Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C08283g51951122760.0
Sklu_1893.251351117550.0
Kwal_23.581951650916040.0
CAGL0L00671g54352314970.0
YER056C (FCY2)53347014770.0
YER060W (FCY21)52846914620.0
Scas_704.3654546914630.0
Scas_715.4953246914410.0
Scas_715.47d53352514290.0
ADL074W52446814270.0
YER060W-A (FCY22)53047014090.0
Kwal_34.1573051850914060.0
CAGL0J02948g51550813780.0
CAGL0C00231g54050012071e-161
Scas_715.47d152347011881e-159
Scas_715.54d2321864921e-58
Kwal_47.172165425064345e-47
KLLA0D05060g5234994301e-46
YGL186C (TPN1)5795663627e-37
Scas_710.305844473485e-35
CAGL0L06138g6314303362e-33
Scas_701.168601846e-17
Scas_690.1*636601987e-16
AGR008W51455692.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C08283g
         (511 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   881   0.0  
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           680   0.0  
Kwal_23.5819                                                          622   0.0  
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   581   0.0  
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   573   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   567   0.0  
Scas_704.36                                                           568   0.0  
Scas_715.49                                                           559   0.0  
Scas_715.47d                                                          555   0.0  
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   554   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   547   0.0  
Kwal_34.15730                                                         546   0.0  
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   535   0.0  
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   469   e-161
Scas_715.47d1                                                         462   e-159
Scas_715.54d                                                          194   1e-58
Kwal_47.17216                                                         171   5e-47
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   170   1e-46
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   144   7e-37
Scas_710.30                                                           138   5e-35
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   134   2e-33
Scas_701.1                                                             75   6e-17
Scas_690.1*                                                            81   7e-16
AGR008W [4318] [Homologous to ScYFR006W - SH] complement(732850....    31   2.1  

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/511 (87%), Positives = 445/511 (87%)

Query: 1   MSSSSSKEEYVLHDVEKQELSKTQFDXXXXXXXXXXXXXXXXKLSWVDHLASKLHAETKG 60
           MSSSSSKEEYVLHDVEKQELSKTQFD                KLSWVDHLASKLHAETKG
Sbjct: 1   MSSSSSKEEYVLHDVEKQELSKTQFDEVLEEEPVIVETTEVTKLSWVDHLASKLHAETKG 60

Query: 61  IEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGL 120
           IEPIT        ILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGL
Sbjct: 61  IEPITDDEKDDDDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGL 120

Query: 121 LPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVN 180
           LPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVN
Sbjct: 121 LPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVN 180

Query: 181 PSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVIIARLAKXXXXXX 240
           PSGPDCPPWAGCL             YRVIHAYEKWSWVPNFAVFLVIIARLAK      
Sbjct: 181 PSGPDCPPWAGCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLAKAGTFTA 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLC 300
                                  ATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLC
Sbjct: 241 GSWGSGSTTAGGVLSFGSSVFGFATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLC 300

Query: 301 FSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNN 360
           FSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNN
Sbjct: 301 FSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNN 360

Query: 361 IPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYL 420
           IPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYL
Sbjct: 361 IPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYL 420

Query: 421 AIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQG 480
           AIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQG
Sbjct: 421 AIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQG 480

Query: 481 QIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
           QIGRLIGENGGDIGFELGAGFAFITYNIFRP
Sbjct: 481 QIGRLIGENGGDIGFELGAGFAFITYNIFRP 511

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/511 (66%), Positives = 391/511 (76%), Gaps = 10/511 (1%)

Query: 4   SSSKEEYVLHDVEKQ---ELSKTQFDXXXXXXXXXXXXXXXXKLSWVDHLASKLHAETKG 60
           SSSKEEY + D+EKQ   EL++T                    +S++D  A+KL AETKG
Sbjct: 2   SSSKEEYAIQDMEKQNPLELTETD-------STPVVESTEYTTVSFIDRWAAKLKAETKG 54

Query: 61  IEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGL 120
           IEPIT        ILNAASMW SAN+VIAA++LG +GT VFGLNF E+VL I+FFSFLGL
Sbjct: 55  IEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGL 114

Query: 121 LPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVN 180
           +PVAFFSVFGAELG+RQ+VLSRFL+GNVTARIF  IN+IACVGWGAVNTIASASLLH++N
Sbjct: 115 IPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMIN 174

Query: 181 PSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVIIARLAKXXXXXX 240
           P G  CPPWA CL             YRVIHAYEKWSWVPNFAVFLVIIARL        
Sbjct: 175 PGGAQCPPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFST 234

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLC 300
                                  A+GWTTYA+DYTVYMPR+TNK K+F A+V GLAFPLC
Sbjct: 235 GEWTSGATTAGGVLSFGGSIFGFASGWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLC 294

Query: 301 FSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNN 360
           FS+ILGAA++ G   N  W + Y+ +SVGGL YAIL++DSL GFG FCCV+LA+ST++NN
Sbjct: 295 FSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANN 354

Query: 361 IPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYL 420
           IPNMYSIALGTQ+++EPLAKVPRV WTI GNLVTLAIAIPAYYKFE+FM++FM++I YYL
Sbjct: 355 IPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEAIAYYL 414

Query: 421 AIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQG 480
           AIY AI+LSEHF YR GFKGYNVDDW+RWD+LPIGYAG  ALFIGAFGVAFGM+Q YW+G
Sbjct: 415 AIYIAISLSEHFFYRKGFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEG 474

Query: 481 QIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
           QI R IGE GGDIGFELG GF+FITYNI RP
Sbjct: 475 QIARHIGEYGGDIGFELGMGFSFITYNILRP 505

>Kwal_23.5819
          Length = 516

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/509 (61%), Positives = 365/509 (71%), Gaps = 3/509 (0%)

Query: 4   SSSKEEYVLHDVEKQELSKTQFDXXXXXXXXXXXXXXXXKLSWVDHLASKLHAETKGIEP 63
           S  KEEY + DVEK+    ++F+                KLS VD +A+ L AETKGIEP
Sbjct: 2   SLQKEEYEIQDVEKR--LNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEP 59

Query: 64  ITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPV 123
           +T        I NAASMW SAN+VIAAFSLG +G  V+GLNF   VL +V FS LG++PV
Sbjct: 60  VTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPV 119

Query: 124 AFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSG 183
           A++SVFGAELGLRQ+VLSRFLLGNVTARIF  INIIACVGWGAVNTIASA LLH++NP G
Sbjct: 120 AYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGG 179

Query: 184 PDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVIIARLAKXXXXXXXXX 243
             CPPWAGCL             YRVIHAYEKWSW+PNFAVFLVIIARL           
Sbjct: 180 ARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEW 239

Query: 244 XXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSM 303
                               A+GWTTYA+DYTVYMPRTTNK KVF A++ GL FPLCFS+
Sbjct: 240 ISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSI 299

Query: 304 ILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNIPN 363
           ILGAAA   ++ N  +A L+D   VGGL YAIL+ +SL GFG FCCV+LA+ST++NNIPN
Sbjct: 300 ILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPN 359

Query: 364 MYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIY 423
           MYSIALGTQAL+EPLAK+PRV WT+ GNLVTLAIAIPAYYKF +FMT FMD+I YYL+IY
Sbjct: 360 MYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIY 419

Query: 424 SAIALSEHFIYRG-GFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQI 482
             I+LSEH  +R   F+ YNVDDW++WDKLPIGYAG  ALF+GA GVA GM Q YW GQI
Sbjct: 420 IGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYAGCCALFVGAVGVAVGMEQTYWTGQI 479

Query: 483 GRLIGENGGDIGFELGAGFAFITYNIFRP 511
            R IG+ G DIGFE+G  F+ I YNI RP
Sbjct: 480 ARKIGDYGADIGFEIGFCFSVIVYNILRP 508

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/523 (55%), Positives = 353/523 (67%), Gaps = 13/523 (2%)

Query: 2   SSSSSKEEYVLHDVEKQELSKTQF-------------DXXXXXXXXXXXXXXXXKLSWVD 48
           S  S   +Y L++VEKQ +   +              D                KL ++ 
Sbjct: 13  SDGSHSNDYELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETKLKLGFIS 72

Query: 49  HLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEA 108
            LA K++AETKG+EP+T        +LNAASMW SANLV+A+++LG +G  VF LNFG +
Sbjct: 73  RLALKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTS 132

Query: 109 VLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVN 168
           VL IVFF+ +GL+ VAFFSVFGAE GLRQ++LSRFL+GNVTAR+F  IN++ACVGWG VN
Sbjct: 133 VLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVN 192

Query: 169 TIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVI 228
           T+ +A LLHIVN      P W GCL             Y +IHAYE+WSWVPNFAVFLVI
Sbjct: 193 TVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVI 252

Query: 229 IARLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKVF 288
           IARL K                             A GWTTYA+DYTVYMPRT NK K+F
Sbjct: 253 IARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIF 312

Query: 289 AAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFC 348
             +  GLAFPL F+MILGAA+  G   N  W  LYDK ++GGL YAIL+ +SL GFG FC
Sbjct: 313 FFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFC 372

Query: 349 CVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETF 408
           CV+LA+STI+NNIPNMY+IAL  QAL+EP ++VPRV WT+ GN   + I+IPA Y FE F
Sbjct: 373 CVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGF 432

Query: 409 MTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFG 468
           +  FMDSIGYYLAIY AI+LSEHFIYR GFKGYN++DW+ WD+LPIG AG  ALF+GAFG
Sbjct: 433 LENFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFG 492

Query: 469 VAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
           VA GM+Q YW G+I R IG++GGDIGFELG  +AFI +NI RP
Sbjct: 493 VALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRP 535

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/470 (61%), Positives = 342/470 (72%), Gaps = 1/470 (0%)

Query: 43  KLSWVDHLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFG 102
           KLSW     + L+AETKG+EP+T        ILNAASMW SAN+VIA+++LG +G  VFG
Sbjct: 56  KLSWFHKFFASLNAETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFG 115

Query: 103 LNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACV 162
           LNFG++VLVI+FF+ +GL+ VAFFSVFGAELGLRQ++LSR+L+GNVTARIF  IN+IACV
Sbjct: 116 LNFGQSVLVIIFFNIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACV 175

Query: 163 GWGAVNTIASASLLHIVNP-SGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPN 221
           GWG VNT  SA LL++VN  SG  CP WAGCL             Y VIHAYEKWSWVPN
Sbjct: 176 GWGIVNTSVSAQLLNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPN 235

Query: 222 FAVFLVIIARLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRT 281
           FAVFLVIIA+L++                             A GWTTYA+DYTVYMP++
Sbjct: 236 FAVFLVIIAQLSRSGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKS 295

Query: 282 TNKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSL 341
           TNK K+F ++V GLAFPL F+MILGAA+      +  W   YDK ++GG+ YAIL+ +SL
Sbjct: 296 TNKYKIFFSLVAGLAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSL 355

Query: 342 WGFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPA 401
            GFG FCCV+LALSTI+NNIPNMY++AL  QAL+ PLAK+PRV WT+ GN  TL I+IPA
Sbjct: 356 NGFGQFCCVLLALSTIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPA 415

Query: 402 YYKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFA 461
            Y F+ FM  FMDSIGYYLAIY AI+ SEHF YR  F  YN+DDWD W+ LPIG AGT A
Sbjct: 416 TYYFDGFMENFMDSIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAA 475

Query: 462 LFIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
           L +GAFGVA GM Q YW G+IGRLIG+ GGDIGFELGA +AFI YNI RP
Sbjct: 476 LIVGAFGVALGMCQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILRP 525

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/469 (60%), Positives = 341/469 (72%), Gaps = 1/469 (0%)

Query: 43  KLSWVDHLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFG 102
           KLS+++ +A+ L AETKGIEPIT        ILNAASMW SAN+V+ A+++G +G  VF 
Sbjct: 53  KLSFLNRIAAGLSAETKGIEPITEDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFD 112

Query: 103 LNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACV 162
           LNFG++V VI+FF+ LGL+ VAFFSVFGAELGLRQ++LSR+L+GN+ ARIF FIN IAC+
Sbjct: 113 LNFGQSVFVIIFFNLLGLVSVAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACI 172

Query: 163 GWGAVNTIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNF 222
           GWG VNT+AS+ +L++VNP G  CP WAGC+             Y VIHAYEKW+WVPNF
Sbjct: 173 GWGIVNTVASSQVLNMVNP-GHQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNF 231

Query: 223 AVFLVIIARLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTT 282
           AVFLVIIARLA+                             A GWTTYA+DYTVYMPR T
Sbjct: 232 AVFLVIIARLARSKKFVLGEWTSGPTTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKT 291

Query: 283 NKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLW 342
           NK K+F ++V+GLA PL F+MILGAA       +  W   YD+ S+GGL +A+L+ +S+ 
Sbjct: 292 NKYKIFFSLVVGLATPLYFTMILGAAVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVH 351

Query: 343 GFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAY 402
           GFG FCCV+L+LSTI+NN+PNMY+IAL  QA +EPLAKVPRV WT++GN   L IAIPA 
Sbjct: 352 GFGQFCCVLLSLSTIANNVPNMYTIALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPAC 411

Query: 403 YKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFAL 462
           Y F TFM  FMDSIGYYLAIY AIA SEHFIYR  F  YNVDDWD W++LPIG AGT AL
Sbjct: 412 YYFSTFMNYFMDSIGYYLAIYIAIACSEHFIYRRSFSAYNVDDWDSWERLPIGIAGTAAL 471

Query: 463 FIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
            +GAFGVA GM Q YW G+I RLIG+ GGDIGFELG  +AFI YNI RP
Sbjct: 472 IVGAFGVALGMCQTYWVGEISRLIGDYGGDIGFELGLSWAFIVYNIARP 520

>Scas_704.36
          Length = 545

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/469 (60%), Positives = 341/469 (72%), Gaps = 1/469 (0%)

Query: 43  KLSWVDHLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFG 102
           KLS+ +   + L+AETKG+EP+T        I+NAASMW SANLVIA+++LG +G  VF 
Sbjct: 70  KLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFN 129

Query: 103 LNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACV 162
           LNFG +VLVI+FF+ LGLL +AFFSVFGAE GLRQ++LSR+LLGN+TARIF  INIIACV
Sbjct: 130 LNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNITARIFAIINIIACV 189

Query: 163 GWGAVNTIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNF 222
           GWG VNT+AS+ LL++VN    +CP WAGCL             Y VIHAYEKWSWVPNF
Sbjct: 190 GWGVVNTVASSQLLNMVNTPN-NCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNF 248

Query: 223 AVFLVIIARLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTT 282
           AVFLVIIARL                               A GWTTYA+DYTVYMPR+T
Sbjct: 249 AVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSFGGAVFGFAAGWTTYAADYTVYMPRST 308

Query: 283 NKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLW 342
           NK  +F ++  GL+ PL F+MILGAA+  G   N  W   Y    +GG+ YAIL+ DSL 
Sbjct: 309 NKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLH 368

Query: 343 GFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAY 402
           GFG FCCV+LA+ST++NNIPNMY+IAL  QAL++P +KVPRVAWT+ GN  TL I+I A 
Sbjct: 369 GFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAAC 428

Query: 403 YKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFAL 462
           Y F+ FM  FM+SIGYYLAIY AI+LSEHFIYR GF+GYNV+DW+ W KLPIG AGT AL
Sbjct: 429 YYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSAL 488

Query: 463 FIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
            +GAFGVA GM+Q YW G+IG+LIG++GGDIGFELGA +AFI YN+ RP
Sbjct: 489 IVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRP 537

>Scas_715.49
          Length = 532

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/469 (60%), Positives = 336/469 (71%)

Query: 43  KLSWVDHLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFG 102
           KL+  + +A+ L AETKGIEPIT        +LNAASMW SAN+VIAA+++G +G  VFG
Sbjct: 56  KLNLFNRIAAGLSAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFG 115

Query: 103 LNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACV 162
           LNFG + LVI+FF+ LGLLPVAFFS+FGA+LGLRQ+VLSRFL+GN TARIF  IN +ACV
Sbjct: 116 LNFGTSTLVIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACV 175

Query: 163 GWGAVNTIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNF 222
           GWG VNT+AS+ LL++VN     CP WAGC+             YRVIH++EKW WVPNF
Sbjct: 176 GWGIVNTVASSQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNF 235

Query: 223 AVFLVIIARLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTT 282
           A FLVIIARLAK                             ATGWTTYA+DYTVYMPR T
Sbjct: 236 ACFLVIIARLAKSGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNT 295

Query: 283 NKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLW 342
           NK K+F ++V GL+FPL F MILGAA+  G   N  WA  Y +  +GGL YAIL+ +SL 
Sbjct: 296 NKFKIFFSLVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLH 355

Query: 343 GFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAY 402
           GFG FCCVVL++S ++NN+PNMY+IAL  QA++ PLAK+PRV WT+ GN  TL IAIPA 
Sbjct: 356 GFGEFCCVVLSISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPAC 415

Query: 403 YKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFAL 462
           Y F+TFM  FMDSI YYLAIY +IALSEHFIYR  F+ YNV+DWD   KLPIG AG  A 
Sbjct: 416 YFFDTFMEYFMDSIAYYLAIYISIALSEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAF 475

Query: 463 FIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
            +G  GVA GM Q YW GQIGRLIGE GGD+GFELGAG++FI YN+ RP
Sbjct: 476 GVGVIGVALGMCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRP 524

>Scas_715.47d
          Length = 533

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/525 (55%), Positives = 347/525 (66%), Gaps = 14/525 (2%)

Query: 1   MSSSSSKEEYVLHDVEKQELSKTQFD--------------XXXXXXXXXXXXXXXXKLSW 46
           MSS S K  Y + D+E      ++F                               K S+
Sbjct: 1   MSSLSDKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSF 60

Query: 47  VDHLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFGLNFG 106
            + LAS+L+AETKGIE IT        IL+A SMW SAN+VI+A++LG IG  V+GLNFG
Sbjct: 61  FNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFG 120

Query: 107 EAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGA 166
             VL I+FFS LGLLPVAFFS+FGA+ GLRQ+VLSRFL+GN TARI   IN+I+ VGWG 
Sbjct: 121 TCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGV 180

Query: 167 VNTIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFL 226
           VN++AS+ LL++VN     CP WAGC+             Y  IHAYE+WSWVPNFAVFL
Sbjct: 181 VNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFL 240

Query: 227 VIIARLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTTNKKK 286
           VIIARL                               ATGWT YA+DYTVYMPR TNK K
Sbjct: 241 VIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFK 300

Query: 287 VFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGS 346
           +F ++V GL+FPL F +ILGAA+  G   N  W + Y    +GG+ YAIL+ DSL GFG 
Sbjct: 301 IFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGE 360

Query: 347 FCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFE 406
           FCCV+LALSTI+NNIPNMYSI L  QA++EPLAKVPR  WT+ GN  TLAI+IPA Y F+
Sbjct: 361 FCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFD 420

Query: 407 TFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGA 466
            FM  FM+SIGYYLAIYSA AL+EHFI+R GFKGYNV+DWD   KLP+G AG  ALF+GA
Sbjct: 421 GFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAALFVGA 480

Query: 467 FGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
           FGVA GM+Q YW G+I R IGE GGDIGFELGAG+AF+ Y I RP
Sbjct: 481 FGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRP 525

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/468 (58%), Positives = 335/468 (71%), Gaps = 3/468 (0%)

Query: 44  LSWVDHLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFGL 103
           LSWV+  A++L+AETKG+ P+T        +LNAASMW SANLVIAAF++G + T+VF L
Sbjct: 52  LSWVNRWAARLNAETKGVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRL 111

Query: 104 NFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVG 163
           N  EAVL  V FSF+G+L VAFFSVFGAE GLRQ++LSR+L+GN TARIFC IN+IACVG
Sbjct: 112 NMLEAVLATVVFSFMGVLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVG 171

Query: 164 WGAVNTIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFA 223
           W +VNTIAS +LLH++NP+G  CPPWA  L             YRVIHAYEKWSWVPN  
Sbjct: 172 WSSVNTIASTTLLHMINPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLV 231

Query: 224 VFLVIIARLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTTN 283
           VFL+IIARLA                              A+GWTTYA+DYTVYMP+ +N
Sbjct: 232 VFLIIIARLAIAGNFTAGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSN 291

Query: 284 KKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWG 343
           K ++F  ++ GLA PL F++ILGAAA     TN  W E Y K+SVGGLC+AIL E++L G
Sbjct: 292 KYRIFFFMIAGLATPLLFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGG 351

Query: 344 FGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYY 403
           FG FCCVVLA+ST++NNIPNMYSIAL TQAL+   A+VPRV WT++GN  +L IAI AYY
Sbjct: 352 FGQFCCVVLAMSTVANNIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYY 411

Query: 404 KFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFALF 463
           KFETFMT+FMDSIGYYL+IY  I ++EHF++R GF+GY+V  WDR D LP GYAG  AL 
Sbjct: 412 KFETFMTSFMDSIGYYLSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLPAGYAGCAALC 471

Query: 464 IGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
           +GA GVA GM+  Y+ G I +L    GGDIGF L AGF+FI Y   RP
Sbjct: 472 VGAVGVAMGMSHEYYTGPIAKL---AGGDIGFLLAAGFSFIVYICCRP 516

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/470 (58%), Positives = 333/470 (70%), Gaps = 1/470 (0%)

Query: 43  KLSWVDHLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFG 102
           K S+ + +A+ L+AETKGIEP+T        ILNAA++W SAN+VI A+S+G +G  VFG
Sbjct: 53  KPSFFNRIAAALNAETKGIEPVTEDEKNDDSILNAATIWFSANMVIVAYSVGALGPLVFG 112

Query: 103 LNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACV 162
           LNFG++VLVI+FF+ LGL+PVA FS+FG ELGLRQ++LSR+L GN+TAR F  +N+IACV
Sbjct: 113 LNFGQSVLVIIFFNILGLIPVALFSLFGVELGLRQMILSRYLAGNITARFFSLVNVIACV 172

Query: 163 GWGAVNTIASASLLHIVNP-SGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPN 221
           GW  +N   SA LL++VN  SG +CP WAGCL             Y V+HAYEKWSWVPN
Sbjct: 173 GWCVLNISVSAQLLNMVNEGSGHNCPIWAGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPN 232

Query: 222 FAVFLVIIARLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRT 281
           FA FLVIIA+L++                             A GW TYA+DYTVYMP+T
Sbjct: 233 FAAFLVIIAQLSRSGKFKGGEWVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKT 292

Query: 282 TNKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSL 341
           T+K K+F ++V GLAFPL F+MILGAA       +  W   YDK ++GG+ YAIL+ +SL
Sbjct: 293 TSKYKIFFSVVAGLAFPLFFTMILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPNSL 352

Query: 342 WGFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPA 401
            GFG FCCV+LALST++NN+P MY++AL  QAL+ PLAK+PRV WT+ GN  TL I+IPA
Sbjct: 353 NGFGQFCCVLLALSTVANNVPGMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPA 412

Query: 402 YYKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWDKLPIGYAGTFA 461
            Y F+ FM  FMDSIGYYLAIY AIA SEHFIYR  F  YN+DDWD W+ LPIG AGT A
Sbjct: 413 TYYFDGFMENFMDSIGYYLAIYIAIACSEHFIYRRSFSAYNIDDWDNWEHLPIGIAGTAA 472

Query: 462 LFIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
           L  GAFGVA GM Q YW G+I RLIGE GGDIGFELG  +AFI YNI RP
Sbjct: 473 LIAGAFGVALGMCQTYWVGEISRLIGEYGGDIGFELGGSWAFIIYNIVRP 522

>Kwal_34.15730
          Length = 518

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/509 (55%), Positives = 346/509 (67%), Gaps = 3/509 (0%)

Query: 6   SKEEYVLHDVEKQELSK--TQFDXXXXXXXXXXXXXXXXKLSWVDHLASKLHAETKGIEP 63
           +K++Y + D+E    S+  T  D                 ++ ++ LA KL AETKGIEP
Sbjct: 2   AKDKYEVQDLELNVYSQENTSADDATRGSSQAPEKLNGGGMAVLNRLAKKLRAETKGIEP 61

Query: 64  ITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPV 123
           +T        I NAA +W SAN+VIAAFS+G +G  VF LNF   V+ IV F+F+G+LPV
Sbjct: 62  VTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSIVIFTFIGVLPV 121

Query: 124 AFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSG 183
             +SVFG +L LRQ+VLSRFLLGNVTARIF  IN+IAC+GWG VNT+ SA LLH++NP+G
Sbjct: 122 CLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTSAQLLHMINPTG 181

Query: 184 PDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVIIARLAKXXXXXXXXX 243
             CPPWAGCL             YRVIH + K+SW+PNF VF+VIIARL           
Sbjct: 182 GRCPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIARLKIDGSFSVGKW 241

Query: 244 XXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSM 303
                               ATGWTTYA+D+TVYMPRT N+ +VF A++LGL FPLCF++
Sbjct: 242 ESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAVMLGLVFPLCFTI 301

Query: 304 ILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNIPN 363
           ILGAAA      N  + E Y+    GGL YAIL+  SL GFG FCCV+LA+ST++N +PN
Sbjct: 302 ILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVLLAMSTVANMVPN 361

Query: 364 MYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIY 423
           MYSIALGTQAL+EPLAKVPRV WT+ GNL+TLAIAIPAYY+FE FMT FMDSI YYL+IY
Sbjct: 362 MYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTNFMDSIAYYLSIY 421

Query: 424 SAIALSEHFIYR-GGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQI 482
             ++LSEHFI+R   F  Y+  +W+ W +LP+GYAG  ALF+GA GVA GM+Q YW G+I
Sbjct: 422 IGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVALGMHQTYWTGEI 481

Query: 483 GRLIGENGGDIGFELGAGFAFITYNIFRP 511
           GRLIGE GGDIGFELG  F+ I Y   RP
Sbjct: 482 GRLIGEFGGDIGFELGLAFSMIVYTALRP 510

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/508 (54%), Positives = 340/508 (66%), Gaps = 3/508 (0%)

Query: 5   SSKEEYVLHDVEKQELSKTQFDXXXXXXXXXXXXXXXXKLSWVDHLASKLHAETKGIEPI 64
           S +++  L+D+E Q  S    +                KLS ++ LA+ + AETKGIEPI
Sbjct: 2   SYEDKKDLYDMEMQVESSA--NSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPI 59

Query: 65  TXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPVA 124
           T        ++NAASMW SAN+V+ A ++G +G  VFGLNFG +VL IVFF+ LGL  VA
Sbjct: 60  TDDEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNILGLFAVA 119

Query: 125 FFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSGP 184
           FFSVFGA+ GLRQ+VLSR+L+GN+TARIF  IN +ACVGWG VNT+A++ LL+ +NP   
Sbjct: 120 FFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSH 179

Query: 185 DCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVIIARLAKXXXXXXXXXX 244
             P W GCL             Y+VIH YEK+SWVPNFAVFLV+IARL            
Sbjct: 180 QLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWG 239

Query: 245 XXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSMI 304
                              A+GWTTYA+DYTVYMPR TN  K+F A+V GLAFPL F+MI
Sbjct: 240 SGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMI 299

Query: 305 LGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNIPNM 364
           LG+A          W E Y+K  +GGL +AIL+ DSL GFG FCCVVLA+STI+NN+PNM
Sbjct: 300 LGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNM 359

Query: 365 YSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIYS 424
           Y+IAL  Q++++P AK+PRV WT+IGNL  L I+IPA Y F TFM  FMDSI YYL+IY 
Sbjct: 360 YTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDSIAYYLSIYI 419

Query: 425 AIALSEHFIYR-GGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQIG 483
           +IAL EH IYR   F  YNV+DW+ + KLPIG AGT +L +GAFGVA GM+Q YW G+I 
Sbjct: 420 SIALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIA 479

Query: 484 RLIGENGGDIGFELGAGFAFITYNIFRP 511
           R IGE GGDI  ELGAG+AFI YNI RP
Sbjct: 480 RHIGEYGGDIAIELGAGWAFIAYNICRP 507

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  469 bits (1207), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 239/500 (47%), Positives = 320/500 (64%), Gaps = 1/500 (0%)

Query: 13  HDVEKQELS-KTQFDXXXXXXXXXXXXXXXXKLSWVDHLASKLHAETKGIEPITXXXXXX 71
            D+E ++++ K +F+                K  ++  L   L+AETKG+EPI       
Sbjct: 33  EDLELKDITFKEKFNELDNKSTETDKDETCFKSPFIIWLKRTLNAETKGVEPINENEKND 92

Query: 72  XXILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPVAFFSVFGA 131
             I  ++ +W SANLV+AA+ +G +G +V+ LNF  +VL IVFF+ LGL+ V+FFSVFGA
Sbjct: 93  TNIFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFNILGLVSVSFFSVFGA 152

Query: 132 ELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSGPDCPPWAG 191
           ELGLRQ+++SR+L+GNVTARIF  +N I CVGW  +N   +A L  I+   G   P W G
Sbjct: 153 ELGLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLFAIIKTGGNHLPLWGG 212

Query: 192 CLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVIIARLAKXXXXXXXXXXXXXXXXX 251
           C+             Y+ IH YEKWSW+PN AVFL+II+R+                   
Sbjct: 213 CIVIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFLIIISRIKISREFSNGPWTSGSTTAG 272

Query: 252 XXXXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSMILGAAAVT 311
                       A GW TY++DYTVYMPR TNK ++F    +GLAF L F+MI+GAAA  
Sbjct: 273 NVLSFGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFFNSIGLAFSLIFTMIVGAAAGI 332

Query: 312 GTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNIPNMYSIALGT 371
               N +W ELY+++ +GG+ YA+L+ +SL GFG FCCV+LA+ST++NN+P+MY+IAL  
Sbjct: 333 CAVNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCVILAMSTVANNVPSMYTIALSV 392

Query: 372 QALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIYSAIALSEH 431
           QAL+EPL  VPR  WTI  N+V L I+IPA Y F++FM  FM SIGY+ A+Y  I+L+EH
Sbjct: 393 QALWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQNFMGSIGYFYALYIGISLAEH 452

Query: 432 FIYRGGFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGRLIGENGG 491
            ++R  F  YNV+D   W+KLPIG+AG  AL +G+FGVA GM Q YW G+I R IG  GG
Sbjct: 453 CVFRRKFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVALGMAQTYWVGEIARKIGTYGG 512

Query: 492 DIGFELGAGFAFITYNIFRP 511
           DIGFELG  +AF+TY I RP
Sbjct: 513 DIGFELGMSWAFLTYIIIRP 532

>Scas_715.47d1
          Length = 523

 Score =  462 bits (1188), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 229/470 (48%), Positives = 303/470 (64%), Gaps = 1/470 (0%)

Query: 43  KLSWVDHLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFG 102
            ++++  +A++L+AET+GIEP+         I N   +W SAN VI+A+++G +G  VFG
Sbjct: 46  NIAFLQKIATRLNAETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFG 105

Query: 103 LNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACV 162
           LNFG   L IVFF+ +G++PVA+FS+FG ELGLRQ+VLSR+L+GN+  R F FIN IACV
Sbjct: 106 LNFGITSLTIVFFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACV 165

Query: 163 GWGAVNTIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNF 222
           GW  +N+I SA LL++VN  G  CP WAG +              +VI A+E+WSWVPN 
Sbjct: 166 GWCVLNSICSAQLLNMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNL 225

Query: 223 AVFLVIIARLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMPRTT 282
           AVFLVIIARL K                             A  W TY++DYTVYMPR T
Sbjct: 226 AVFLVIIARLHKSGQFSGGKWTSGPTTAGNVLSLGCVAYGYAGAWATYSADYTVYMPRNT 285

Query: 283 NKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLW 342
           NK K+F  + + L  PLCF+MILGAA   G   N  WA+ Y    +GGL Y +L+ +S+ 
Sbjct: 286 NKVKLFFGLCVALTVPLCFTMILGAAVGMGGVNNATWAKYYSSNGIGGLTYEVLVPNSVH 345

Query: 343 GFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAY 402
           GFG FCCV+LALSTI+NN PNMY++    QA++EPLA+VPR   T+ GN     +   A 
Sbjct: 346 GFGEFCCVLLALSTIANNTPNMYTLGFSFQAIWEPLARVPRAFCTLFGNAAVFVVGCCAC 405

Query: 403 YKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRG-GFKGYNVDDWDRWDKLPIGYAGTFA 461
           Y F++FM  FMD++ YY AIY ++ ++EH I+R   FK Y+V DW  + KLPIG AG   
Sbjct: 406 YYFDSFMEKFMDTLAYYGAIYISLGMAEHLIFRKCSFKAYDVKDWKTFSKLPIGIAGGVG 465

Query: 462 LFIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
            F+ AFGVA GM Q YW G+IGR IG++GGD+GFE+GA + FI Y + RP
Sbjct: 466 FFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 515

>Scas_715.54d
          Length = 232

 Score =  194 bits (492), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 128/186 (68%)

Query: 43  KLSWVDHLASKLHAETKGIEPITXXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFG 102
            ++++  +A++L+AET+GIEP+         I N   +W SAN VI+A+++G +G  VFG
Sbjct: 47  NIAFLQKIATRLNAETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFG 106

Query: 103 LNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACV 162
           LNFG   L IVFF+ +G++PVA+FS+FG ELGLRQ+VLSR+L+GN+  R F FIN IACV
Sbjct: 107 LNFGITSLTIVFFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACV 166

Query: 163 GWGAVNTIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNF 222
           GW  +N+I SA LL++VN  G  CP WAG +              +VI A+E+WSWVPN 
Sbjct: 167 GWCVLNSICSAQLLNMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNL 226

Query: 223 AVFLVI 228
           AVFLVI
Sbjct: 227 AVFLVI 232

>Kwal_47.17216
          Length = 542

 Score =  171 bits (434), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 139/506 (27%), Positives = 204/506 (40%), Gaps = 42/506 (8%)

Query: 43  KLSWVDHLASKLHAETKGIEPITXXXX-XXXXILNAASMWLSANLVIAAFSLGCIGTSVF 101
           KLS        L  E +GI+ I           L+ A +WLSA   +++ S   +G  +F
Sbjct: 32  KLSVASKRLDALGVEIRGIQRIPAYERGTSKQFLSVAGLWLSAAGGLSSMSSYFLGPLLF 91

Query: 102 GLNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIAC 161
            L F ++++  +    +G    A+ S  G + G RQ+V +R+L G    +     +II  
Sbjct: 92  ELTFRQSLVSGLVSMAIGCAVAAYLSTMGPQSGCRQMVTARYLFGWYFVKFVSLASIIGV 151

Query: 162 VGWGAVNTIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPN 221
           +GW  VN +    +L  ++ S    P W G +              + +   E +  VP 
Sbjct: 152 MGWSIVNCVVGGQMLAAISNS--KIPLWVGIIIVTAVSFIVAIFGIKQVLRVETFLSVPV 209

Query: 222 FAVFLVI-IARLAKXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXATGWTTYASDYTVYM 278
              FL++ IA   K                                + W +  +DY +  
Sbjct: 210 LTCFLLLYIAASDKYYLLDTFKNDDIDPLTIKGNWLSFFSLCYSITSTWGSITADYYILF 269

Query: 279 PRTTNKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIE 338
           P  T   KVF     G   P  F  +LG    +   + E W   Y KY +GGL ++    
Sbjct: 270 PEDTAHYKVFLLTFFGTLIPTTFVGVLGLILASCAASYEPWKAAYHKYGMGGLLFSGF-- 327

Query: 339 DSLWGFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIA 398
           +   GFG FC VVL  S ISNNI N YS A   Q     +A+VPR  W I   +  L  A
Sbjct: 328 ERWNGFGKFCVVVLIFSLISNNIINTYSAAFNIQLSSVHMARVPRWLWAIACTIFYLVCA 387

Query: 399 IPAYYKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFK------------------- 439
           +     F   +  F+  IGY++++Y  I L E+ I+R  F+                   
Sbjct: 388 LVGRNHFSEILGNFLPMIGYWISMYFIILLEENLIFRSHFRHLYTEEFPPHPVEEGESPR 447

Query: 440 ---------------GYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGR 484
                           YN + W+  + L  GYA TFA  +G  GVA  M Q YW G I R
Sbjct: 448 ALRDIKNKKVSSRKHAYNWEMWNNAEVLTHGYAATFAFLVGVGGVALSMAQAYWIGPIAR 507

Query: 485 LIGENGGDIGFELGAGFAFITYNIFR 510
             G+ GGD+G  +  GF+   Y   R
Sbjct: 508 HFGDFGGDLGMWVSMGFSGTVYPALR 533

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  170 bits (430), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 142/499 (28%), Positives = 207/499 (41%), Gaps = 40/499 (8%)

Query: 47  VDHLASKLHA---ETKGIEPITXXXX-XXXXILNAASMWLSANLVIAAFSLGCIGTSVFG 102
           +   + KL A   E +GI+ I            + A +WLSA   +++ S   +G  VF 
Sbjct: 21  IRQFSDKLDALGVEARGIQRIQPYERGTAKQFWHVAGLWLSAAGGLSSMSSYFLGPMVFQ 80

Query: 103 LNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACV 162
           L F + ++  +   ++G    A+ SV G + G RQ+V +R+L G    +      I+  +
Sbjct: 81  LTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTARYLFGWWFVKFIALAAIVGVM 140

Query: 163 GWGAVNTIASASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNF 222
           GW  VN +    +L  V  S    P W G +              + +   E    VP  
Sbjct: 141 GWSIVNCVVGGQMLASV--SDGKVPLWVGIIIVTVVSLLVSIFGIKQVLKVETLFAVPVL 198

Query: 223 AVFLVIIARLA---KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGWTTYASDYTVYMP 279
             FL++    +   K                              + W +  +DY +  P
Sbjct: 199 TSFLLLYISASDKFKYLYEFSNSDIDSLTVKGCWLSFFSLCYSITSTWGSITADYYILFP 258

Query: 280 RTTNKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIED 339
             T + +VF     G A P  F  +LG    + + + E W   YD+Y +GGL  A     
Sbjct: 259 EDTPQIQVFLLTFFGTAVPTTFVGVLGLLLASCSLSYEPWQAAYDEYGMGGLMNAGF--- 315

Query: 340 SLW-GFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIA 398
           S W GFG F  VVL LS ISNNI N YS A   Q     LAKVPR  W I   +  L  A
Sbjct: 316 SRWNGFGKFLVVVLILSLISNNIVNTYSAAFSIQLSSVMLAKVPRWIWAIGCTIFYLVCA 375

Query: 399 IPAYYKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKG------------------ 440
           +     F T +  F+  IGY++++Y  + + E+ I+R  F                    
Sbjct: 376 LVGRNSFSTILGNFLPMIGYWISMYFILLVEENVIFRNWFHHLYKLEFPNDIEVKPHHKL 435

Query: 441 ---------YNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGRLIGENGG 491
                    YN D+WD  + +  G A + A  IG  GV  GM Q Y+ G +   IGE GG
Sbjct: 436 RKLPRHIHRYNWDEWDNSEVITRGLAASAAFCIGVAGVVLGMCQTYYVGPLAAKIGEYGG 495

Query: 492 DIGFELGAGFAFITYNIFR 510
           D+G  LG GFA ++Y   R
Sbjct: 496 DLGMWLGMGFAGVSYPPLR 514

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  144 bits (362), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 141/566 (24%), Positives = 221/566 (39%), Gaps = 65/566 (11%)

Query: 1   MSSSSSKEEYVLHDVEKQEL-------SKTQFDXXXXXXXXXXXXXXXXKLSWVDHLASK 53
           M ++  KE++  H  +  E        S                     + +W+      
Sbjct: 6   MDTTKRKEDHTKHTTDVIEFYEEGTAASSLNIATEKANSSPSILRRIINRAAWLSKKVDA 65

Query: 54  LHAETKGIEPIT--XXXXXXXXILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLV 111
           +  E+ GI+ I+           L+ A +WLSA   +++ S   +G  +FGL+F E+V  
Sbjct: 66  MGVESTGIQRISPYERGTSKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFGLSFRESVAS 125

Query: 112 IVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIA 171
            +    +G L  A+ S+ G + G RQ+V +R+L G    ++    +II  +GW  VN++ 
Sbjct: 126 SLISVTIGCLIAAYCSIMGPQSGCRQMVTARYLFGWWFVKLVALASIIGVMGWSVVNSVV 185

Query: 172 SASLLHIVNPSGPDCPPWAGCLXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVI-IA 230
              +L  +  S    P W G +              + +   E +  VP    FL++ I+
Sbjct: 186 GGEMLAAI--SNDKVPLWVGIVIVTVCSFLVAIFGIKQVIKVETYLSVPVLTAFLLLYIS 243

Query: 231 RLAKXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKV 287
              K                                   W +  +DY +  P  T   ++
Sbjct: 244 SSDKYSFVNAYVSKGNLDSSTRKGNWMSFFSLCYSITATWGSITADYYILFPEDTPYIQI 303

Query: 288 FAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLW-GFGS 346
           F     G   P CF  ILG    +   + + W+  YD + +GGL +A       W GFG 
Sbjct: 304 FCLTFFGTFLPTCFVGILGLLLASVAMSYKPWSVEYDSHGMGGLLWAGF---QRWNGFGK 360

Query: 347 FCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFE 406
           FC VVL  S +SNNI N YS A   Q      AK+PR  W+I+  ++ L  A+     F 
Sbjct: 361 FCVVVLVFSLVSNNIINTYSAAFSIQLSSVFCAKIPRWFWSIVCTIICLVCALIGRNHFS 420

Query: 407 TFMTTFMDSIGYYLAIYSAIALSEHFIYRGGF---------------------------- 438
           T +  F+  IGY++++Y  +   E+ ++R  F                            
Sbjct: 421 TILGNFLPMIGYWISMYFILLFEENLVFRRFFLHLYTKEFPTVTGEINGPELVGSSKEVE 480

Query: 439 ------------------KGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQG 480
                               YN D W+ ++ L  GYA TFA  +G  GV  GM Q YW G
Sbjct: 481 KDAVTNIHLLKRKHKVTKHRYNWDKWEDYEVLTHGYAATFAFIVGVAGVVVGMAQAYWIG 540

Query: 481 QIGRLIGENGGDIGFELGAGFAFITY 506
            I    GE GGD+   L   F+ + Y
Sbjct: 541 PIAAKFGEYGGDVAMWLSMAFSGVVY 566

>Scas_710.30
          Length = 584

 Score =  138 bits (348), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 120/447 (26%), Positives = 189/447 (42%), Gaps = 13/447 (2%)

Query: 15  VEKQELSKTQFDXXXXXXXXXXXXXXXXKLSWVDHLASKLHAETKGIEPIT--XXXXXXX 72
           +EK E+++T+F                  L  +      L  E  GIE I+         
Sbjct: 6   IEKIEVAETEFTTVKKSPSYLRRLLHTANL--LSKKLDSLGVEATGIERISPYERGSKRK 63

Query: 73  XILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPVAFFSVFGAE 132
             ++ A  WL+A   +++ S   +G  +FGL F E+++  +    +G L  A+ S+ G +
Sbjct: 64  QFIHVAGYWLAATGSLSSMSSFLLGPLLFGLTFNESMVSGIVSMAIGCLVAAYCSIMGPQ 123

Query: 133 LGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSGPDCPPWAGC 192
            G RQ+V +R+L G    +      II  +GW  VN++    +L  +  S    P W G 
Sbjct: 124 SGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVVNSVVGGEMLASI--SNDKVPLWVGV 181

Query: 193 LXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVIIARLAKXXXXXXXXXXXXXXXXXX 252
           L              + +   E +  +P + +F+++    +                   
Sbjct: 182 LIVTLFSFLVAVFGIKQVLKVETYLSIPVWLMFILLYISSSDKYHYIDDFKSPIPDRLTL 241

Query: 253 X---XXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSMILGAAA 309
                            W +  +DY +  P  T+K +VF    LG   P  F  +LG   
Sbjct: 242 KGNWLSFFSLCYSITATWGSITADYYILFPEDTSKFQVFMLTFLGTVVPTLFVGVLGLCL 301

Query: 310 VTGTRTNERWAELYDKYSVGGLCYAILIEDSLW-GFGSFCCVVLALSTISNNIPNMYSIA 368
            T   T E W + Y+KY +GGL +A       W GFG FC VVL LS ISNNI N YS A
Sbjct: 302 STVAATYEPWNDDYNKYGMGGLLHAGF---KRWNGFGKFCVVVLLLSLISNNIINTYSAA 358

Query: 369 LGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIYSAIAL 428
              Q      AKVPR  W+I+  ++ L  A+     F T +  F+  IGY++++Y  + L
Sbjct: 359 FSVQLASVKAAKVPRWFWSIVCMIICLVCALVGRNHFSTILGNFLPMIGYWISMYFILLL 418

Query: 429 SEHFIYRGGFKGYNVDDWDRWDKLPIG 455
            E+ I+R  F      ++  +DK   G
Sbjct: 419 EENVIFREYFHHLYYKEFPEFDKSKSG 445

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 431 HFIYRGGFKGYNVDDWDRWDK---LPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGRLIG 487
           H + R      +  +W++WD    L  GYA TFA   G  GV  GM Q YW G + R  G
Sbjct: 493 HLLKRRHLATSHKYNWNKWDDPEVLTHGYAATFAFLCGVAGVVVGMAQAYWIGPLARKFG 552

Query: 488 ENGGDIGFELGAGFAFITYNIFR 510
           E GGDI   L   F+ + Y   R
Sbjct: 553 ETGGDIAMWLSMAFSGLVYPPLR 575

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  134 bits (336), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 112/430 (26%), Positives = 172/430 (40%), Gaps = 10/430 (2%)

Query: 14  DVEKQELSKTQFDXXXXXXXXXXXXXXXXKLSWVDHLASKLHAETKGIEPITXXXX-XXX 72
           D      +K  FD                 L W+         ET GIE +         
Sbjct: 47  DSRTNRRNKKLFDLDRHDPNLNIFMKGLAYLLWLSDKLDSFGVETSGIERVPPYERGTKK 106

Query: 73  XILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPVAFFSVFGAE 132
             L+ A +WLSA   +++ S   +G  +F L+F +A+   +    +G L  A+ S+ G +
Sbjct: 107 QFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTSSMISVTVGCLVAAYCSIMGPQ 166

Query: 133 LGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSGPDCPPWAGC 192
            G RQ+V +R+L G    +      II  +GW   N++    +L  +  S    P W G 
Sbjct: 167 SGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVVGGEMLAAI--SNDRVPLWVGI 224

Query: 193 LXXXXXXXXXXXXXYRVIHAYEKWSWVPNFAVFLVIIARLAKXXXXXXXXXXXXXXXXXX 252
           +              + +   E +  VP    FL++                        
Sbjct: 225 VIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLLYISSGNRDYLVREYKPIDVPSKTI 284

Query: 253 X---XXXXXXXXXXATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSMILGAAA 309
                          + W +  +DY +  P  T   +VF   + G   P  F  ILG   
Sbjct: 285 KGNWISFFSLCYSITSTWGSITADYYILFPEDTPHYQVFLLTLAGTLIPTTFVGILGLTL 344

Query: 310 VTGTRTNERWAELYDKYSVGGLCYAILIEDSLW-GFGSFCCVVLALSTISNNIPNMYSIA 368
            +  ++ + + E YD + +GGL +A     S W GFG F  VVL LS ISNNI N YS A
Sbjct: 345 ASIAKSYQPYGEEYDTHGMGGLLWAGF---SRWNGFGKFLVVVLILSLISNNIINTYSAA 401

Query: 369 LGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIYSAIAL 428
            G Q      A+VPR  W I+  +V L  A+     F T +  F+  IGY++++Y  +  
Sbjct: 402 FGIQLSAVWAARVPRWFWCIVCTIVYLVCALVGRNHFATILGNFLPMIGYWISMYFILLF 461

Query: 429 SEHFIYRGGF 438
            E+ I+R  F
Sbjct: 462 EENVIFRRYF 471

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 441 YNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGR-LIGENGGDIGFELGA 499
           YN D+WD  D L  GYA TFA   G  GV  GM Q YW G I R L G  GGDI   L  
Sbjct: 552 YNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKLGGPYGGDIAMWLSM 611

Query: 500 GFAFITYNIFR 510
           GF+ I Y   R
Sbjct: 612 GFSGIVYPWLR 622

>Scas_701.1
          Length = 68

 Score = 75.5 bits (184), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%)

Query: 452 LPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
           LPIG AG    F+ AFGVA GM Q YW G+IGR IG++GGD+GFE+GA + FI Y + RP
Sbjct: 1   LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 60

>Scas_690.1*
          Length = 636

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%)

Query: 452 LPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNIFRP 511
           LPIG AG    F+ AFGVA GM Q YW G+IGR IG++GGD+GFE+GA + FI Y + RP
Sbjct: 569 LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 628

>AGR008W [4318] [Homologous to ScYFR006W - SH]
           complement(732850..734394) [1545 bp, 514 aa]
          Length = 514

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 321 ELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNIPNMYSIALGTQALF 375
           E Y++Y V  + YA  I+ +L G   F  + + L  + +NI  +  I  G   LF
Sbjct: 149 EAYERYDVDSVAYASSIQKNLVGLDDFQLLTIDLDDVPSNIQPLLKI--GGDDLF 201

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,408,126
Number of extensions: 484564
Number of successful extensions: 1329
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1329
Number of HSP's successfully gapped: 37
Length of query: 511
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 405
Effective length of database: 12,926,601
Effective search space: 5235273405
Effective search space used: 5235273405
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)