Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C08305g40940318920.0
ADL075W2072056761e-87
YER059W (PCL6)4202556821e-85
Scas_704.354482146718e-84
Kwal_23.58074652166677e-83
CAGL0M12342g4572226422e-79
YIL050W (PCL7)2852455752e-71
Scas_715.513412135096e-61
Sklu_2373.43072021765e-14
KLLA0D01287g3451371671e-12
ACR001C3461821661e-12
CAGL0E02541g3421831563e-11
Scas_392.13031331472e-10
YOL001W (PHO80)2931331412e-09
Kwal_56.224432801381365e-09
YGL134W (PCL10)433601271e-07
YPL219W (PCL8)4921531244e-07
Scas_720.474731611226e-07
Scas_706.3451651217e-07
Kwal_56.241514801551192e-06
CAGL0H08998g5471441182e-06
CAGL0E05918g4811591173e-06
KLLA0B02024g5271401083e-05
AFL115W386471048e-05
YNL289W (PCL1)279111920.002
CAGL0E02233g26661800.052
Kwal_34.1599623161770.11
AAL032W24466770.11
AER440C44853740.36
Scas_646.2323865710.61
AEL195W23762653.9
YJL109C (UTP10)176999639.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C08305g
         (403 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C08305g complement(728996..730225) some similarities with s...   733   0.0  
ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W (...   265   1e-87
YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associat...   267   1e-85
Scas_704.35                                                           263   8e-84
Kwal_23.5807                                                          261   7e-83
CAGL0M12342g complement(1232642..1234015) weakly similar to sp|P...   251   2e-79
YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates w...   226   2e-71
Scas_715.51                                                           200   6e-61
Sklu_2373.4 YOL001W, Contig c2373 11960-12883                          72   5e-14
KLLA0D01287g 112866..113903 some similarities with sp|P20052 Sac...    69   1e-12
ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH] (357962..3...    69   1e-12
CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces c...    65   3e-11
Scas_392.1                                                             61   2e-10
YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that intera...    59   2e-09
Kwal_56.22443                                                          57   5e-09
YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associa...    54   1e-07
YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associa...    52   4e-07
Scas_720.47                                                            52   6e-07
Scas_706.3                                                             51   7e-07
Kwal_56.24151                                                          50   2e-06
CAGL0H08998g 877952..879595 weakly similar to tr|Q08966 Saccharo...    50   2e-06
CAGL0E05918g complement(585723..587168) some similarities with t...    50   3e-06
KLLA0B02024g 176585..178168 some similarities with sp|P53124 Sac...    46   3e-05
AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W (...    45   8e-05
YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin ...    40   0.002
CAGL0E02233g 215697..216497 similar to sp|P24867 Saccharomyces c...    35   0.052
Kwal_34.15996                                                          34   0.11 
AAL032W [155] [Homologous to ScYHR071W (PCL5) - SH] complement(2...    34   0.11 
AER440C [2940] [Homologous to ScYGL215W (CLG1) - SH] (1477945..1...    33   0.36 
Scas_646.23                                                            32   0.61 
AEL195W [2311] [Homologous to ScYNL289W (PCL1) - SH] complement(...    30   3.9  
YJL109C (UTP10) [2806] chr10 complement(211917..217226) Componen...    29   9.0  

>KLLA0C08305g complement(728996..730225) some similarities with
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 409

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/403 (89%), Positives = 362/403 (89%)

Query: 1   MSYLRNTTSSSYAETEPIEIPVNRTETEPYSSSLQGSQVNSEAXXXXXXXXXXXXXXXDK 60
           MSYLRNTTSSSYAETEPIEIPVNRTETEPYSSSLQGSQVNSEA               DK
Sbjct: 1   MSYLRNTTSSSYAETEPIEIPVNRTETEPYSSSLQGSQVNSEAITTSTRLIDSSSSSIDK 60

Query: 61  YGSGGLTPQDMNHGVTSSYFDSXXXXXXXXXXHTDTNFNKHAGISSSFIXXXXXXXXXXX 120
           YGSGGLTPQDMNHGVTSSYFDS          HTDTNFNKHAGISSSFI           
Sbjct: 61  YGSGGLTPQDMNHGVTSSYFDSNYNNNIASNNHTDTNFNKHAGISSSFIDNTSGVSSSLD 120

Query: 121 XXXXXRHSNLSGNFLPNDTQSNSNVLIPVKAVSELRIDDEQTGSSSTSQPDHHSNDETQH 180
                RHSNLSGNFLPNDTQSNSNVLIPVKAVSELRIDDEQTGSSSTSQPDHHSNDETQH
Sbjct: 121 SGSNLRHSNLSGNFLPNDTQSNSNVLIPVKAVSELRIDDEQTGSSSTSQPDHHSNDETQH 180

Query: 181 SLNNNNHHMDIATFPTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSF 240
           SLNNNNHHMDIATFPTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSF
Sbjct: 181 SLNNNNHHMDIATFPTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSF 240

Query: 241 RGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKT 300
           RGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKT
Sbjct: 241 RGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKT 300

Query: 301 TASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLE 360
           TASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLE
Sbjct: 301 TASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLE 360

Query: 361 LQFLILCDFRLIISVEELQRYADLLYKFWDKEKHLYQSVSQPT 403
           LQFLILCDFRLIISVEELQRYADLLYKFWDKEKHLYQSVSQPT
Sbjct: 361 LQFLILCDFRLIISVEELQRYADLLYKFWDKEKHLYQSVSQPT 403

>ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W
           (PCL6) - SH] complement(550944..551567) [624 bp, 207 aa]
          Length = 207

 Score =  265 bits (676), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 135/205 (65%), Positives = 150/205 (73%), Gaps = 25/205 (12%)

Query: 188 HMDIATFPTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPG 247
           HMDIA FPT KLL+MLTGLL KIIKSND L   P  +     N   +  +LSFRGK +P 
Sbjct: 15  HMDIAQFPTDKLLEMLTGLLYKIIKSNDRL--KPFDQEKHDINNKYVAHVLSFRGKHIPT 72

Query: 248 ITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQ 307
           ITL  YF RIQKYCP TNDV LSLLV+FDRIAK+CNA+                      
Sbjct: 73  ITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAL---------------------- 110

Query: 308 SSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILC 367
             PQLFVMDS+NIHRLIIAA+TVSTKF SDFFYSNSRYARVGGISL+ELN LELQF ILC
Sbjct: 111 -DPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILC 169

Query: 368 DFRLIISVEELQRYADLLYKFWDKE 392
           DF LI+S++ELQRYADLLYKFW +E
Sbjct: 170 DFELIVSIQELQRYADLLYKFWHRE 194

>YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           utilization of alternative carbon and nitrogen sources
           [1263 bp, 420 aa]
          Length = 420

 Score =  267 bits (682), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 142/255 (55%), Positives = 167/255 (65%), Gaps = 44/255 (17%)

Query: 189 MDIATFPTYKLLDMLTGLLTKIIKSNDSLGST-PNF--ETSQGKNIPL-------MREIL 238
           ++IA FPT KLL MLT LLTKIIKSND   +T P+   E   G+ + L       +  +L
Sbjct: 162 LNIAEFPTDKLLKMLTALLTKIIKSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVL 221

Query: 239 SFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAI--------AQEYM 290
            FRGK VP I L QYFQRIQKYCPTTNDV LSLLV+FDRI+K+CN++        A+   
Sbjct: 222 GFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKHES 281

Query: 291 VSVVSTPDKTTASLAHQSS--------------------------PQLFVMDSHNIHRLI 324
            S  S+ DK        S+                          PQ+FVMDSHNIHRLI
Sbjct: 282 PSNESSLDKANRGADKMSACNSNENNENDDSDDENTGVQRDSRAHPQMFVMDSHNIHRLI 341

Query: 325 IAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVEELQRYADL 384
           IA ITVSTKF+SDFFYSNSRY+RVGGISLQELNHLELQFL+LCDF L+ISV ELQRYADL
Sbjct: 342 IAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYADL 401

Query: 385 LYKFWDKEKHLYQSV 399
           LY+FW+  K   Q++
Sbjct: 402 LYRFWNNAKAQSQAL 416

>Scas_704.35
          Length = 448

 Score =  263 bits (671), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 134/214 (62%), Positives = 155/214 (72%), Gaps = 21/214 (9%)

Query: 184 NNNHHMDIATFPTYKLLDMLTGLLTKIIKSNDSLG-STPNFET-------SQGKNIPLMR 235
           ++N  ++IA FPT KLL+MLT LL KI+KSND L  S+ N E+           N   + 
Sbjct: 219 DDNESINIAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVG 278

Query: 236 EILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVS 295
            IL+FRGK VP I+L QYFQRIQKYCPTTNDV LSLLV+FDRI+K+CN        SV S
Sbjct: 279 SILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNN-------SVTS 331

Query: 296 TPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQE 355
             D  T      +  QLFVMDS+NIHRLIIA +TV TKF SDFFYSNSRYARVGG+SLQE
Sbjct: 332 QGDSPT------NKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQE 385

Query: 356 LNHLELQFLILCDFRLIISVEELQRYADLLYKFW 389
           LNHLELQFL+LCDF L+I  EELQRYADLL +FW
Sbjct: 386 LNHLELQFLVLCDFELMIPTEELQRYADLLSRFW 419

>Kwal_23.5807
          Length = 465

 Score =  261 bits (667), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 150/216 (69%), Gaps = 35/216 (16%)

Query: 189 MDIATFPTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQ-----------GKNIP-LMRE 236
           + IATFPT +LL MLT LL KI+KSND L     F+  Q               P +  E
Sbjct: 261 IQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIASE 320

Query: 237 ILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVST 296
           ILSFRGK VP ITL+QYFQRIQKYCPTTNDV LSLLV+FDRIAK CN             
Sbjct: 321 ILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCN------------- 367

Query: 297 PDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQEL 356
                         QLFVMDS+NIHRLII+A+TVSTKF SDFFYSNSRYARVGGISL+EL
Sbjct: 368 ----------HGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKEL 417

Query: 357 NHLELQFLILCDFRLIISVEELQRYADLLYKFWDKE 392
           NHLELQFL+LCDF LIISVEELQ+Y+DLL  FW++E
Sbjct: 418 NHLELQFLVLCDFELIISVEELQKYSDLLRDFWNRE 453

>CAGL0M12342g complement(1232642..1234015) weakly similar to
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 457

 Score =  251 bits (642), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 153/222 (68%), Gaps = 32/222 (14%)

Query: 189 MDIATFPTYKLLDMLTGLLTKIIKSND------------------SLGSTPNFETSQGKN 230
           ++IA FPT KLL+MLT LL KIIKSND                  SL  +          
Sbjct: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYKDKDKDEDHDDDESLTDSKLMSVKGTDK 295

Query: 231 IPLMREILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYM 290
              ++ ILSF+GK VP ITL QYFQRIQKYCPTTNDV LSLLV+FDRI+KKCN+   E  
Sbjct: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSE-- 353

Query: 291 VSVVSTPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGG 350
            S  ++P           + QLFVMDS+NIHRL+IA +TV TKF SDFFYSNSRYARVGG
Sbjct: 354 -SADTSP-----------ADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGG 401

Query: 351 ISLQELNHLELQFLILCDFRLIISVEELQRYADLLYKFWDKE 392
           ISL ELNHLELQFL+LCDF L+ISV++LQRYA+LL +FW+ +
Sbjct: 402 ISLSELNHLELQFLVLCDFELLISVDKLQRYANLLLRFWNNQ 443

>YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates with
           the Pho85p cyclin-dependent kinase, involved in
           utilization of alternate carbon sources [858 bp, 285 aa]
          Length = 285

 Score =  226 bits (575), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 161/245 (65%), Gaps = 29/245 (11%)

Query: 148 PVKAVSELRIDDEQTGSSSTSQPDHHSNDETQHSLNNNNHHMDIATFPTYKLLDMLTGLL 207
           PV+AV +    + +T S      D  +N++T   +      ++IA FPT +L+ M++ LL
Sbjct: 70  PVQAVKKSLESEAKTHSL-----DEETNEQTDVKI------LNIADFPTDELILMISALL 118

Query: 208 TKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQKYCPTTNDV 267
            +II +ND        + S      L+  IL+F GK VP I + QY +RIQKYCPTTND+
Sbjct: 119 NRIITANDETTDVSQ-QVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDI 177

Query: 268 LLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSHNIHRLIIAA 327
            LSLLV+FDRI+K                 +   +S  +  + QLFVMDS NIHRL+I  
Sbjct: 178 FLSLLVYFDRISK-----------------NYGHSSERNGCAKQLFVMDSGNIHRLLITG 220

Query: 328 ITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVEELQRYADLLYK 387
           +T+ TKF+SDFFYSNSRYA+VGGISLQELNHLELQFLILCDF+L++SVEE+Q+YA+LLYK
Sbjct: 221 VTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYK 280

Query: 388 FWDKE 392
           FW+ +
Sbjct: 281 FWNDQ 285

>Scas_715.51
          Length = 341

 Score =  200 bits (509), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 144/213 (67%), Gaps = 13/213 (6%)

Query: 186 NHHMDIATFPTYKLLDMLTGLLTKIIKSNDSL---------GSTPNFETSQGKNIPLMRE 236
           N  +DI    T KL+ M++ +L K+IKSND L           T +  + + K   L+R 
Sbjct: 124 NDFIDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESK---LVRS 180

Query: 237 ILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVST 296
           I SFRGK +P I L+QYF RIQKYCPT N VLL++L++FDRI+K  N   +      +ST
Sbjct: 181 IKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNIST 240

Query: 297 PDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQEL 356
                 +   +   + F++DS+NIHRLII+AITVSTKF SDFFYSNSRYA+VGGISL E+
Sbjct: 241 HHHLLRNYDCKIEDK-FLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEM 299

Query: 357 NHLELQFLILCDFRLIISVEELQRYADLLYKFW 389
           N+LELQFL++ +F LIIS EE+QRY+ LL KF+
Sbjct: 300 NYLELQFLLISNFDLIISSEEIQRYSGLLSKFY 332

>Sklu_2373.4 YOL001W, Contig c2373 11960-12883
          Length = 307

 Score = 72.4 bits (176), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 95/202 (47%), Gaps = 47/202 (23%)

Query: 199 LLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQ 258
           L+ +++ +L+ +I+ NDS+         + KN+ L R    F  +  PGI++  Y  R+ 
Sbjct: 61  LVVLISRMLSSLIQMNDSM--------CKDKNLKLTR----FHSRVPPGISVYNYLIRLA 108

Query: 259 KYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSH 318
           KY      VL++ + + D ++            SV  +                F ++S 
Sbjct: 109 KYSSLEPAVLIAAVYYIDLLS------------SVYPS----------------FTLNSL 140

Query: 319 NIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLII----- 373
            +HR ++ A TV++K +SD F +N  YA+VGG+   ELN LE +FL   ++R+I      
Sbjct: 141 TVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNI 200

Query: 374 --SVEELQRYADLLYKFWDKEK 393
               EE Q+   + +   DK K
Sbjct: 201 FNCKEEYQQGVFITFPLADKIK 222

>KLLA0D01287g 112866..113903 some similarities with sp|P20052
           Saccharomyces cerevisiae YOL001w PHO80 cyclin,
           hypothetical start
          Length = 345

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 67/137 (48%), Gaps = 28/137 (20%)

Query: 236 EILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVS 295
           E+  F  K  P IT+ QY  R+ KY    + VLLS + + D ++    A+  E       
Sbjct: 59  ELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS----AVYPE------- 107

Query: 296 TPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQE 355
                            F ++S  +HR ++ A T+++K + D F +N+ Y++VGG+   E
Sbjct: 108 -----------------FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSE 150

Query: 356 LNHLELQFLILCDFRLI 372
           LN LE +FL    +R+I
Sbjct: 151 LNILENEFLERVRYRII 167

>ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH]
           (357962..359002) [1041 bp, 346 aa]
          Length = 346

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 39/182 (21%)

Query: 199 LLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQ 258
           L+ +++ +LT +I  ND+ G        + K I L R    F  +  P I++  Y  R+ 
Sbjct: 30  LVVLISRMLTSLIGMNDAQGD-------KSKPIKLTR----FHSRVPPAISVYNYLIRLT 78

Query: 259 KYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSH 318
           KY    + VLL+ + + D                           L     P+ F +DS 
Sbjct: 79  KYSSLEHCVLLASVYYID---------------------------LLTNVYPE-FRLDSL 110

Query: 319 NIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVEEL 378
            +HR ++ A TV++K + D F +N+ YA+VGG+   ELN LE +FL   ++R++   + +
Sbjct: 111 TVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNI 170

Query: 379 QR 380
           +R
Sbjct: 171 RR 172

>CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces
           cerevisiae YOL001w PHO80 cyclin, start by similarity
          Length = 342

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 83/183 (45%), Gaps = 38/183 (20%)

Query: 190 DIATFPTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGIT 249
           D    P   L+ ++  +L  II+ NDS     N + ++ K       +  F  K  P I+
Sbjct: 22  DFLKCPKGDLVILIARMLQFIIQINDS-----NIKENERK-----YGLTRFHSKIAPNIS 71

Query: 250 LKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSS 309
           +  YF R+ KY    + VLLS + + D ++    A                         
Sbjct: 72  VFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPA------------------------- 106

Query: 310 PQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDF 369
              F ++S   HR ++ A T+++K + D F +N+ Y++VGG+   ELN LE +FL   ++
Sbjct: 107 ---FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNY 163

Query: 370 RLI 372
           R+I
Sbjct: 164 RII 166

>Scas_392.1
          Length = 303

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 28/133 (21%)

Query: 240 FRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDK 299
           F  +  P I++  Y  R+ KYC   + VLLS++ + D                       
Sbjct: 100 FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYID----------------------- 136

Query: 300 TTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHL 359
               L   + P  F  +S   HR ++ AITV+ K + D F + ++YA++GG+  +ELN L
Sbjct: 137 ----LFTAAYPT-FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNIL 191

Query: 360 ELQFLILCDFRLI 372
           E  FL + ++R+I
Sbjct: 192 ETYFLRIVNYRII 204

>YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that interacts
           with Pho85p cyclin-dependent kinase, regulates the
           phosphate pathway through phosphorylation of Pho4p [882
           bp, 293 aa]
          Length = 293

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 62/133 (46%), Gaps = 28/133 (21%)

Query: 240 FRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDK 299
           +  K  P I++  YF R+ K+    + VL++ L + D +                  PD 
Sbjct: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQ--------------TVYPD- 111

Query: 300 TTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHL 359
                        F ++S   HR ++ A TV+TK + D F +N+ YA+VGG+   ELN L
Sbjct: 112 -------------FTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNIL 158

Query: 360 ELQFLILCDFRLI 372
           E  FL   ++R+I
Sbjct: 159 ENDFLKRVNYRII 171

>Kwal_56.22443
          Length = 280

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 28/138 (20%)

Query: 235 REILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVV 294
           +E+  F  +  P I++  Y  R+ +Y      VL++ + + D +                
Sbjct: 70  KELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLL---------------- 113

Query: 295 STPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQ 354
                   S  + S    F ++S  +HR ++ A TV++K + D F +NS YA+VGG+   
Sbjct: 114 --------SAMYPS----FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCS 161

Query: 355 ELNHLELQFLILCDFRLI 372
           EL+ LE +FL   ++R++
Sbjct: 162 ELHVLESEFLKKVNYRIL 179

>YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           glycogen accumulation [1302 bp, 433 aa]
          Length = 433

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 43/60 (71%), Gaps = 1/60 (1%)

Query: 320 IHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLI-LCDFRLIISVEEL 378
           +HR+IIAA+ +STK + DF +S+  +++V GIS + L  LE+  LI +C+ +L++S  +L
Sbjct: 359 VHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVSNRKL 418

>YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           control of glycogen accumulation [1479 bp, 492 aa]
          Length = 492

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 74/153 (48%), Gaps = 23/153 (15%)

Query: 235 REILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVV 294
           ++ ++F  K  P ++ + +  RIQ  C      +   +V+          +   Y++ +V
Sbjct: 351 QKFVNFVMKNPPSLSFRDFIDRIQNKC------MFGAVVY----------LGATYLLQLV 394

Query: 295 -STPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISL 353
             T D+    +  ++  Q         HR+II+ I ++TK + DF +S +   +V GIS 
Sbjct: 395 FLTRDEMDGPIKLKAKLQ-----EDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISK 449

Query: 354 QELNHLELQFLILCDFR-LIISVEELQRYADLL 385
           + L  LE+ F+   +F  L+I+ E+L++   +L
Sbjct: 450 RLLTKLEISFMASVNFDGLMITCEKLEKTLHIL 482

>Scas_720.47
          Length = 473

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 75/161 (46%), Gaps = 21/161 (13%)

Query: 207 LTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQKYCPTTND 266
           +T + +S + +    N E S  + +  M    +F+ K  P ++   + QRIQ  C     
Sbjct: 307 ITNMRESIEEILQMSNRELSIDEPLDEMIAFSNFKMKSPPSLSYADFIQRIQNKCEYDPH 366

Query: 267 VLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSHNIHRLIIA 326
           V L               IA   + +++   ++ +  L  +     F  +  ++HRLIIA
Sbjct: 367 VYL---------------IATYLLQTLLLIREEHSRKLKLR-----FKFEKSDVHRLIIA 406

Query: 327 AITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILC 367
            + ++TK + D  +S+  + +V GIS + L+ LE+  L+LC
Sbjct: 407 TVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVS-LLLC 446

>Scas_706.3
          Length = 451

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 315 MDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLI-LCDFRLII 373
           +  + +HR+IIA I V TK + DF +S+  + +V G+S + L+ LE+  L+ L   ++II
Sbjct: 373 LQENEVHRMIIATIRVGTKLVEDFVHSHQYFCKVCGVSRKLLSKLEVTLLLCLKHDKIII 432

Query: 374 SVEEL 378
           + EEL
Sbjct: 433 TTEEL 437

>Kwal_56.24151
          Length = 480

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 70/155 (45%), Gaps = 39/155 (25%)

Query: 226 SQGKNIPLMR---EILSFRGKQVPGITLKQYFQRIQ---KYCP----TTNDVLLSLLVHF 275
           S+  N+PL     ++ +F     P +  ++Y QR+     + P    T   +L SL    
Sbjct: 331 SKNANVPLGNPPPQLATFNMDSTPTLAYEEYLQRLHCKFSFAPIVYLTAAHLLQSLF--- 387

Query: 276 DRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFI 335
             + +K N +  +Y                         +D+  +HRLIIA+I ++TK +
Sbjct: 388 --LTRKDNKLCCKYH------------------------LDNCQVHRLIIASIRLATKLL 421

Query: 336 SDFFYSNSRYARVGGISLQELNHLELQFLILCDFR 370
            D  +S++ ++R+ GIS + L  LE+ FL   +F 
Sbjct: 422 EDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFE 456

>CAGL0H08998g 877952..879595 weakly similar to tr|Q08966
           Saccharomyces cerevisiae YPL219w PCL8, hypothetical
           start
          Length = 547

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 25/144 (17%)

Query: 238 LSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVV-ST 296
           L+F  K  P ++ + +  RIQ  C             F  I      +A  Y++ ++  T
Sbjct: 412 LNFTMKSKPSVSAEIFLGRIQNKC------------EFGPII----YLAAAYLLQILFLT 455

Query: 297 PDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQEL 356
            D   +++  +       +  + IHRLII+ + VS K + DF +S+  +++V G+S + L
Sbjct: 456 RDNPDSNIRVR-----LKLRENEIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLL 510

Query: 357 NHLELQFLILC--DFRLIISVEEL 378
           + LE+  LI+C  + RL+I+ ++L
Sbjct: 511 SKLEVS-LIMCIKNERLMITKQKL 533

>CAGL0E05918g complement(585723..587168) some similarities with
           tr|Q08966 Saccharomyces cerevisiae YPL219w PCL8,
           hypothetical start
          Length = 481

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 31/159 (19%)

Query: 240 FRGKQVPGITLKQYFQRIQKYCPTTNDVLLS----LLVHFDRIAKKCNAIAQEYMVSVVS 295
           F  K  P I+   + QRIQ  C   + + L     L + F         + +EY      
Sbjct: 346 FSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILF---------LTREY------ 390

Query: 296 TPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQE 355
             +     L H+       +  + +HR+I+  I ++TK + DF +S+    +V GIS + 
Sbjct: 391 --NDGPLRLKHK-------LQQNEVHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKL 441

Query: 356 LNHLELQFLILC--DFRLIISVEELQRYADLLYKFWDKE 392
           +  LEL  LI C  D  L+I+ E+L   A +L +   +E
Sbjct: 442 MTKLELA-LIFCLKDNNLLINSEKLSATACILEELKAQE 479

>KLLA0B02024g 176585..178168 some similarities with sp|P53124
           Saccharomyces cerevisiae YGL134w PCL10 cyclin like
           protein interacting with PHO85P, hypothetical start
          Length = 527

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 64/140 (45%), Gaps = 20/140 (14%)

Query: 240 FRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDK 299
           F+ K  P +++ QY  RI+  C     + L+               A   +V+       
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLT---------------ASFLLVTYCDIKFD 436

Query: 300 TTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHL 359
           T +   H  +P    M     HRL+IA I ++ K + D  +S+S +++V GIS + L+ L
Sbjct: 437 TGSGKFHLENPITESM----THRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKL 492

Query: 360 ELQF-LILCDFRLIISVEEL 378
           EL   LIL D +  + + EL
Sbjct: 493 ELNLVLILQDTQDGLLITEL 512

>AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W
           (PCL10) - SH] complement(221235..222395) [1161 bp, 386
           aa]
          Length = 386

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 32/47 (68%)

Query: 320 IHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLIL 366
           +HRLI+A I VSTK + D  +S+  +++V GIS + L  LEL  +++
Sbjct: 305 VHRLIVALIRVSTKIVEDTVHSHEYFSKVCGISKKLLMRLELALILV 351

>YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin
           that interacts with the Cdc28p-like kinase Pho85p [840
           bp, 279 aa]
          Length = 279

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 6/111 (5%)

Query: 274 HFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDS----HNIHRLIIAAIT 329
           H  R+      I +    + V TP   TA+       ++   D+      IHR+ +A + 
Sbjct: 48  HLTRLPSLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACLI 107

Query: 330 VSTKFISDFFYSNSRYARV--GGISLQELNHLELQFLILCDFRLIISVEEL 378
           +S KF +D    N  +AR   G  +L+++N +E Q L L ++ L ++ E+L
Sbjct: 108 LSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDLRVNTEDL 158

>CAGL0E02233g 215697..216497 similar to sp|P24867 Saccharomyces
           cerevisiae YNL289w PCL1 cyclin, start by similarity
          Length = 266

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 320 IHRLIIAAITVSTKFISDFFYSNSRYARV--GGISLQELNHLELQFLILCDFRLIISVEE 377
           IHRL +A + +S+K  +D    N  +AR   G  SL+++N +E Q L L ++ + +S ++
Sbjct: 98  IHRLFLACLILSSKCHNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDD 157

Query: 378 L 378
           L
Sbjct: 158 L 158

>Kwal_34.15996
          Length = 231

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 37/61 (60%)

Query: 322 RLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVEELQRY 381
           R+ +  + ++ KF++D  +S + + R+ G+S ++L+ +E   L   D+ L+I+ E L  +
Sbjct: 127 RVYLCCLILAHKFLNDQTFSMNSWQRISGLSSKDLSTMERWCLSKLDYELLINDENLNSW 186

Query: 382 A 382
           +
Sbjct: 187 S 187

>AAL032W [155] [Homologous to ScYHR071W (PCL5) - SH]
           complement(282832..283566) [735 bp, 244 aa]
          Length = 244

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 322 RLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVEELQRY 381
           R+ + ++ ++ KF  D  +S   ++ + G+  ++++ +E   L    +RL +S E+L R+
Sbjct: 120 RMFLCSLILAHKFTQDSTFSMKAWSTITGLPPKDISTMERWALNQLQYRLYVSAEDLDRW 179

Query: 382 A-DLLY 386
             D+L+
Sbjct: 180 TEDVLF 185

>AER440C [2940] [Homologous to ScYGL215W (CLG1) - SH]
           (1477945..1479291) [1347 bp, 448 aa]
          Length = 448

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 31/53 (58%)

Query: 320 IHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLI 372
           I++ ++ A  ++ KF  D  ++N  +++  G+ +  +N  E ++L + D+RL 
Sbjct: 225 IYQNLMVAFVLANKFNDDKTFTNRSWSQATGMKVDVINTYEREWLYIFDWRLF 277

>Scas_646.23
          Length = 238

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 36/65 (55%)

Query: 317 SHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVE 376
           +H+I R  +  + ++ KF +D  +S   ++ + G+  + ++ +E   L   +F+L +S E
Sbjct: 137 AHSIKRTFLNCLILAHKFSNDITFSMKTWSLITGLQPKNISTMERWCLKKLNFQLFVSNE 196

Query: 377 ELQRY 381
           +L  +
Sbjct: 197 QLLSW 201

>AEL195W [2311] [Homologous to ScYNL289W (PCL1) - SH]
           complement(266347..267060) [714 bp, 237 aa]
          Length = 237

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 321 HRLIIAAITVSTKFISDFFYSNSRYARV--GGISLQELNHLELQFLILCDFRLIISVEEL 378
           HR+ +A + +S KF +D    N  + +   G  + Q++N +E Q L L D+ + +   +L
Sbjct: 98  HRIFLACLILSAKFHNDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDL 157

Query: 379 QR 380
            R
Sbjct: 158 CR 159

>YJL109C (UTP10) [2806] chr10 complement(211917..217226) Component of
            U3 snoRNP (also called small subunit processome), which
            is required for 18S rRNA biogenesis [5310 bp, 1769 aa]
          Length = 1769

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 46/99 (46%), Gaps = 7/99 (7%)

Query: 263  TTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSHNIHR 322
            T  + LL+    F+++ +    I   Y   ++   D        +       M++ N+ R
Sbjct: 1567 TETERLLAFFKFFNKLQENLRGIITSYFTYLLEPVDMLLKRFISKD------MENVNLRR 1620

Query: 323  LIIAAITVSTKFISD-FFYSNSRYARVGGISLQELNHLE 360
            L+I ++T S KF  D ++ S SR+  +    + +L+++E
Sbjct: 1621 LVINSLTSSLKFDRDEYWKSTSRFELISVSLVNQLSNIE 1659

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,270,393
Number of extensions: 499065
Number of successful extensions: 2262
Number of sequences better than 10.0: 62
Number of HSP's gapped: 2261
Number of HSP's successfully gapped: 62
Length of query: 403
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 299
Effective length of database: 12,995,837
Effective search space: 3885755263
Effective search space used: 3885755263
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)