GL G+ D  +  VK+++E L    + I M+TGD   TA  VSI+ ++         
Sbjct: 559 LTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTA--VSIARQI--------G 608

Query: 797 VTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTP 856
           +  VN PE A+                     G  L +  ++    +++   + A R TP
Sbjct: 609 IPVVN-PETAVL-------------------TGDKLDHMSEDQLASIIDHVNIFA-RATP 647

Query: 857 QQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSIT 913
           + K ++ V   Q  G  V   GDG ND   ++ AD+GV + GK G   A  A+D  +T
Sbjct: 648 EHKLNI-VRALQKRGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLT 703

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 135/648 (20%), Positives = 246/648 (37%), Gaps = 128/648 (19%)

Query: 276 GDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLN 335
           GD++  + G R+PAD+ +++  + +    I    L GE +                    
Sbjct: 172 GDLVHFRIGDRIPADIRIIEAIDLS----IDESNLTGENE-------------------- 207

Query: 336 NITITASAPEHSIHNFLGKITYKDSTSS--PLSVDNTMWENTVLASSAACICCIVYTGRE 393
                   P H     + K ++ D  +S  P+S  + +     L         +V TG  
Sbjct: 208 --------PVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTN 259

Query: 394 TR-----QALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIM 448
           T      + +N  + K KT L +L ++ L K L    F++  M+          W     
Sbjct: 260 TSFGAVFEMMNNIE-KPKTPL-QLTMDKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQ 317

Query: 449 RYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKT 508
             + L    IP  L + + +  ++   ++   K     IVR     E LG +  + SDKT
Sbjct: 318 ISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK----AIVRRLPSVETLGSVNVICSDKT 373

Query: 509 GTLTQNDMQLKKIHLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXKNISDRVIDLVT 568
           GTLT N M + K+      +  ++M    + +                  +++ V + +T
Sbjct: 374 GTLTSNHMTVSKL------WCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRETLT 427

Query: 569 TLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLE 628
              +C+N + + E         +P ++A+++   +  +   R     +            
Sbjct: 428 IGNLCNNASFSQEHAIFL---GNPTDVALLEQLANFEMPDIRNTVQKVQ----------- 473

Query: 629 YDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEG 688
                  PFNS  K M   I + +  +     KGA             LE  TS + ++G
Sbjct: 474 -----ELPFNSKRKLMATKILNPVDNKCTVYVKGA---------FERILEYSTSYLKSKG 519

Query: 689 LRTLVIGRKKLST------NLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGL 742
            +T  +   + +T      ++  +  + +  A LT+ D    +   + K    DL   GL
Sbjct: 520 KKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIK----DLTFTGL 575

Query: 743 TGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNK 802
            G+ D  + +VK +IE L   G+ I M+TGD   TA               V+   ++  
Sbjct: 576 IGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA---------------VNIAKQIGI 620

Query: 803 PEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIV--VNLPTVVACRCTPQQKA 860
           P           V      ++ G+ L    +   D+  +++  VN    +  R TP+ K 
Sbjct: 621 P-----------VIDPKLSVLSGDKLD---EMSDDQLANVIDHVN----IFARATPEHKL 662

Query: 861 DVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGV--GIVGKE-GKQAS 905
           ++   +R+  G  V   GDG ND   ++ +D+GV  G +G +  K+AS
Sbjct: 663 NIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEAS 709

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 150/678 (22%), Positives = 257/678 (37%), Gaps = 170/678 (25%)

Query: 270 SKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLT 329
           + +L  GD+++ K G R+PAD                           LR+  S+   + 
Sbjct: 161 ASNLVPGDLVRFKVGDRIPAD---------------------------LRIVESIDLCVD 193

Query: 330 ENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTV-----LASSAACI 384
           E++L        +     +H   G +  K+ +  P S+      N +     L       
Sbjct: 194 ESNL--------TGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGK 245

Query: 385 CCIVYTGRETRQA----LNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNN 440
             ++ TG+ T       + +   K KT L +  ++ L + L    F+L  ++        
Sbjct: 246 GIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTAMDKLGQDLSYMSFVLIGIICLIGIIQG 304

Query: 441 NDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRI 500
             W       + L    IP  L + + +  ++   ++   K     IVR     E LG +
Sbjct: 305 RSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK----AIVRRLPSVETLGSV 360

Query: 501 EYLLSDKTGTLTQNDMQLKKI-HLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXKNI 559
             + SDKTGTLT N M + KI  LG++      + +                       +
Sbjct: 361 NVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLAL---------------------SKV 399

Query: 560 SDRVI----DLVTTLA---ICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRD 612
            +R I    D+ TTL    IC+N   T+    L Y   +P +IAI++  +  G++  R  
Sbjct: 400 KERPIKMEQDVATTLRIGNICNN--GTYSQEHLKY-LGNPTDIAILESLQHFGINDCRNS 456

Query: 613 RHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMS---S 669
            + I+                  PFNS  K M V   D   +   +++   + ++    +
Sbjct: 457 VNKIN----------------EIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSIN 500

Query: 670 IVVRNDWLEEETSN-----------MATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTM 718
            + R+  + +   N           +A+EGLRTL     ++S       +KE++E     
Sbjct: 501 YIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSAT---HGDKEFNED---- 553

Query: 719 MDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETA 778
                         +   L   GL  + D  +  V+S+IE L    + + M+TGD   TA
Sbjct: 554 --------------MVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTA 599

Query: 779 RCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDE 838
             VSI+ ++         +  +N PE +               ++ G+ L    Q   D+
Sbjct: 600 --VSIARQI--------GIPVIN-PEYS---------------VLSGDKLD---QMTDDQ 630

Query: 839 FFDIV--VNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGI 896
              ++  VN    V  R TP+ K ++ V   Q  G  V   GDG ND   ++ AD+GV +
Sbjct: 631 LASVIDHVN----VFARATPEHKLNI-VRALQKRGDIVAMTGDGVNDAPALKLADIGVSM 685

Query: 897 VGKEGKQ-ASLAADFSIT 913
            GK G   A  A+D  +T
Sbjct: 686 -GKMGTDVAKEASDMVLT 702

>Scas_707.48*
          Length = 741

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 152/670 (22%), Positives = 256/670 (38%), Gaps = 166/670 (24%)

Query: 276 GDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLN 335
           GD++  K G R+PAD                           LR+  ++  S+ E++L  
Sbjct: 172 GDLVHFKIGDRIPAD---------------------------LRIIEAVDLSIDESNLTG 204

Query: 336 NITITASAPEHSIHNFLGKITYKDSTSS--PLSVDNTMWENTVLASSAACICCIVYTGRE 393
                 + P H     + K ++ D  +S  P+S    +     L         +V  G+ 
Sbjct: 205 E-----NEPVHKSAKEVNKDSFNDQPNSIIPISDRTCVAYMGTLVKEGHGKGIVVGIGKN 259

Query: 394 TRQA----LNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMR 449
           T       + +   K KT L +  ++ L K L    F++ I L+   G      ++++ +
Sbjct: 260 TSFGAIFEMLSNIEKPKTPL-QNAMDKLGKDLSLFSFIV-IGLICLVGILQGRSWLEMFQ 317

Query: 450 YLILFSTI-----IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLL 504
             +  +       +P+ + V L LG    A +          IVR     E LG +  + 
Sbjct: 318 ISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVETLGSVNVIC 369

Query: 505 SDKTGTLTQNDMQLKKI-HLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXKN-ISDR 562
           SDKTGTLT N M   KI  L +++     + +                     KN +++ 
Sbjct: 370 SDKTGTLTSNHMTASKIWCLDSMANKANVLSL-------------EKSKSGSLKNYLTED 416

Query: 563 VIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDH 622
           V   +T   IC+N + + E G+      +P +IA+++      LS F           D 
Sbjct: 417 VKSTLTIGNICNNASFSQEHGKYL---GNPTDIALLE-----QLSKF-----------DL 457

Query: 623 SGMKLEYDIKILFPFNSDSKRMGVII--------------FDKLKQE--YWFLQKGADTV 666
           S ++  +      PFNS  K M V I              F+K+  +  ++  QKG    
Sbjct: 458 SDIRPTFKKVQEIPFNSKRKFMAVKIVNSEGKYSLCVKGAFEKVLSQCSHYLNQKGKTEK 517

Query: 667 MSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQ 726
           ++    + D + E  +++A+EGLR L              F K     S T++  E    
Sbjct: 518 LTQ--GQRDVIIETANSLASEGLRMLA-------------FAKTTLPDSPTLLTEESV-- 560

Query: 727 NVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 786
                    DL   GL G+ D  +  VK +IE L   G+ I M+TGD   TA        
Sbjct: 561 --------GDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTA-------- 604

Query: 787 LISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIV--V 844
                  V+   ++  P           V      ++ G+ L    +   D+  +++  V
Sbjct: 605 -------VNIARQIGIP-----------VLDPKLSVLSGDKLN---EMSDDQLANVIDHV 643

Query: 845 NLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ- 903
           N    +  R TP+ K ++   +R+  G  V   GDG ND   ++ AD+GV + G+ G   
Sbjct: 644 N----IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDV 697

Query: 904 ASLAADFSIT 913
           A  A+D  +T
Sbjct: 698 AKEASDMVLT 707

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 111/467 (23%), Positives = 180/467 (38%), Gaps = 129/467 (27%)

Query: 458 IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQ 517
           +P+ + V L LG       +   KQ  + IVR     E LG +  + +DKTGTLT N M 
Sbjct: 338 LPIIVTVTLALGV------LRMTKQ--NAIVRRLPSVETLGSVNVICTDKTGTLTTNHMT 389

Query: 518 LKKIHLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXKNISDRVIDLVTTLA-ICHNV 576
           + K+     S T E                          ++ D  +    T+A IC+N 
Sbjct: 390 VSKLFCLDSSGTYEN---------------AISPEEDSEFDVHDNDVKETLTIANICNNA 434

Query: 577 TPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFP 636
             + E         +P ++A+++     G+   +RD H           K+E        
Sbjct: 435 KYSEEH---NLYIGNPTDVALIEVLTKFGIP-DQRDSHE----------KMEE-----LS 475

Query: 637 FNSDSKRMGV---------IIFDK------LKQEYWFLQKGADTV----MSSIVVRNDWL 677
           FNS  K M +         +++ K      L +  ++L K  +       S ++V     
Sbjct: 476 FNSKRKYMAIKSSKESGEHVLYIKGAFERILDKSSYYLDKAGEVREFDEHSKVMVL---- 531

Query: 678 EEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDL 737
            E   + A++GLRT+    K   ++                        NV+ +   N L
Sbjct: 532 -EAAHSCASDGLRTIACAFKPTDSD------------------------NVISEDDINGL 566

Query: 738 ELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTV 797
              GL G+ D  + +VK+SIE L   G+ I M+TGD V TA  VSI+ K+          
Sbjct: 567 TFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTA--VSIAEKI---------- 614

Query: 798 TKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIV--VNLPTVVACRCT 855
                          L V      ++ G+ +    +   DE   ++  VN    +  R T
Sbjct: 615 --------------GLSVQDRESSVMTGDKVS---ELTEDELSKVIDKVN----IFARAT 653

Query: 856 PQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGV--GIVGKE 900
           P+ K ++   +R+  G  V   GDG ND   ++ AD+G+  GI G +
Sbjct: 654 PENKLNIVKALRK-RGDIVAMTGDGVNDAPALKLADIGIAMGISGTD 699

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 144/348 (41%), Gaps = 69/348 (19%)

Query: 636 PFNSDSKRMGVIIFDK----LKQEYWFLQKGADTVMSSIVV--RN--DWLEE-------- 679
           PF S  K  G+++  K     K  Y F  KGA  ++S      RN  D LEE        
Sbjct: 614 PFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINEDNKKE 673

Query: 680 ---ETSNMATEGLRTLVIGRK---KLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFL 733
              E  N+A++ LR + +  K   +  +   EQ  ++    ++  +D   + Q       
Sbjct: 674 TDDEIKNLASDALRAISVAHKDFCECDSWPPEQL-RDKDSPNIAALDLLFNSQK------ 726

Query: 734 ENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQY 793
              L L GL G++D L+  V+ S++  + AG+ + M+TGD +       ++AK I+R   
Sbjct: 727 --GLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNI-------LTAKAIARNCA 777

Query: 794 VHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTV-VAC 852
           + +    ++   A+   E+ ++ +N  + I                      LP + V  
Sbjct: 778 ILSTDISSEAYSAMEGTEFRKLTKNERIRI----------------------LPNLRVLA 815

Query: 853 RCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADF 910
           R +P+ K  + V   +  G  V   GDG ND   ++ ADVG  +GI G E  + +     
Sbjct: 816 RSSPEDKR-LLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIIL 874

Query: 911 SITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICS 958
               F  +   + W GR    S  K  QF     LI+++   + +  S
Sbjct: 875 MTDDFSAIVNAIKW-GRCVSVSIKKFIQF----QLIVNITAVILTFVS 917

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 123/292 (42%), Gaps = 54/292 (18%)

Query: 630 DIKIL--FPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIV-VRNDWLEEETSNMAT 686
           DI IL  F F+S  KR   I     KQ Y  ++   +T+   +  V  D+ ++   +   
Sbjct: 574 DISILRRFQFSSALKRSSTIAVHN-KQHYSAVKGAPETIRERLSQVPTDY-DQVYKSFTR 631

Query: 687 EGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVE 746
            G R L +  KKL +   +Q EK         ++RE          +E+DLE  G     
Sbjct: 632 AGSRVLALASKKLPSMSIKQIEK---------LEREA---------VESDLEFKGFLVFH 673

Query: 747 DKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKP-EG 805
             L+ D   +I++L  +  +  M+TGD   TA  V+    ++ R   +     +++P +G
Sbjct: 674 CPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLI-----LDEPIDG 728

Query: 806 ALHHLEYLQVNQNSC--------------------LLIDGESLGLYLQYFPDEFFDIVVN 845
           + H L +  + +                       + + G +L L   +   +  +++ +
Sbjct: 729 SSHALVFRNIEETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGH--SQLNELIRH 786

Query: 846 LPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIV 897
             T V  R +P QK  +   ++    + + C GDG NDV  ++ A VG+ ++
Sbjct: 787 --TWVYARVSPAQKEFIMNSLKDMGYQTLMC-GDGTNDVGALKQAHVGIALL 835

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 74/165 (44%), Gaps = 12/165 (7%)

Query: 361 TSSPLSVDNTMWENTVLASS---AACICCIVYTGRET---RQALNTTKSKAKTGLLELEI 414
           T   L+VD    + T  +S+         +  TG  T   R A    K+    G     +
Sbjct: 231 TGESLAVDKHYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVL 290

Query: 415 NGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVY 473
           NG+  IL   V + +++LV  A F   +  V I+RY +  + I +PV L   +    +V 
Sbjct: 291 NGIGIILLVLV-IATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVG 349

Query: 474 AYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQL 518
           A  +   +     IV+  +  E L  +E L SDKTGTLT+N + L
Sbjct: 350 AAYLAKKQ----AIVQKLSAIESLAGVEILCSDKTGTLTKNKLSL 390

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 94/249 (37%), Gaps = 55/249 (22%)

Query: 699 LSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIE 758
           +  ++ E +E + +E    +  R      V RK  E   E+LG+    D  + D   ++ 
Sbjct: 490 IPEDVHENYENKVAE----LASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVS 545

Query: 759 LLRNAGIKIWMLTGDKV----ETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQ 814
             R+ G+++ MLTGD V    ET R + +    I   + +      + P           
Sbjct: 546 EARHLGLRVKMLTGDAVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP----------- 593

Query: 815 VNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRV 874
                     G  L  +++   D F ++             PQ K  V V I Q  G  V
Sbjct: 594 ----------GSELADFVEN-ADGFAEVF------------PQHKYRV-VEILQNRGYLV 629

Query: 875 CCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSA 934
              GDG ND   ++ AD G+ + G     A  AAD           + L  G ++   + 
Sbjct: 630 AMTGDGVNDAPSLKKADTGIAVEGAT-DAARSAADI----------VFLAPGLSAIIDAL 678

Query: 935 KLSQFVIHR 943
           K S+ + HR
Sbjct: 679 KTSRQIFHR 687

>Scas_688.1
          Length = 913

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 94/243 (38%), Gaps = 49/243 (20%)

Query: 702 NLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLR 761
           ++ E +E + +E    +  R      V RK  E   E+LG+    D  + D   ++   R
Sbjct: 488 DIHENYENKVAE----LASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTGETVAEAR 543

Query: 762 NAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGA-LHHLEYLQVNQNSC 820
             G+++ MLTGD V  A+    + + +  G  V+   ++    G  +   E     +N+ 
Sbjct: 544 RLGLRVKMLTGDAVGIAKE---TCRQLGLGTNVYNAERLGLSGGGDMPGSELADFVENA- 599

Query: 821 LLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDG 880
              DG     + + FP + + +V                      I Q  G  V   GDG
Sbjct: 600 ---DG-----FAEVFPQDKYRVVE---------------------ILQTRGYLVAMTGDG 630

Query: 881 GNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFV 940
            ND   ++ AD G+ + G     A  AAD           + L  G ++   + K S+ +
Sbjct: 631 VNDAPSLKKADTGIAVEGAT-DAARSAADI----------VFLAPGLSAIIDALKTSRQI 679

Query: 941 IHR 943
            HR
Sbjct: 680 FHR 682

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 436 AGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIP 494
           A F   D  V I+RY +  + + +PV L   +    +V A  +   +     IV+  +  
Sbjct: 306 ASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQ----AIVQKLSAI 361

Query: 495 EDLGRIEYLLSDKTGTLTQNDMQL 518
           E L  +E L SDKTGTLT+N + L
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSL 385

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 93/246 (37%), Gaps = 55/246 (22%)

Query: 702 NLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLR 761
           ++ E +E + +E    +  R      V RK  E   E+LG+    D  + D   +I   R
Sbjct: 522 DVHENYENKVAE----LASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTINEAR 577

Query: 762 NAGIKIWMLTGDKV----ETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQ 817
           N G++I MLTGD V    ET R + +    I   + +      + P              
Sbjct: 578 NLGLRIKMLTGDAVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP-------------- 622

Query: 818 NSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCI 877
                  G  L  +++   D F ++             PQ K  V V I Q  G  V   
Sbjct: 623 -------GSELADFVEN-ADGFAEVF------------PQHKYRV-VEILQNRGYLVAMT 661

Query: 878 GDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLS 937
           GDG ND   ++ AD G+ + G      S AAD           + L  G ++   + K S
Sbjct: 662 GDGVNDAPSLKKADTGIAVEGATDAARS-AADI----------VFLAPGLSAIIDALKTS 710

Query: 938 QFVIHR 943
           + + HR
Sbjct: 711 RQIFHR 716

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 102/254 (40%), Gaps = 53/254 (20%)

Query: 268 IPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQS 327
           IP+ ++  G+I++L+ G   PAD  ++  +      F++ DQ                 +
Sbjct: 220 IPANEVVPGEILQLESGTIAPADGRIVTED-----CFLQIDQ----------------SA 258

Query: 328 LTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCI 387
           +T   L        +A +H         T K  T     V     +NT +  +AA +   
Sbjct: 259 ITGESL--------AAEKHYGDEVFSSSTVK--TGEAFMVVTATGDNTFVGRAAALV--- 305

Query: 388 VYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDI 447
                         ++    G     +NG+  IL   V + +++LV  A F      V I
Sbjct: 306 -------------GQASGVEGHFTEVLNGIGIILLVLV-IATLLLVWTACFYRTVGIVSI 351

Query: 448 MRYLILFSTI-IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSD 506
           +RY +  + I +PV L   +    +V A  +   +     IV+  +  E L  +E L SD
Sbjct: 352 LRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQ----AIVQKLSAIESLAGVEILCSD 407

Query: 507 KTGTLTQNDMQLKK 520
           KTGTLT+N + L +
Sbjct: 408 KTGTLTKNKLSLHE 421

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 89/243 (36%), Gaps = 51/243 (20%)

Query: 705 EQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAG 764
           E   + Y      +  R      V RK  E   E+LG+    D  + D   ++   R+ G
Sbjct: 473 EDVRENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLG 532

Query: 765 IKIWMLTGDKV----ETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSC 820
           +++ MLTGD V    ET R + +    I   + +      + P                 
Sbjct: 533 LRVKMLTGDAVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP----------------- 574

Query: 821 LLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDG 880
               G  L  +++   D F ++             PQ K +V V I Q  G  V   GDG
Sbjct: 575 ----GSELADFVEN-ADGFAEVF------------PQHKYNV-VEILQQRGYLVAMTGDG 616

Query: 881 GNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFV 940
            ND   ++ AD G+ + G     A  AAD           + L  G ++   + K S+ +
Sbjct: 617 VNDAPSLKKADTGIAVEGAT-DAARSAADI----------VFLAPGLSAIIDALKTSRQI 665

Query: 941 IHR 943
            HR
Sbjct: 666 FHR 668

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 11/100 (11%)

Query: 436 AGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIP 494
           A F   +  V I+RY +  + + +PV L   +    +V A  +   +     IV+  +  
Sbjct: 292 ASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQ----AIVQKLSAI 347

Query: 495 EDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMD 534
           E L  +E L SDKTGTLT+N + L +       YT E +D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVD 381

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 90/243 (37%), Gaps = 51/243 (20%)

Query: 705 EQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAG 764
           E  ++ Y      +  R      V RK  E   E+LG+    D  + D   ++   R+ G
Sbjct: 473 EDVKENYENKVAELASRGYRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLG 532

Query: 765 IKIWMLTGDKV----ETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSC 820
           +++ MLTGD V    ET R + +    I   + +      + P                 
Sbjct: 533 LRVKMLTGDAVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP----------------- 574

Query: 821 LLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDG 880
               G  L  +++   D F ++             PQ K +V V I Q  G  V   GDG
Sbjct: 575 ----GSELADFVEN-ADGFAEVF------------PQHKYNV-VEILQQRGYLVAMTGDG 616

Query: 881 GNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFV 940
            ND   ++ AD G+ + G      S AAD           + L  G ++   + K S+ +
Sbjct: 617 VNDAPSLKKADTGIAVEGATDAARS-AADI----------VFLAPGLSAIIDALKTSRQI 665

Query: 941 IHR 943
            HR
Sbjct: 666 FHR 668

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 102/252 (40%), Gaps = 53/252 (21%)

Query: 268 IPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQS 327
           IP+ ++  GDI++L+ G  +PAD  ++         F++ DQ           +    +S
Sbjct: 172 IPANEVVPGDILQLEDGVIIPADGRIVTEG-----CFVQIDQ-----------SAITGES 215

Query: 328 LTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCI 387
           L  +    + T ++S  +     F+      DST                          
Sbjct: 216 LAVDKRYGDATFSSSTVKRG-EGFMIVTATGDST-------------------------- 248

Query: 388 VYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDI 447
            + GR    A    K+ A +G     +NG+  IL   V L  +++     + + D  V I
Sbjct: 249 -FVGR---AAALVNKASAGSGHFTEVLNGIGTILLILVILTLLVVYVACFYRSID-IVTI 303

Query: 448 MRYLILFSTI-IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSD 506
           +RY +  + + +PV L   +    +V A  +   K     IV+  +  E L  +E L SD
Sbjct: 304 LRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKK----AIVQKLSAIESLAGVEILCSD 359

Query: 507 KTGTLTQNDMQL 518
           KTGTLT+N + L
Sbjct: 360 KTGTLTKNKLSL 371

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 81/211 (38%), Gaps = 73/211 (34%)

Query: 686 TEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGV 745
           T  + T+ IG KKL           + + SL+    ++    +   ++  D  L+G   +
Sbjct: 703 TSKIHTITIGNKKL-----------FPDESLS----DIASSTLTESYVSIDGSLVGKFEI 747

Query: 746 EDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEG 805
            D++++D    +E L+N GIK  M+TGD                                
Sbjct: 748 SDRVKEDAHFVVEYLQNLGIKCCMVTGDA------------------------------- 776

Query: 806 ALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVF 865
              H   L+V Q          LG+      D F ++            TP+QK D+ + 
Sbjct: 777 ---HQSALKVAQQ---------LGISAN---DVFSEV------------TPEQKRDIVIQ 809

Query: 866 IRQATGKRVCCIGDGGNDVSMIQCADVGVGI 896
           ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 810 LQNNGTERVAFVGDGINDSPALVEADLGISI 840

>Kwal_47.17522
          Length = 899

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 93/249 (37%), Gaps = 55/249 (22%)

Query: 699 LSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIE 758
           +  ++ E +E + +E    +  R      V RK  E   E+LG+    D  + D   ++ 
Sbjct: 471 IPEDVHENYENKVAE----LASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVH 526

Query: 759 LLRNAGIKIWMLTGDKV----ETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQ 814
             R  G+++ MLTGD V    ET R + +    I   + +      + P           
Sbjct: 527 EARRLGLRVKMLTGDAVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP----------- 574

Query: 815 VNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRV 874
                     G  L  +++   D F ++             PQ K  V V I Q  G  V
Sbjct: 575 ----------GSELADFVEN-ADGFAEVF------------PQHKYSV-VEILQQRGYLV 610

Query: 875 CCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSA 934
              GDG ND   ++ AD G+ + G     A  AAD           + L  G ++   + 
Sbjct: 611 AMTGDGVNDAPSLKKADTGIAVEGAT-DAARSAADI----------VFLAPGLSAIIDAL 659

Query: 935 KLSQFVIHR 943
           K S+ + HR
Sbjct: 660 KTSRQIFHR 668

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 436 AGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIP 494
           A F   D  V I+RY +  + I +PV L   +    +V A  +   +     IV+  +  
Sbjct: 292 ACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQ----AIVQKLSAI 347

Query: 495 EDLGRIEYLLSDKTGTLTQNDMQLKK 520
           E L  +E L SDKTGTLT+N + L +
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHE 373

>Scas_710.41
          Length = 904

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 92/242 (38%), Gaps = 47/242 (19%)

Query: 702 NLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLR 761
           ++ E +E + +E    +  R      V RK  E   E+LG+    D  + D   +I   R
Sbjct: 480 DVHENYENKVAE----LASRGFRSLGVARKRGEGYWEILGVMPCMDPPRDDTARTIAEAR 535

Query: 762 NAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCL 821
             G+++ MLTGD V  A+  S   + +  G  ++   K               +      
Sbjct: 536 TLGLRVKMLTGDAVGIAKETS---RQLGLGVNIYNAEK---------------LGLGGGG 577

Query: 822 LIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGG 881
            + G  L  +++   D F ++             PQ K  V V I Q  G  V   GDG 
Sbjct: 578 DMPGSELADFVEN-ADGFAEVF------------PQHKYKV-VEILQNRGYLVAMTGDGV 623

Query: 882 NDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVI 941
           ND   ++ AD G+ + G     A  AAD           + L  G ++     K S+ + 
Sbjct: 624 NDAPSLKKADTGIAVEGAT-DAARSAADI----------VFLAPGLSAIIDGLKTSRQIF 672

Query: 942 HR 943
           HR
Sbjct: 673 HR 674

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 436 AGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIP 494
           A F   D  V I+R+ +  + I +PV L   +    +V A  +   +     IV+  +  
Sbjct: 298 ACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQ----AIVQKLSAI 353

Query: 495 EDLGRIEYLLSDKTGTLTQNDMQL 518
           E L  +E L SDKTGTLT+N + L
Sbjct: 354 ESLAGVEILCSDKTGTLTKNKLSL 377

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 77/204 (37%), Gaps = 44/204 (21%)

Query: 699 LSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIE 758
           +  ++ E +E + +E    +  R      V RK  E   E+LG+    D  + D   ++ 
Sbjct: 474 IPEDVHENYENKVAE----LASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAETVN 529

Query: 759 LLRNAGIKIWMLTGDKV----ETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQ 814
             R  G+++ MLTGD V    ET R + +    I   + +      + P           
Sbjct: 530 EARRLGLRVKMLTGDAVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP----------- 577

Query: 815 VNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRV 874
                     G  L  +++   D F ++             PQ K  V V I Q  G  V
Sbjct: 578 ----------GSELADFVEN-ADGFAEVF------------PQHKYKV-VEILQNRGYLV 613

Query: 875 CCIGDGGNDVSMIQCADVGVGIVG 898
              GDG ND   ++ AD G+ + G
Sbjct: 614 AMTGDGVNDAPSLKKADTGIAVEG 637

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 436 AGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIP 494
           A F   D  V I+R+ +  + I +PV L   +    +V A  +   +     IV+  +  
Sbjct: 295 ACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQ----AIVQKLSAI 350

Query: 495 EDLGRIEYLLSDKTGTLTQNDMQLKK 520
           E L  +E L SDKTGTLT+N + L +
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHE 376

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 94/428 (21%), Positives = 162/428 (37%), Gaps = 101/428 (23%)

Query: 498 GRIEYLLSDKTGTLTQNDM---QLKKIHLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXX 554
           GRI+    DKTGTLT  D+    L  +H G+        DI T                 
Sbjct: 478 GRIDVCCFDKTGTLTAEDLVFEGLAGLHDGS--------DIRT----------------- 512

Query: 555 XXKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRH 614
             K+ +D   ++++ +   H +    +DGE+      P E A +K       S +  D  
Sbjct: 513 -LKSANDASQEVLSAIGAAHALV-KLDDGEIV---GDPMEKATLK------ASSWTVD-- 559

Query: 615 SISLFHDHSGMKLEYDIKIL--FPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIV- 671
               F D        +I+IL  F F+S  KR   I        ++   KGA   +   + 
Sbjct: 560 ----FKDVVKRAGADNIRILRRFQFSSSLKRSASIA--SQSNRFFAAVKGAPETIRERLN 613

Query: 672 -VRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVR 730
            V +D+ ++   +    G R L +  K L      Q +                  N+ R
Sbjct: 614 SVPSDY-DDIYKSFTRSGSRVLALAYKDLPKMSNSQID------------------NIDR 654

Query: 731 KFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 790
             +E  L           L+ D   +I++L  +  +  M+TGD   TA  V+    ++ R
Sbjct: 655 DEIETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDR 714

Query: 791 GQYVHTVTKVNKP-EGALHHLEYLQVN--------------------QNSCLLIDGESLG 829
              +     +++P +G+ H L    VN                    Q   L + G +L 
Sbjct: 715 ETLI-----LDEPIDGSSHALVMRDVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALK 769

Query: 830 LYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQC 889
           L   +   +  D++ +  T +  R +P QK  + + ++    + + C GDG NDV  ++ 
Sbjct: 770 LLQGH--KQLRDVIRH--TWIYARVSPSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQ 824

Query: 890 ADVGVGIV 897
           A VG+ ++
Sbjct: 825 AHVGIALL 832

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 88/424 (20%), Positives = 152/424 (35%), Gaps = 92/424 (21%)

Query: 498 GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXK 557
           GRI+    DKTGTLT  D+  +    G    +++  DI                      
Sbjct: 477 GRIDVCCFDKTGTLTGEDLVFE----GLAGLSSDPKDI------------RHLYSATDCP 520

Query: 558 NISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSIS 617
           N +  V+     L          EDGE+         +  +K+T   G  +F      ++
Sbjct: 521 NSTSLVVGAAHALV-------RLEDGEIVGDPMEKATLKALKWTVEKGDKVFNEKNGQVT 573

Query: 618 LFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWL 677
           +                F F+S  KR   +     K  Y  ++   +T+   +       
Sbjct: 574 ILRR-------------FQFSSALKRSSSVATHDGKL-YSAVKGAPETIRERLFTIPANY 619

Query: 678 EEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDL 737
           +E   +    G R L +  KKL         ++ S++ +   DRE           E DL
Sbjct: 620 DEIYKSFTRSGSRVLALASKKL---------EKMSQSQIEDADRE---------HFERDL 661

Query: 738 ELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQ--YVH 795
           E  G       L+ D   +I++L  +  +  M+TGD   TA  V+    ++ +G+   V 
Sbjct: 662 EFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIV-KGETLIVD 720

Query: 796 TVTKVNKPEGALHHLE-----YLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVV 850
            V   N  +    ++E        V+++S      E  G++ +Y      D+ V    + 
Sbjct: 721 MVDNGNDDKLVFRNVEETLSFEFVVSKDSF-----EKYGIFDKY------DLAVTGHALE 769

Query: 851 A-----------------CRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVG 893
           A                  R +P QK  +   ++    + + C GDG NDV  ++ A VG
Sbjct: 770 ALKGHHQLQDLIRHAWIYARVSPAQKEFILNNLKDMGYQTLMC-GDGTNDVGALKQAHVG 828

Query: 894 VGIV 897
           V ++
Sbjct: 829 VALL 832

>Scas_569.0d
          Length = 468

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 75/158 (47%), Gaps = 27/158 (17%)

Query: 846 LPTVVACRCTPQQKADVAVFIRQATGKR--VCCI-GDGGNDVSMIQCADVGV--GIVGKE 900
           LP V+A RC+PQ K    V + +A  +R   C + GDG ND   ++ A+VG+  GI G +
Sbjct: 101 LPLVIA-RCSPQTK----VRMIEALHRRDKFCAMTGDGVNDSPSLKMANVGIAMGINGSD 155

Query: 901 GKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSM- 959
             + +     S   F  +   +   GR   + S  + +FV+   L  +V QA+Y IC + 
Sbjct: 156 VAKDASDIVLSDDNFASILNAIE-EGR---RMSDNIQKFVLQL-LAENVAQALYLICGLA 210

Query: 960 FE--------PLALYQGWLMVGYATCYTMAPVFSLTLD 989
           F+        PLA  +   ++   +C+   P   L L+
Sbjct: 211 FQDKEGKSVFPLAPVEVLWIIVVTSCF---PAMGLGLE 245

>Scas_297.1
          Length = 800

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 73/189 (38%), Gaps = 32/189 (16%)

Query: 772 GDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLY 831
           GD + TAR ++ +  ++S   Y+        PE A+   ++  + +              
Sbjct: 1   GDNILTARAIARNCNILSEETYLI-------PECAIEGPKFRTLTKQ------------- 40

Query: 832 LQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCAD 891
                 E   ++ NL   V  R +P+ K  + V   +  G  V   GDG ND   ++ AD
Sbjct: 41  ------ERIKMLPNL--RVMARSSPEDKR-LLVETLKGMGDVVAVTGDGTNDAPALKLAD 91

Query: 892 VG--VGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISV 949
           VG  +GI G E  + +         F  +   + W GR    S  K  QF +   +   +
Sbjct: 92  VGFSMGISGTEVAREASDIILMTDDFAAIVDAIKW-GRCVSISIKKFIQFQLIVNITAVI 150

Query: 950 CQAVYSICS 958
              V SI S
Sbjct: 151 LAFVSSIAS 159

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 730 RKFLEND-LELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVS 782
           R +  ND    + +   +D+++ + K  I+ LR +GI+ WM++GD   TAR V+
Sbjct: 911 RSYFGNDNFYPVMMCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVA 964

>Kwal_55.21575
          Length = 989

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 268 IPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQL 310
           IP + L+VGD +++K GA++P D V+++      ES I  + L
Sbjct: 422 IPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464

>Scas_583.14*
          Length = 875

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 93/427 (21%), Positives = 170/427 (39%), Gaps = 77/427 (18%)

Query: 498 GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIVTDFIQXXXXXXXXXXXXXXXK 557
           GRI+    DKTGTLT  D+  +    G    ++++ D+   F                  
Sbjct: 133 GRIDVCCFDKTGTLTGEDLVFE----GLAGLSDKSEDVRHLF------------------ 170

Query: 558 NISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSIS 617
           +  D   + +  +   H +    +DGE+      P E A +K   ++G  +   D  S  
Sbjct: 171 SSEDASQETILVVGAAHALV-KLDDGEIV---GDPMEKATLK---ALGWKVEGNDFTS-- 221

Query: 618 LFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWL 677
                +G KL+  I   F F+S  KR   +   K K  +  ++   +T+   + V     
Sbjct: 222 --RPKTG-KLQ--ILRRFQFSSALKRSSSVASHKDKL-FTAVKGAPETIRERLAVVPKNY 275

Query: 678 EEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDL 737
           +E   +    G R L +  K L  NL        S   L  +DR+          +E  L
Sbjct: 276 DEIYKSFTRSGSRVLALASKSLP-NL--------SSKQLDDLDRDE---------IETGL 317

Query: 738 ELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK----VETARCVSI---------S 784
              G       L+ D   +I++L  +  +  M+TGD     V  A+ V+I          
Sbjct: 318 TFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDK 377

Query: 785 AKLISRGQ--YVHTVTKVNKP-EGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFD 841
           ++ +  G+  + +    +  P + A    ++ ++     + + G +L L   +   +  D
Sbjct: 378 SETVGDGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDH--SQLKD 435

Query: 842 IVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIV-GKE 900
           ++ +  T V  R +P QK  +   +++   + + C GDG NDV  ++ A VGV ++ G E
Sbjct: 436 LIRH--TWVYARVSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVALLNGTE 492

Query: 901 GKQASLA 907
               ++A
Sbjct: 493 ESMTAMA 499

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 856  PQQKADVAVFIRQATGKRVCC--IGDGGNDVSMIQCADVGVGI 896
            P+ KA+   +IR+ +G+ V    +GDG ND   I  ADVG+ +
Sbjct: 1067 PEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISL 1109

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 744  GVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKP 803
             V D+L+ + K  ++ L   GI+ WM++GD    A  V++   +       H +  V  P
Sbjct: 1015 AVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI------KHVIADV-LP 1067

Query: 804  EGALHHLEYLQ 814
            EG    +++++
Sbjct: 1068 EGKAEKIQWIR 1078

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 69/191 (36%), Gaps = 61/191 (31%)

Query: 729  VRKFLENDLELLGLT---------GVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETAR 779
            VRK LE    +   +          +ED L+ D  S+I LLR  GI + +L+GD     R
Sbjct: 997  VRKALEQGYSVFCFSVNGSVTAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVR 1056

Query: 780  CVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEF 839
              S++A+L                                      ES  +     P E 
Sbjct: 1057 --SMAARL------------------------------------GIESSNIRSHATPAEK 1078

Query: 840  FDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGK 899
             + + ++     C  + Q K  V VF            GDG ND   +  A +GV I   
Sbjct: 1079 SEYIKDIVEGRNCDSSSQSKRPVVVF-----------CGDGTNDAIGLTQATIGVHI--N 1125

Query: 900  EGKQ-ASLAAD 909
            EG + A LAAD
Sbjct: 1126 EGSEVAKLAAD 1136

>Scas_227.0d
          Length = 307

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 12/80 (15%)

Query: 630 DIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMS-----------SIVVRN-DWL 677
           +I  + PF S  K  G+I+  K    Y F  KGA  ++S           SIV  N D +
Sbjct: 184 EIAQIIPFESTRKWGGIIVKYKESNLYRFFIKGAAEIVSNNCHSKRNSDDSIVTLNKDQI 243

Query: 678 EEETSNMATEGLRTLVIGRK 697
            +E  N+A + LR L +  +
Sbjct: 244 NKEIENLANDALRALSLAHR 263

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 263 NKPCPIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGET 314
           N+   IP + L+V DI+++K G ++PAD ++ +     GES I    + GE+
Sbjct: 421 NETKEIPIELLQVNDIVEIKPGMKIPADGIITR-----GESEIDESLMTGES 467

>ADL254W [1487] [Homologous to ScYNL061W (NOP2) - SH]
           complement(253604..255415) [1812 bp, 603 aa]
          Length = 603

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 16/96 (16%)

Query: 880 GGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQF 939
           GG D  ++     G G++GK+        +    Q  HL K L+    +S  S++K    
Sbjct: 400 GGFDRILLDAPCSGTGVIGKDQSVKVNRTEKDFMQIPHLQKQLILSAIDSVDSNSK---- 455

Query: 940 VIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYA 975
             H G+I      VYS CS    +A+ +   +V YA
Sbjct: 456 --HGGVI------VYSTCS----VAVEENEAVVDYA 479

>Scas_615.9
          Length = 942

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 5/42 (11%)

Query: 273 LKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGET 314
           L+  DII++K G ++PAD +++Q     GES I    + GE+
Sbjct: 379 LQRNDIIEIKPGMKIPADGIIIQ-----GESEIDESLMTGES 415

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 732 FLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRG 791
           +L  D ++ G   + D+++ D K  I  LRN   +++M+TGD  ++A  V+    +    
Sbjct: 748 YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNN 807

Query: 792 QYVHTVTKVNKPEGALHHLEYLQ 814
            Y         P+G    +EYL+
Sbjct: 808 VYSEVT-----PDGKSQTVEYLR 825

>KLLA0D02772g complement(234761..236146) similar to sp|P07236
           Saccharomyces cerevisiae YKL194c MST1 threonine--tRNA
           ligase, mitochondrial, start by similarity
          Length = 461

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 48/94 (51%), Gaps = 13/94 (13%)

Query: 703 LFEQFEKEYSEASLTMMDREVHMQN----------VVRKFLENDLELLGLTGVEDKLQKD 752
           +F++F++ Y+E  L   D     +N           VRKF ++D  +       D+++++
Sbjct: 142 VFKRFDRSYNELPLRFSDFSPLHRNEASGALSGLTRVRKFHQDDGHIFC---TPDQVRQE 198

Query: 753 VKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 786
           ++  +EL+     K++ ++GD  + A  +++S +
Sbjct: 199 IQKCLELVDMCYTKVFPISGDSKQAAYSLTLSTR 232

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,247,560
Number of extensions: 1534268
Number of successful extensions: 5256
Number of sequences better than 10.0: 91
Number of HSP's gapped: 5176
Number of HSP's successfully gapped: 178
Length of query: 1131
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 1019
Effective length of database: 12,718,893
Effective search space: 12960551967
Effective search space used: 12960551967
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)