Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C08327g1031025291e-71
Sklu_2193.41021023581e-45
Scas_715.521071013572e-45
YER058W (PET117)1071043512e-44
ADL076W1131023088e-38
CAGL0J02926g127973053e-37
Kwal_23.5805102972931e-35
Kwal_26.668656955720.044
KLLA0F07117g15146601.5
YHR096C (HXT5)59249583.6
KLLA0E08987g56680574.1
YMR011W (HXT2)54154574.4
Kwal_55.2104931027564.8
Sklu_2415.257143549.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C08327g
         (102 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C08327g complement(730884..731195) similar to sp|Q02771 Sac...   208   1e-71
Sklu_2193.4 YER058W, Contig c2193 6568-6876                           142   1e-45
Scas_715.52                                                           142   2e-45
YER058W (PET117) [1488] chr5 (271766..272089) Protein involved i...   139   2e-44
ADL076W [1665] [Homologous to ScYER058W (PET117) - SH] complemen...   123   8e-38
CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces c...   122   3e-37
Kwal_23.5805                                                          117   1e-35
Kwal_26.6686                                                           32   0.044
KLLA0F07117g 680589..681044 no similarity, hypothetical start          28   1.5  
YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of ...    27   3.6  
KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1 Kluyverom...    27   4.1  
YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexos...    27   4.4  
Kwal_55.21049                                                          26   4.8  
Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement         25   9.9  

>KLLA0C08327g complement(730884..731195) similar to sp|Q02771
           Saccharomyces cerevisiae YER058w PET117 cytochrome c
           oxidase assembly factor singleton, start by similarity
          Length = 103

 Score =  208 bits (529), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%)

Query: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60
           MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK
Sbjct: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60

Query: 61  ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQK 102
           ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQK
Sbjct: 61  ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQK 102

>Sklu_2193.4 YER058W, Contig c2193 6568-6876
          Length = 102

 Score =  142 bits (358), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 84/102 (82%), Gaps = 1/102 (0%)

Query: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLAR-QNGVDPE 59
           MSRASKITL L+ L T T V+GVH VQ++ERQTLHQGPIKDA+RVAEKKLA+ +   DP 
Sbjct: 1   MSRASKITLALSCLLTTTTVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60

Query: 60  KERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQ 101
           K+R ++VNK EHE Q ELRKKYE MQPLSGEV TKD E++++
Sbjct: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVKK 102

>Scas_715.52
          Length = 107

 Score =  142 bits (357), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 84/101 (83%)

Query: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60
           MSRASKIT  LT +FT T  VGVH+VQ +ER TLHQGPIKDA+RVAEKK  +++G+DP K
Sbjct: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60

Query: 61  ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQ 101
           E++RM N++EHE Q EL+K+YEQ QPLSGEV TKD E++++
Sbjct: 61  EKKRMFNQSEHELQKELKKQYEQQQPLSGEVVTKDGEVVKE 101

>YER058W (PET117) [1488] chr5 (271766..272089) Protein involved in
           assembly of cytochrome oxidase [324 bp, 107 aa]
          Length = 107

 Score =  139 bits (351), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 82/104 (78%), Gaps = 3/104 (2%)

Query: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGV---D 57
           MSRASKIT   + L TA  VVGVH+VQE+ER+TLHQGPIKDA+RV EK+L + NGV   D
Sbjct: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60

Query: 58  PEKERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQ 101
           P KER+R  N +EHE Q ELRKKYE MQPLSGEV TKD E++++
Sbjct: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVKE 104

>ADL076W [1665] [Homologous to ScYER058W (PET117) - SH]
           complement(550058..550399) [342 bp, 113 aa]
          Length = 113

 Score =  123 bits (308), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 61/102 (59%), Positives = 75/102 (73%), Gaps = 2/102 (1%)

Query: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60
           MSRASKITL L T  +A  VV VH VQE+ER  L QGPIKDA R AEK+  R    DPE 
Sbjct: 14  MSRASKITLALCTAASAATVVTVHLVQEMERDALKQGPIKDALRTAEKRAERD--ADPEA 71

Query: 61  ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQK 102
            R++M+N +EHE QLELR+KY  MQPLSGEV T+D +++E++
Sbjct: 72  ARKKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVVERR 113

>CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces
           cerevisiae YER058w PET117, start by similarity
          Length = 127

 Score =  122 bits (305), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 74/97 (76%), Gaps = 4/97 (4%)

Query: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60
           MSRASKIT G++   T   ++GVH+VQELER+TLHQGPIKDA+RVAEKK     G D +K
Sbjct: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTDEKK 91

Query: 61  ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNE 97
               ++N++EHE Q ELRKKYE MQPLSGEV T+D E
Sbjct: 92  ----LLNRSEHELQQELRKKYESMQPLSGEVVTQDGE 124

>Kwal_23.5805
          Length = 102

 Score =  117 bits (293), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 73/97 (75%), Gaps = 6/97 (6%)

Query: 1  MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60
          MS ASKITL L+ + T   V+GVH+VQELER TLHQGPIKDA+R+A++K   +N      
Sbjct: 1  MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMEN------ 54

Query: 61 ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNE 97
          ER++  N++EHE Q ELR+KYE +QPLSGEV TKD E
Sbjct: 55 ERKKRFNESEHELQQELRRKYEALQPLSGEVLTKDGE 91

>Kwal_26.6686
          Length = 569

 Score = 32.3 bits (72), Expect = 0.044,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 6   KITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60
           +I +GL  L+   I+ G+  V E  R  +  G +++A+R     +AR N VDPE+
Sbjct: 238 RIPVGLCFLWAMIIIGGMTFVPESPRFLVEVGRMEEAKR----SVARSNKVDPEE 288

>KLLA0F07117g 680589..681044 no similarity, hypothetical start
          Length = 151

 Score = 27.7 bits (60), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 21 VGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEKERQRMV 66
          +G HHVQ+     +   P  D  +++E K  +QN   P+ +  R++
Sbjct: 53 LGSHHVQKPNELDVTSNPTGDISKMSESKRLKQNA-QPDTKPYRLI 97

>YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1779 bp, 592 aa]
          Length = 592

 Score = 26.9 bits (58), Expect = 3.6,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 6   KITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQN 54
           ++ LGL   ++  ++VG+  V E  R  +  G I++A+R     LAR N
Sbjct: 257 RVPLGLCFAWSIFMIVGMTFVPESPRYLVEVGKIEEAKR----SLARAN 301

>KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1
           Kluyveromyces lactis hexose transporter, start by
           similarity
          Length = 566

 Score = 26.6 bits (57), Expect = 4.1,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 6   KITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEKERQRM 65
           +  LG + +F+  + VG+  + E  R  +H+G   +A +V  ++L   + +  ++E   M
Sbjct: 249 RYMLGSSLVFSTILFVGLFFLPESPRWLIHKGYDVEAYKVW-RRLRDTSDLGNKREFLEM 307

Query: 66  VNKNEHEYQL-ELRKKYEQM 84
            +  E + QL E   +++ M
Sbjct: 308 KHAAEQDRQLKEQESRFKSM 327

>YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexose
           transporter, member of the hexose transport family of
           the major facilitator superfamily (MFS) [1626 bp, 541
           aa]
          Length = 541

 Score = 26.6 bits (57), Expect = 4.4,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 6   KITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPE 59
           ++ LGL   F   ++ G+  V E  R  + +G  +DA+R     LA+ N V  E
Sbjct: 227 RVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKR----SLAKSNKVTIE 276

>Kwal_55.21049
          Length = 310

 Score = 26.2 bits (56), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 67  NKNEHEYQLELRKKYEQMQPLSGEVRT 93
           NK+E  Y  E R++Y    P +G + T
Sbjct: 108 NKDESSYDAESRRRYRAPPPAAGAIST 134

>Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement
          Length = 571

 Score = 25.4 bits (54), Expect = 9.9,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 23/43 (53%)

Query: 6   KITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEK 48
           ++ LGL   +   +VVG+  V E  R  +  G ++DA+R   K
Sbjct: 240 RVPLGLCFAWAIIMVVGMCFVPESPRFLVKVGRVEDAKRSVAK 282

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.128    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,157,258
Number of extensions: 121113
Number of successful extensions: 694
Number of sequences better than 10.0: 97
Number of HSP's gapped: 679
Number of HSP's successfully gapped: 103
Length of query: 102
Length of database: 16,596,109
Length adjustment: 73
Effective length of query: 29
Effective length of database: 14,068,995
Effective search space: 408000855
Effective search space used: 408000855
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (25.4 bits)