Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C08371g1251055425e-73
YIL052C (RPL34B)1211054801e-63
YER056C-A (RPL34A)1211054792e-63
CAGL0M12408g1281054645e-61
Scas_715.54*1251054514e-59
ADL078C1261054514e-59
Scas_704.33*1241054515e-59
Kwal_23.579969492043e-22
Scas_20.1*5948982e-06
CAGL0I07205g60334700.14
Sklu_2333.931249612.0
YER123W (YCK3)52474576.3
YER105C (NUP157)1391101576.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C08371g
         (123 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C08371g join(732878..732914,733482..733822) highly similar ...   213   5e-73
YIL052C (RPL34B) [2615] chr9 complement(256224..256552,257025..2...   189   1e-63
YER056C-A (RPL34A) [1486] chr5 complement(269421..269749,270147....   189   2e-63
CAGL0M12408g join(1236607..1236643,1237307..1237656) highly simi...   183   5e-61
Scas_715.54*                                                          178   4e-59
ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH; ScYER056C...   178   4e-59
Scas_704.33*                                                          178   5e-59
Kwal_23.5799                                                           83   3e-22
Scas_20.1*                                                             42   2e-06
CAGL0I07205g 694434..696245 similar to tr|Q12242 Saccharomyces c...    32   0.14 
Sklu_2333.9 , Contig c2333 11161-12099 reverse complement              28   2.0  
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...    27   6.3  
YER105C (NUP157) [1537] chr5 complement(367834..372009) Nuclear ...    27   6.9  

>KLLA0C08371g join(732878..732914,733482..733822) highly similar to
           sp|P40525 Saccharomyces cerevisiae YIL052c RPL34B
           ribosomal protein or sp|P87262 Saccharomyces cerevisiae
           YER056ca ribosomal protein, start by similarity
          Length = 125

 Score =  213 bits (542), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60
           MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR
Sbjct: 1   MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60

Query: 61  QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105
           QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI
Sbjct: 61  QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105

>YIL052C (RPL34B) [2615] chr9
           complement(256224..256552,257025..257061) Ribosomal
           protein L34 (rat L34), nearly identical to Rpl34Ap [366
           bp, 121 aa]
          Length = 121

 Score =  189 bits (480), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 91/105 (86%), Positives = 98/105 (93%)

Query: 1   MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60
           MAQRVTFRRRNPYNT+SNKIKVVKTPGG LR+QHVKKLATRPKCGD G  LQG+STLRPR
Sbjct: 1   MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60

Query: 61  QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105
           QYATVS+T KTVSRAYGGS+ AN VKERIVRAFLIEEQKIVK+V+
Sbjct: 61  QYATVSKTHKTVSRAYGGSRCANCVKERIVRAFLIEEQKIVKKVV 105

>YER056C-A (RPL34A) [1486] chr5
           complement(269421..269749,270147..270183) Ribosomal
           protein L34 (rat L34), nearly identical to Rpl34Bp [366
           bp, 121 aa]
          Length = 121

 Score =  189 bits (479), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 90/105 (85%), Positives = 98/105 (93%)

Query: 1   MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60
           MAQRVTFRRRNPYNT+SNKIKVVKTPGG LR+QHVKKLATRPKCGD G  LQG+STLRPR
Sbjct: 1   MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPR 60

Query: 61  QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105
           QYATVS+T KTVSRAYGGS+ AN VKERI+RAFLIEEQKIVK+V+
Sbjct: 61  QYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIVKKVV 105

>CAGL0M12408g join(1236607..1236643,1237307..1237656) highly similar
           to sp|P40525 Saccharomyces cerevisiae YIL052c RPL34B or
           sp|P87262 Saccharomyces cerevisiae YER056BC RPL34A
          Length = 128

 Score =  183 bits (464), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 86/105 (81%), Positives = 97/105 (92%)

Query: 1   MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60
           MAQRVTFRRRNPYNT+SNKIKVVKTPGG LR+QHVKKLATRPKCGD G+ L G++TLRPR
Sbjct: 1   MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGIALPGIATLRPR 60

Query: 61  QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105
           QYA++S+T KTVSR YGGS+ AN VKERIVRAFLIEEQKIVK+V+
Sbjct: 61  QYASISKTHKTVSRVYGGSRCANCVKERIVRAFLIEEQKIVKKVV 105

>Scas_715.54*
          Length = 125

 Score =  178 bits (451), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%)

Query: 1   MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60
           MAQRVTFRRRNP NTKSNKIKVVKTPGG LR+QHVKK A+RPKCGD G+PL GV+ LRPR
Sbjct: 1   MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60

Query: 61  QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105
           QYA++S+T KTVSR YGGS+ +N VKERIVRAFLIEEQKIVK+V+
Sbjct: 61  QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFLIEEQKIVKKVV 105

>ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH; ScYER056C-A
           (RPL34A) - SH] (548697..549040,549209..549245) [381 bp,
           126 aa]
          Length = 126

 Score =  178 bits (451), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%)

Query: 1   MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60
           MAQRVTFRRRNP+NTK+NKIKVVKTPGG LR+QHVKKLATR KCGD G+ L G+S+LRPR
Sbjct: 1   MAQRVTFRRRNPFNTKTNKIKVVKTPGGVLRAQHVKKLATRHKCGDCGIALDGISSLRPR 60

Query: 61  QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105
           QYA+VS+T KTVSR YGGS+ AN VK+RIVRAFLIEEQKIVK+V+
Sbjct: 61  QYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFLIEEQKIVKKVV 105

>Scas_704.33*
          Length = 124

 Score =  178 bits (451), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%)

Query: 1   MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPR 60
           MAQRVTFRRRNP NTKSNKIKVVKTPGG LR+QHVKK A+RPKCGD G+PL GV+ LRPR
Sbjct: 1   MAQRVTFRRRNPCNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPR 60

Query: 61  QYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105
           QYA++S+T KTVSR YGGS+ +N VKERIVRAFLIEEQKIVK+V+
Sbjct: 61  QYASISKTSKTVSRVYGGSRCSNCVKERIVRAFLIEEQKIVKKVV 105

>Kwal_23.5799
          Length = 69

 Score = 83.2 bits (204), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 40/49 (81%), Positives = 45/49 (91%)

Query: 57  LRPRQYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105
           +RPR+YATVS+T KTVSRAYGG   ANAVKERIVRAFLIEEQKIVK+V+
Sbjct: 1   MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFLIEEQKIVKKVV 49

>Scas_20.1*
          Length = 59

 Score = 42.4 bits (98), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 27/48 (56%)

Query: 47 TGVPLQGVSTLRPRQYATVSRTKKTVSRAYGGSKSANAVKERIVRAFL 94
          T V L  VS L         R  +   RAYGGS+ AN VKERIVRAFL
Sbjct: 12 TVVFLCKVSLLDQENTLLSPRPTRPSPRAYGGSRCANCVKERIVRAFL 59

>CAGL0I07205g 694434..696245 similar to tr|Q12242 Saccharomyces
           cerevisiae YOR138c, hypothetical start
          Length = 603

 Score = 31.6 bits (70), Expect = 0.14,   Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 18/34 (52%)

Query: 9   RRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRP 42
           R NP+NT  +KI V K  G     QHVK   T P
Sbjct: 514 RFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVP 547

>Sklu_2333.9 , Contig c2333 11161-12099 reverse complement
          Length = 312

 Score = 28.1 bits (61), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 1/49 (2%)

Query: 30  LRSQHVKKLATRPKCGDTGVPLQGVSTL-RPRQYATVSRTKKTVSRAYG 77
           L  + +KKL     C DTG+P + +S +    +Y        TV  ++ 
Sbjct: 237 LMDKEIKKLGYSEACNDTGLPKETLSEIGHIAEYENYGNDNSTVGESFA 285

>YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I
           isoform, plasma membrane-bound [1575 bp, 524 aa]
          Length = 524

 Score = 26.6 bits (57), Expect = 6.3,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 10  RNPYNTKSNKIKVVKTPGGALRSQHV-KKLATRPK-CGDTGVPLQGVSTLRPRQYATVSR 67
           +N YN  ++K ++   P    + QHV KK+    K   +T   LQ     + + Y ++S 
Sbjct: 390 QNSYNKDNSKSRISSNPQSFTKQQHVLKKIEPNSKYIPETHSNLQRPIKSQSQTYDSISH 449

Query: 68  TKKTVSRAYGGSKS 81
           T+ +    Y  SK+
Sbjct: 450 TQNSPFVPYSSSKA 463

>YER105C (NUP157) [1537] chr5 complement(367834..372009) Nuclear
           pore protein (nucleoporin); has similarity to Nup170p
           and mammalian Nup155p [4176 bp, 1391 aa]
          Length = 1391

 Score = 26.6 bits (57), Expect = 6.9,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 21/101 (20%)

Query: 11  NPYNTKSNKIKVVKT------PGGALRSQHVKKLATRPKCGDTGVPLQGVSTLRPRQYAT 64
           N +N+KSNKI + K+      P   + S    KL  +   GD G   + +S L   Q   
Sbjct: 293 NLFNSKSNKICLTKSNLANLLPTKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRG 352

Query: 65  VSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVKRVI 105
           V  T  T S               IVR++LI    +V  V+
Sbjct: 353 VLHTLSTKS---------------IVRSYLITSNGLVGPVL 378

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.129    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,951,394
Number of extensions: 96569
Number of successful extensions: 253
Number of sequences better than 10.0: 17
Number of HSP's gapped: 253
Number of HSP's successfully gapped: 17
Length of query: 123
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 34
Effective length of database: 13,515,107
Effective search space: 459513638
Effective search space used: 459513638
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)