Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C08349g1401387104e-98
Sklu_2193.31281265853e-79
Kwal_23.58041411395821e-78
Scas_704.341481295404e-72
Scas_715.531281265316e-71
ADL077C1421405213e-69
YIL051C (MMF1)1451285196e-69
CAGL0M12386g1421404944e-65
YER057C (HMF1)1291244449e-58
Kwal_47.16590126991503e-13
Kwal_23.28071291071485e-13
Kwal_55.212471341031364e-11
Scas_506.36891201354e-10
KLLA0B14817g1311011163e-08
CAGL0M04521g6881051125e-07
KLLA0E03894g1371001032e-06
AGL164W686971054e-06
KLLA0D16984g6961391002e-05
YLR143W685105983e-05
Kwal_27.1131068887840.002
Scas_715.33101860730.071
Kwal_47.1797249851603.8
Scas_474.747670603.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C08349g
         (138 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...   278   4e-98
Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement        229   3e-79
Kwal_23.5804                                                          228   1e-78
Scas_704.34                                                           212   4e-72
Scas_715.53                                                           209   6e-71
ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...   205   3e-69
YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...   204   6e-69
CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...   194   4e-65
YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...   175   9e-58
Kwal_47.16590                                                          62   3e-13
Kwal_23.2807                                                           62   5e-13
Kwal_55.21247                                                          57   4e-11
Scas_506.3                                                             57   4e-10
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    49   3e-08
CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...    48   5e-07
KLLA0E03894g complement(364475..364888) some similarities with s...    44   2e-06
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....    45   4e-06
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...    43   2e-05
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...    42   3e-05
Kwal_27.11310                                                          37   0.002
Scas_715.33                                                            33   0.071
Kwal_47.17972                                                          28   3.8  
Scas_474.7                                                             28   3.8  

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score =  278 bits (710), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 138/138 (100%), Positives = 138/138 (100%)

Query: 1   MFRQALKSTVRRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSI 60
           MFRQALKSTVRRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSI
Sbjct: 1   MFRQALKSTVRRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSI 60

Query: 61  ADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVA 120
           ADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVA
Sbjct: 61  ADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVA 120

Query: 121 AKALPLNVDLEMEVIAVE 138
           AKALPLNVDLEMEVIAVE
Sbjct: 121 AKALPLNVDLEMEVIAVE 138

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score =  229 bits (585), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 119/126 (94%)

Query: 13  MNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVK 72
           M+TLTPV+TQLAPPPAASYSQAIKVNN++FVSGQIPYT ENKPVEGSIADKAEQVIQNVK
Sbjct: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60

Query: 73  NILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEM 132
           NIL EANS L+KIVKVN+FLADIN FAEFN VYAKYFN HKPARSCVA K+LPLNVDLEM
Sbjct: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120

Query: 133 EVIAVE 138
           EVIAVE
Sbjct: 121 EVIAVE 126

>Kwal_23.5804
          Length = 141

 Score =  228 bits (582), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 111/139 (79%), Positives = 124/139 (89%), Gaps = 1/139 (0%)

Query: 1   MF-RQALKSTVRRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGS 59
           MF R A ++T R M+TLTPV+TQL+PPPAASYSQA++VN ++FVSGQIPYTAENK VEG+
Sbjct: 1   MFLRNAARNTFRSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGT 60

Query: 60  IADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCV 119
           IADKAEQVIQNV+NIL EANS LDKIVKVNIFLADI  FAEFN VY KYFN HKPARSCV
Sbjct: 61  IADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCV 120

Query: 120 AAKALPLNVDLEMEVIAVE 138
           A KALPL+VDLEMEV+AVE
Sbjct: 121 AVKALPLDVDLEMEVVAVE 139

>Scas_704.34
          Length = 148

 Score =  212 bits (540), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%)

Query: 10  VRRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQ 69
           VR + TLTPV T+LAPP AASYSQA+K NN ++VSGQIPYT ENKPVEG+I+DKAEQV Q
Sbjct: 15  VRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQ 74

Query: 70  NVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVD 129
           N+KNIL E+ S +DKIVKVN+FLADIN+F EFN VYAKYFNVHKPARSCVA K LPLNVD
Sbjct: 75  NIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVD 134

Query: 130 LEMEVIAVE 138
           LE+EVIAVE
Sbjct: 135 LEVEVIAVE 143

>Scas_715.53
          Length = 128

 Score =  209 bits (531), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 111/126 (88%)

Query: 13  MNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVK 72
           M TLTPV  + AP  AASYS A+K NNLIF+SGQIP TAENKPVEGSIADKAEQVIQN+K
Sbjct: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60

Query: 73  NILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEM 132
           N+L  +NS L+KIVKVNIFLADINSFAEFN+VYAKYFNVHKPARSCVA  ALPLN DLEM
Sbjct: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120

Query: 133 EVIAVE 138
           EVIAVE
Sbjct: 121 EVIAVE 126

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score =  205 bits (521), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (82%), Gaps = 2/140 (1%)

Query: 1   MFRQALKSTV--RRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEG 58
           M R    +TV  R M++LTPV+T  APPPAASYSQA++ N ++FVSGQIPYT +NKPVEG
Sbjct: 1   MRRLTQTATVLARSMSSLTPVRTTAAPPPAASYSQAMRANGMVFVSGQIPYTPDNKPVEG 60

Query: 59  SIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSC 118
           S+ADK EQVI NV+N+L  +NS LD++ KVN+FLAD+  FAEFNSVYAKYF  HKPARSC
Sbjct: 61  SVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSC 120

Query: 119 VAAKALPLNVDLEMEVIAVE 138
           VA +ALPLNVDLEMEVIA+E
Sbjct: 121 VAVRALPLNVDLEMEVIALE 140

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score =  204 bits (519), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 112/128 (87%)

Query: 11  RRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQN 70
           R + TLTPV T+LAPP AASYSQA+K NN ++VSGQIPYT +NKPV+GSI++KAEQV QN
Sbjct: 16  RGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQN 75

Query: 71  VKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDL 130
           VKNIL E+NS LD IVKVN+FLAD+ +FAEFNSVYAK+F+ HKPARSCV   +LPLNVDL
Sbjct: 76  VKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDL 135

Query: 131 EMEVIAVE 138
           EMEVIAVE
Sbjct: 136 EMEVIAVE 143

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score =  194 bits (494), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 103/140 (73%), Positives = 120/140 (85%), Gaps = 2/140 (1%)

Query: 1   MFRQALKSTV--RRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEG 58
           MF    +S +  R+++ LTPV +  APP AASYS A+KVNNLI+VSGQIPYT +NKPVEG
Sbjct: 1   MFGLKARSLIMTRQLSKLTPVISANAPPAAASYSHAMKVNNLIYVSGQIPYTKDNKPVEG 60

Query: 59  SIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSC 118
           SI+DKAEQVIQNV+NIL ++NSDL++IVKVNIFLAD+N+FAEFN VYAKYFNVHKPARSC
Sbjct: 61  SISDKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSC 120

Query: 119 VAAKALPLNVDLEMEVIAVE 138
           VA  ALPL VDLEMEVIA E
Sbjct: 121 VAVAALPLGVDLEMEVIATE 140

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score =  175 bits (444), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 95/124 (76%), Positives = 105/124 (84%)

Query: 15  TLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNI 74
           TLTPV  + AP  AASYS A+KVNNLIF+SGQIP T +NK VEGSIADKAEQVIQN+KN+
Sbjct: 4   TLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNV 63

Query: 75  LVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEMEV 134
           L  +NS LD++VKVNIFLADIN FAEFNSVYAKYFN HKPARSCVA  ALPL VD+EME 
Sbjct: 64  LEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEA 123

Query: 135 IAVE 138
           IA E
Sbjct: 124 IAAE 127

>Kwal_47.16590
          Length = 126

 Score = 62.4 bits (150), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query: 38  NNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINS 97
           N  +F SG I        V   I D+    I+N++ +LV   S L K+ KV +F++  + 
Sbjct: 26  NGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETVLVAGGSSLSKVFKVTMFISHADY 85

Query: 98  FAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEMEVIA 136
               N +Y  YF  HKPARSCV    +   +  E+E IA
Sbjct: 86  SKVVNEIYGHYFP-HKPARSCVVVAFMDAAIKYELEAIA 123

>Kwal_23.2807
          Length = 129

 Score = 61.6 bits (148), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 63/107 (58%), Gaps = 9/107 (8%)

Query: 34  AIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVI----QNVKNILVEANSDLDKIVKVN 89
           A K N+L+F SG +       PV G++ +  EQ I    +N+KN+L  + S L++++KV 
Sbjct: 25  ASKSNDLVFTSGCV----GTDPVTGNLPEDLEQQIINALENLKNVLHASGSSLERVLKVL 80

Query: 90  IFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEMEVIA 136
           +F++D +  +  N VY++YF  + PARSC+        + +E+E IA
Sbjct: 81  LFVSDASYASTVNEVYSRYFP-NAPARSCIVVAFPAPALKVELECIA 126

>Kwal_55.21247
          Length = 134

 Score = 57.0 bits (136), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 38  NNLIFVSGQIPYTAENKPVEGSIADKAEQ----VIQNVKNILVEANSDLDKIVKVNIFLA 93
           ++L+F SG +       PV G +    EQ     ++N+KN+L  + S L++++KV +F++
Sbjct: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83

Query: 94  DINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEMEVIA 136
           D +     N VY++YF    PARSC+       ++ +E+E IA
Sbjct: 84  DGSYAPAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125

>Scas_506.3
          Length = 689

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 67/120 (55%), Gaps = 12/120 (10%)

Query: 21  TQLAPPPAASYSQAI-KVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEAN 79
           TQL+  P   Y  ++ KV NL+++S   P     K  E ++  +A+QV Q +  I+ E +
Sbjct: 303 TQLSTIPECKYRNSVNKVGNLLYISNLCP-----KDSELNVEQQAKQVFQQLDKIMKENS 357

Query: 80  SDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHK-----PARSCVAAKALPLNVDLEMEV 134
               +I+  ++ LA++++FA  N VY  +F ++K     P+R+CV +  L  NV L++ V
Sbjct: 358 LFPSQILFSSLILANMSNFATVNQVYNDFFRINKWGPLPPSRACVGS-VLSNNVQLQLSV 416

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 49.3 bits (116), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 36  KVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADI 95
           K   L++ SG +        +   +  +    + N+  +L  +NS  D ++K+ +F+AD 
Sbjct: 27  KDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALDNLGRVLKASNSSFDDVLKILLFVADG 86

Query: 96  NSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEMEVIA 136
           +  +  N+VY +YF   +PARSC+        + +E+E +A
Sbjct: 87  SYASTVNAVYKEYFP-ERPARSCIVVSFPDPTLKVELECVA 126

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 47.8 bits (112), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 57/105 (54%), Gaps = 10/105 (9%)

Query: 36  KVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADI 95
           ++ NL+++S   P   +     G++ ++ + V+Q + NIL + +     ++  ++ L D+
Sbjct: 318 RIGNLLYISNIQPQYKD-----GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372

Query: 96  NSFAEFNSVYAKYFNVHK-----PARSCVAAKALPLNVDLEMEVI 135
           + FA  N  Y+K+F++ K     PAR+C+ +  +     L++ V+
Sbjct: 373 SLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVV 417

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 44.3 bits (103), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 38  NNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINS 97
           N L+F SG +        +   +  +A   + N+K +L  + S +D ++K+ +F++D + 
Sbjct: 29  NQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSY 88

Query: 98  FAEFNSVYAKYFNVHKPARSCVAAKALPLN-VDLEMEVIA 136
               N V+ ++F  ++PARSC+   A P N + +E+E IA
Sbjct: 89  AGIVNKVFKEFFP-NQPARSCIVV-AFPNNKLKVELECIA 126

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 6/97 (6%)

Query: 45  GQIPYTAENKP-VEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNS 103
           G + Y +  +P   G +  +A  V   +   L        +++   + LAD+ +FAE N+
Sbjct: 313 GGLLYVSNIQPRCRGPLEKQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINT 372

Query: 104 VYAKYFNVHK-----PARSCVAAKALPLNVDLEMEVI 135
            Y  YF++ +     P+R+C+ +K+L   + L++ V+
Sbjct: 373 AYNGYFSIQEIGPLPPSRACIESKSLAPGIGLQLSVV 409

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 38/139 (27%), Positives = 68/139 (48%), Gaps = 15/139 (10%)

Query: 1   MFRQALKSTVRRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSI 60
           M+ + +   ++++N   P    ++P    S ++   V  L+++S   P   E      S+
Sbjct: 289 MYLRLMTIDLKKLNN-CPNHHNVSPSVPVSINE---VGKLLYISNIAPSKGE------SL 338

Query: 61  ADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHK-----PA 115
            +K   V   + +IL   +    +I+  ++ L+D+N+F E NS Y +YFNV K     PA
Sbjct: 339 KEKCLDVFSQLTSILSSRSIFACQILSSSLLLSDMNNFQEVNSYYNEYFNVTKIGPLPPA 398

Query: 116 RSCVAAKALPLNVDLEMEV 134
           R+CV +  L   V L + V
Sbjct: 399 RACVESSFLKHPVQLSVVV 417

>YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containing
           an endoribonuclease L-PSP domain and a DUF71 domain of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.3850p [2058 bp, 685 aa]
          Length = 685

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 55/105 (52%), Gaps = 11/105 (10%)

Query: 36  KVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADI 95
           K N+ +++S      +E      ++  ++E +   + +IL       + I+  ++ + D+
Sbjct: 317 KTNDKLYISNLQSRKSE------TVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDM 370

Query: 96  NSFAEFNSVYAKYFNVHK-----PARSCVAAKALPLNVDLEMEVI 135
           ++F + N +Y ++ ++ K     P+R+CV +K LP +  +++ V+
Sbjct: 371 SNFGKINKIYNEFLDLSKYGPLPPSRACVGSKCLPEDCHVQLSVV 415

>Kwal_27.11310
          Length = 688

 Score = 37.0 bits (84), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 55  PVEGSIAD-KAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHK 113
           P  GS  D K + V + + +IL +      +I+   + LAD+  F++ N  Y ++F+V +
Sbjct: 326 PKGGSSPDEKVQDVFRQLSDILRDYELSPAQILSSLVLLADMGDFSKVNEHYNEFFHVAR 385

Query: 114 -----PARSCVAAKALPLNVDLEMEVI 135
                P+R+CV +  +     L++ VI
Sbjct: 386 NGPLPPSRACVGSSLVGSENILQLSVI 412

>Scas_715.33
          Length = 1018

 Score = 32.7 bits (73), Expect = 0.071,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 26  PPAASYSQAI--KVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLD 83
           P   SYS+AI    N+L+  + ++P   E +  +G     AE V+  +KN+  E   DLD
Sbjct: 341 PIKQSYSKAIFNYTNSLLIATAELPEIDEIRVSQGGTESNAENVVTTLKNLSFE---DLD 397

>Kwal_47.17972
          Length = 498

 Score = 27.7 bits (60), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%)

Query: 36  KVNNLIFVSGQIPYTAEN----KPVEGSIADKAEQVIQNVKNILVEANSDL 82
           K N + +  GQ  +  EN     PVEG      E++    KNI+V   S++
Sbjct: 129 KKNGVTYYKGQGAFEDENNIKVSPVEGIEGSVTEEITLEAKNIIVATGSEV 179

>Scas_474.7
          Length = 476

 Score = 27.7 bits (60), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 41  IFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAE 100
           + ++G+IP  A+ + +   +A +AE + ++V N+L      L  + + +I +  + S ++
Sbjct: 127 LLLTGEIPSRAQVEQLSADLASRAE-LPEHVVNLLNGLPKHLHPMAQFSIAVNALESESK 185

Query: 101 FNSVYAKYFN 110
           F   YA+  N
Sbjct: 186 FAKAYAQGVN 195

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.130    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,947,949
Number of extensions: 147570
Number of successful extensions: 550
Number of sequences better than 10.0: 33
Number of HSP's gapped: 545
Number of HSP's successfully gapped: 33
Length of query: 138
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 47
Effective length of database: 13,445,871
Effective search space: 631955937
Effective search space used: 631955937
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)