Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C08261g23323011991e-169
Kwal_23.58252432314832e-60
ADL073W2772324286e-52
Sklu_1893.32812634018e-48
Scas_704.372512323605e-42
CAGL0L00693g2492313562e-41
YIL049W (DFG10)2532253397e-39
AER342C631133740.19
AGL323C21882661.1
KLLA0E05566g21987632.9
Scas_495.4*21854615.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C08261g
         (230 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C08261g complement(724399..725100) similar to sp|P40526 Sac...   466   e-169
Kwal_23.5825                                                          190   2e-60
ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH] complement...   169   6e-52
Sklu_1893.3 YIL049W, Contig c1893 3492-4337                           159   8e-48
Scas_704.37                                                           143   5e-42
CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces cer...   141   2e-41
YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in...   135   7e-39
AER342C [2843] [Homologous to ScYOR275C (RIM20) - SH] (1264670.....    33   0.19 
AGL323C [3989] [Homologous to ScYBL040C (ERD2) - SH] (103001..10...    30   1.1  
KLLA0E05566g join(501887..501911,502069..502703) gi|119544|sp|P1...    29   2.9  
Scas_495.4*                                                            28   5.1  

>KLLA0C08261g complement(724399..725100) similar to sp|P40526
           Saccharomyces cerevisiae YIL049w DFG10 singleton, start
           by similarity
          Length = 233

 Score =  466 bits (1199), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 230/230 (100%), Positives = 230/230 (100%)

Query: 1   MDIFQILLYSTFYVGIISVFVAEFYIPQLLKYGKTWEASNNFWYSLTCPKSNFGHFYLLS 60
           MDIFQILLYSTFYVGIISVFVAEFYIPQLLKYGKTWEASNNFWYSLTCPKSNFGHFYLLS
Sbjct: 1   MDIFQILLYSTFYVGIISVFVAEFYIPQLLKYGKTWEASNNFWYSLTCPKSNFGHFYLLS 60

Query: 61  SIFSIYNLLWIRSLLTLSVFIHSVRRLYECYCVTKWGQSKIHLSHYLVGIWFYTTLNLGI 120
           SIFSIYNLLWIRSLLTLSVFIHSVRRLYECYCVTKWGQSKIHLSHYLVGIWFYTTLNLGI
Sbjct: 61  SIFSIYNLLWIRSLLTLSVFIHSVRRLYECYCVTKWGQSKIHLSHYLVGIWFYTTLNLGI 120

Query: 121 MLYHGETQYSLISVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYICSAHYFDELLIY 180
           MLYHGETQYSLISVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYICSAHYFDELLIY
Sbjct: 121 MLYHGETQYSLISVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYICSAHYFDELLIY 180

Query: 181 TSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKFGYRSRWYLIP 230
           TSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKFGYRSRWYLIP
Sbjct: 181 TSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKFGYRSRWYLIP 230

>Kwal_23.5825
          Length = 243

 Score =  190 bits (483), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/231 (45%), Positives = 147/231 (63%), Gaps = 12/231 (5%)

Query: 9   YSTFYVGIISVFVAEFYIPQLLKYGKTWEASNN------FWYSLTCPKSNFGHFYLLSSI 62
           Y++F VGI SV +A++ +P LLKYGKT E S        F+  LT PK  F HFY+ S+ 
Sbjct: 10  YASFLVGIASVHLAKWQLPALLKYGKTLEGSRTQKGLLGFFEQLTVPKQWFTHFYVYSTT 69

Query: 63  FSIYNLLWIRSLLTLSVFIHSVRRLYECYCVTKWGQ-SKIHLSHYLVGIWFYTTLNLGIM 121
            +I N+   R+L++L   IHS RRLYE  CVTK+G+ S++HLSHYLVG+WFY+  N  + 
Sbjct: 70  LAILNVYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWFYSVANWAVF 129

Query: 122 LYHGETQYSLI---SVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYICSAHYFDELL 178
                +Q  L+   +V++F +SS+DQ  NH +LSKL KY+ P+YGLF    S HYFDE+L
Sbjct: 130 ESKSRSQLPLVRFLAVLVFALSSVDQYMNHLHLSKLVKYTMPTYGLFSITTSPHYFDEVL 189

Query: 179 IYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKFGYRSRWYLI 229
           +Y S  L      + L  C++W++VNL TS+ ET  WY +KF   +  Y I
Sbjct: 190 LYLS--LTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQTTPPYAI 238

>ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH]
           complement(553708..554541) [834 bp, 277 aa]
          Length = 277

 Score =  169 bits (428), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 140/232 (60%), Gaps = 18/232 (7%)

Query: 7   LLYSTFYVGIISVFVAEFYIPQLLKYGKTWEAS----NNFWY-SLTCPKSNFGHFYLLSS 61
           L++ ++ +G+ S+++A++ +P+LL+YGKT +         WY S+  P+  F HFY+LS 
Sbjct: 31  LIHFSYGIGLFSLWLAKYRLPKLLQYGKTRQKKLVGVIEPWYTSIAVPRRYFSHFYVLSF 90

Query: 62  IFSIYNLLWI-RSLLTLSVFIHSVRRLYECYCVTKWG-QSKIHLSHYLVGIWFYTTLNLG 119
           + +  NL W    ++T  +F HS+RRL E   VTKWG +S++H +HYLVG+WFY+ LNL 
Sbjct: 91  VLATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLS 150

Query: 120 IMLYHGETQ-----------YSLISVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYI 168
           + L     Q           +  +  + F+++S DQA NH +L+ + KY+ P  GLFK +
Sbjct: 151 VYLQLNSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKIV 210

Query: 169 CSAHYFDELLIYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKF 220
             AHYFDE++IY S   M+  +R  L   ++W+  NLG S+ ET  +Y  KF
Sbjct: 211 ACAHYFDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKF 262

>Sklu_1893.3 YIL049W, Contig c1893 3492-4337
          Length = 281

 Score =  159 bits (401), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 99/263 (37%), Positives = 152/263 (57%), Gaps = 38/263 (14%)

Query: 6   ILLYSTFYVGIISVFVAEFYIPQLLKYGKTW----------------EASN-----NFWY 44
           +L+ ++F V I  V +A++ +   LKYGKT                 E +N     +F+ 
Sbjct: 16  LLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMTNVLQILDFFE 75

Query: 45  SLTCPKSNFGHFYLLSSIFSIYNLLWIRS-LLTLSVFIHSVRRLYECYCVTKWG-QSKIH 102
           S+  P++ F HFY++S+ FS+ N +W    L+      HS+RRLYE YC++K+G +SK++
Sbjct: 76  SIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCISKFGAESKMN 135

Query: 103 LSHYLVGIWFYTTLNL----------GIMLYHGETQYSLISVILFIMSSLDQATNHDYLS 152
           +SHYLVGIWFYT+LNL           I      + + LI++ +F+ SS +Q  NH YLS
Sbjct: 136 ISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSYNQYQNHVYLS 195

Query: 153 KLKKYSQPSYGLFKYICSAHYFDELLIYTSFMLMDKGSRM-----LLIHCILWILVNLGT 207
           +L KY+ P  GLFK++  AHYFDE+LIY+S     + SR       L +C+LW+ +NL  
Sbjct: 196 QLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYCLLWVGINLSV 255

Query: 208 SSFETGNWYQEKFGYRSRWYLIP 230
           S+ ET N+Y  ++   +   +IP
Sbjct: 256 SAIETRNYYSHRYQDVAPHAIIP 278

>Scas_704.37
          Length = 251

 Score =  143 bits (360), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 138/232 (59%), Gaps = 32/232 (13%)

Query: 10  STFYVGIISVFVAEFYIPQLLKYGKTWEASNN-----FWYSL---TCPKSNFGHFYLLSS 61
           S+F++G++S+ +A+FY+P  L+YGKT   + +      W  +   T PKS F HFY LS+
Sbjct: 16  SSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHFTVPKSYFSHFYYLSA 75

Query: 62  IFSI--------YNLLWIRSLLTLSVFIHSVRRLYECYCVTKW-GQSKIHLSHYLVGIWF 112
           I S+        Y ++W+ +        HS+RRLYE   V K+  +S+++ SHY+VGIWF
Sbjct: 76  ILSVSTLYVYPKYPVVWLLAF-------HSLRRLYETLFVCKYTSKSRMNWSHYVVGIWF 128

Query: 113 YTTLNL--GIMLYHGETQYSLISVILFIM--SSLDQATNHDYLSKLKKYSQPSYGLFKYI 168
           YT L+L   I LY      ++    LFI+  +S DQ  NH  L+ L+KYS P+  LFK +
Sbjct: 129 YTVLHLILNICLYFERISPTINISALFILILASWDQYKNHRVLAHLRKYSLPTQRLFKIV 188

Query: 169 CSAHYFDELLIYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKF 220
           C  HY DE++IY++F+  +       I  ++W++V+L  S+ ET N+Y+ KF
Sbjct: 189 CCPHYLDEMIIYSTFLSYNAE----FIWPLIWVVVSLSISAIETKNFYKSKF 236

>CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces
           cerevisiae YIL049w DFG10, hypothetical start
          Length = 249

 Score =  141 bits (356), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/231 (35%), Positives = 138/231 (59%), Gaps = 15/231 (6%)

Query: 1   MDIFQILLYSTFYVGIISVFVAEFYIPQLLKYGKTW----EASNNFWYSL---TCPKSNF 53
           + +  I L  +  VG++S+ +A++Y+P  L+YGKT+      + N W  +   + PKS F
Sbjct: 8   LQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNFSVPKSYF 67

Query: 54  GHFYLLSSIFSIYNLL-WIRSLLTLSVFIHSVRRLYECYCVTKWGQ-SKIHLSHYLVGIW 111
            HFY+LSS+ ++  L  +   +L   +F+HS RRLYE   ++K+ + SK++ SHY VG+W
Sbjct: 68  AHFYILSSVLALVTLASYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWSHYAVGLW 127

Query: 112 FYTTLNLGIMLY--HGETQYSLISVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYIC 169
           FY+ LN+ + L      T   ++ +++ +++S DQ  NH  LSKLKKYS P   LF+ +C
Sbjct: 128 FYSQLNILVYLRVQRENTTARVLPILVMVLASWDQYKNHVVLSKLKKYSLPRSRLFELVC 187

Query: 170 SAHYFDELLIYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKF 220
             HY DE++IY S  L+  G     +  ++W++ +L  S+ E+  +Y  KF
Sbjct: 188 CPHYLDEMIIYGS--LVSYGHE--FVWPLIWVIASLSISALESRKFYLSKF 234

>YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in
           filamentous growth, cell polarity, and cellular
           elongation [762 bp, 253 aa]
          Length = 253

 Score =  135 bits (339), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 131/225 (58%), Gaps = 18/225 (8%)

Query: 11  TFYVGIISVFVAEFYIPQLLKYGKTWEASNNFWYS--------LTCPKSNFGHFYLLSSI 62
           +F+VGI S+F+A+  +P+ L+YGKT+    N  YS         T PK+ F HFY L++ 
Sbjct: 19  SFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFTVPKAYFSHFYYLATF 78

Query: 63  FSIYNL-LWIRSLLTLSVFIHSVRRLYEC-YCVTKWGQSKIHLSHYLVGIWFYTTL--NL 118
            S+  L  + +  +   +F HS+RRLYE  Y +     S+++ SHYLVGIWFY+ L   L
Sbjct: 79  LSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSHYLVGIWFYSVLLLIL 138

Query: 119 GIMLYHGETQYSLI--SVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYICSAHYFDE 176
            I LY      +L   + I+F ++S DQ  NH  L+ L KYS P+  LF+ +C  HY DE
Sbjct: 139 NISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLPTGRLFRLVCCPHYLDE 198

Query: 177 LLIYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKFG 221
           ++IY++ +  ++   + L+    W++ +L  S+ ET N+Y+ KF 
Sbjct: 199 IIIYSTLLPYEQEFYLTLV----WVITSLTISALETKNYYRHKFK 239

>AER342C [2843] [Homologous to ScYOR275C (RIM20) - SH]
           (1264670..1266565) [1896 bp, 631 aa]
          Length = 631

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 61/133 (45%), Gaps = 28/133 (21%)

Query: 56  FYLLSSIF----SIYNLLWIRSLLTLSVFIHSVRRLYECYCVT------KWGQSKIHLSH 105
           FY +SS+F    +  N +  RSL+     + ++  L E YC T      K+   +I  + 
Sbjct: 29  FYQVSSVFIDDLAAVNDMRNRSLMEADASVSNLEALLE-YCKTLFALIAKFPDRQIEFT- 86

Query: 106 YLVGIWFYTTLNLGIMLYHGET----QYSLISVILFI---MSSLDQATNHDYLSKLKKYS 158
                WF T   LG   Y G+T    ++ L +VI  I    S L  +  +D L +  +Y 
Sbjct: 87  -----WFET---LGHKAY-GKTSNLWKFELFNVIYNIGAVKSLLASSMGNDELKEACRYL 137

Query: 159 QPSYGLFKYICSA 171
           Q S G F+YI SA
Sbjct: 138 QESAGCFQYILSA 150

>AGL323C [3989] [Homologous to ScYBL040C (ERD2) - SH]
           (103001..103657) [657 bp, 218 aa]
          Length = 218

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 44/82 (53%), Gaps = 7/82 (8%)

Query: 63  FSIYNLLWIRSLLTLSVFIHSVRRLYECYCVTKWGQSKIHLSHYLVGIWFYTTLNLG--I 120
           + +  +LW+      SV++ SV  + + + ++K G++    SHY+  + FY  + +   I
Sbjct: 118 YKVQQVLWV-----FSVWLESVAIMPQLFMLSKAGKADALTSHYIFALGFYRAMYIPNWI 172

Query: 121 MLYHGETQYSLISVILFIMSSL 142
             Y+ E ++  ++V+  ++ +L
Sbjct: 173 WRYYVENRFDKVAVVAGVVQTL 194

>KLLA0E05566g join(501887..501911,502069..502703)
           gi|119544|sp|P18413|ERD2_KLULA Kluyveromyces lactis ER
           lumen protein retaining receptor, start by similarity
          Length = 219

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 58  LLSSIFSIYNLLWIRSLLTLSVFIHSVRRLYECYCVTKWGQSKIHLSHYLVGIWFYTTLN 117
           LL  IF+ Y   +I+   + S+++ SV  L + + +TK G++K   SHY+  +  Y  L 
Sbjct: 110 LLGLIFN-YRFSFIQICWSFSLWLESVAILPQLFMLTKTGKAKQLTSHYIFALGLYRALY 168

Query: 118 LG--IMLYHGETQYSLISVILFIMSSL 142
           +   I  Y+ E ++  +SV   ++ +L
Sbjct: 169 IPNWIWRYYTEERFDKLSVFTGVIQTL 195

>Scas_495.4*
          Length = 218

 Score = 28.1 bits (61), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 63  FSIYNLLWIRSLLTLSVFIHSVRRLYECYCVTKWGQSKIHLSHYLVGIWFYTTL 116
           FS+  +LW     + SV++ SV  L + + ++K G++K    HY+  +  Y TL
Sbjct: 119 FSLLEILW-----SFSVWLESVAILPQLFMLSKSGKAKSLTIHYIFALGLYRTL 167

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.142    0.466 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,865,657
Number of extensions: 332198
Number of successful extensions: 1094
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1066
Number of HSP's successfully gapped: 21
Length of query: 230
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 132
Effective length of database: 13,203,545
Effective search space: 1742867940
Effective search space used: 1742867940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)