Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C08217g25625213390.0
Scas_701.825024110391e-144
ADL071C2532489901e-137
Scas_704.322472429891e-137
CAGL0M11660g2482439831e-136
CAGL0M12430g2492419781e-135
YIL053W (RHR2)2712419791e-135
YER062C (HOR2)2502419611e-132
Kwal_23.58312492449401e-129
CAGL0I05874g2472419171e-126
Sklu_2394.32432263624e-42
CAGL0D04092g2512333503e-40
YHR043C (DOG2)2462243452e-39
YHR044C (DOG1)2462233408e-39
Scas_690.302592263365e-38
CAGL0M12925g2462233355e-38
KLLA0C11143g2682263253e-36
Scas_690.312442243199e-36
AAL123W2892372984e-32
CAGL0I07315g217206790.032
CAGL0L01969g237207760.079
CAGL0A01386g110229770.098
Kwal_26.808022363730.19
KLLA0F25696g222119730.19
YOR131C218215720.25
Scas_625.322350710.37
YKL220C (FRE2)71126635.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C08217g
         (252 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C08217g 721753..722523 highly similar to sp|P41277 Saccharo...   520   0.0  
Scas_701.8                                                            404   e-144
ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C (...   385   e-137
Scas_704.32                                                           385   e-137
CAGL0M11660g complement(1158566..1159312) highly similar to sp|P...   383   e-136
CAGL0M12430g complement(1238150..1238899) highly similar to sp|P...   381   e-135
YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphat...   381   e-135
YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycero...   374   e-132
Kwal_23.5831                                                          366   e-129
CAGL0I05874g complement(558102..558845) highly similar to sp|P41...   357   e-126
Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement        144   4e-42
CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces c...   139   3e-40
YHR043C (DOG2) [2331] chr8 complement(192797..193537) 2-Deoxyglu...   137   2e-39
YHR044C (DOG1) [2332] chr8 complement(194060..194800) 2-Deoxyglu...   135   8e-39
Scas_690.30                                                           134   5e-38
CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces...   133   5e-38
KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces c...   129   3e-36
Scas_690.31                                                           127   9e-36
AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DO...   119   4e-32
CAGL0I07315g 710064..710717 similar to tr|Q12486 Saccharomyces c...    35   0.032
CAGL0L01969g 228760..229473 similar to tr|Q86ZR7 Saccharomyces c...    34   0.079
CAGL0A01386g 136693..140001 some similarities with sp|P08640 Sac...    34   0.098
Kwal_26.8080                                                           33   0.19 
KLLA0F25696g 2386886..2387554 similar to sp|O59760 Schizosacchar...    33   0.19 
YOR131C (YOR131C) [4933] chr15 complement(572182..572838) Protei...    32   0.25 
Scas_625.3                                                             32   0.37 
YKL220C (FRE2) [3055] chr11 complement(9092..11227) Ferric and c...    29   5.3  

>KLLA0C08217g 721753..722523 highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 DL-glycerol
           phosphatase, start by similarity
          Length = 256

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/252 (100%), Positives = 252/252 (100%)

Query: 1   MSAATASNTAQQPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISH 60
           MSAATASNTAQQPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISH
Sbjct: 1   MSAATASNTAQQPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISH 60

Query: 61  GWRTYDVIKQFAPDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVA 120
           GWRTYDVIKQFAPDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVA
Sbjct: 61  GWRTYDVIKQFAPDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVA 120

Query: 121 TSGTYEMAHKWFDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKV 180
           TSGTYEMAHKWFDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKV
Sbjct: 121 TSGTYEMAHKWFDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKV 180

Query: 181 IVFEDAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVE 240
           IVFEDAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVE
Sbjct: 181 IVFEDAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVE 240

Query: 241 FIFDEYLYAKDD 252
           FIFDEYLYAKDD
Sbjct: 241 FIFDEYLYAKDD 252

>Scas_701.8
          Length = 250

 Score =  404 bits (1039), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 189/241 (78%), Positives = 216/241 (89%)

Query: 12  QPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQF 71
           +P+SL+VNAALFDVDGT+IISQ AIA FWRDFGKDKPYFD++HVI ISHGWRTYD I +F
Sbjct: 6   KPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 65

Query: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHKW 131
           APD+A+EE V+KLEGEIPEK+G+H+IEVPGA KLC +LNKLPKEKWAVATSGT EMA KW
Sbjct: 66  APDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATKW 125

Query: 132 FDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGIL 191
           FD+L IKRP  FITANDVK GKPHPEPYLKGRNGL +PIN+++P+ SK IVFEDAPAGI+
Sbjct: 126 FDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGIV 185

Query: 192 AGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYAKD 251
           AGKAAGCKIVGIATTFD +FL EKGCDI++K+H  +RV  Y P TDEVEFIFD+YLYAKD
Sbjct: 186 AGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIFDDYLYAKD 245

Query: 252 D 252
           D
Sbjct: 246 D 246

>ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C
           (HOR2) - SH] (556136..556897) [762 bp, 253 aa]
          Length = 253

 Score =  385 bits (990), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 185/248 (74%), Positives = 218/248 (87%)

Query: 5   TASNTAQQPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRT 64
           T++   +QPISL+VN ALFDVDGT+IISQPA+A FWR+FGKDKPYFD++HVI  +HGWRT
Sbjct: 2   TSTADHKQPISLKVNGALFDVDGTIIISQPALAAFWREFGKDKPYFDAEHVISATHGWRT 61

Query: 65  YDVIKQFAPDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGT 124
           YD I  FAPDY +EEYVT+LEGEIP+K+G+ ++EVPGA  LC  LN+LPKEKWAV TSGT
Sbjct: 62  YDAIATFAPDYLSEEYVTRLEGEIPDKYGKFSVEVPGAVTLCNALNELPKEKWAVGTSGT 121

Query: 125 YEMAHKWFDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFE 184
           +EMAHKWFD+LGIKRPS FITANDVK GKPHPEPY+KGRN L +PIN++NP  SKVIVFE
Sbjct: 122 FEMAHKWFDVLGIKRPSTFITANDVKQGKPHPEPYIKGRNALGFPINEQNPKGSKVIVFE 181

Query: 185 DAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFD 244
           DAPAGI AGKAAGCKIVG+ATTFD E+L E+GCDI++KDH  +RV  Y+PETDEVEF+FD
Sbjct: 182 DAPAGIAAGKAAGCKIVGVATTFDVEYLKERGCDIIVKDHRSIRVGGYNPETDEVEFVFD 241

Query: 245 EYLYAKDD 252
           +YLYAKDD
Sbjct: 242 DYLYAKDD 249

>Scas_704.32
          Length = 247

 Score =  385 bits (989), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 211/242 (87%)

Query: 11  QQPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQ 70
             PI+LRVNAALFDVDGT+IISQPA+A FW+ FG+DKPYFD+  V   +HGWRTYD I++
Sbjct: 2   NNPIALRVNAALFDVDGTIIISQPALAAFWKHFGEDKPYFDADLVTHATHGWRTYDAIEK 61

Query: 71  FAPDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHK 130
           FAPD+A+ EYVT+LEGEIP KFGQHA+EVPGA KLC E NKLPKE+WAVATSGT+EMA K
Sbjct: 62  FAPDWADREYVTQLEGEIPTKFGQHALEVPGAVKLCNEFNKLPKERWAVATSGTFEMASK 121

Query: 131 WFDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGI 190
           WF++L I+RP+NFITANDV+ GKPHP+PYLKGRNGL +PIN  NP+ SKV+VFEDAPAGI
Sbjct: 122 WFELLKIERPTNFITANDVERGKPHPDPYLKGRNGLGFPINATNPSKSKVVVFEDAPAGI 181

Query: 191 LAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYAK 250
            +GKAAGCKIVG+ATTFD+EFL EKGCD+++ +H  +++  Y+PETDE+E +F +YL+AK
Sbjct: 182 ESGKAAGCKIVGVATTFDEEFLKEKGCDLIVSNHESIKLNGYYPETDEIELVFHDYLFAK 241

Query: 251 DD 252
           DD
Sbjct: 242 DD 243

>CAGL0M11660g complement(1158566..1159312) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 248

 Score =  383 bits (983), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 216/243 (88%)

Query: 10  AQQPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIK 69
           +  P+SL+VNAALFDVDGT+IISQPAIA FWRDFGKDKPYFD++HVI ISHGWRTYD I 
Sbjct: 2   STSPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIA 61

Query: 70  QFAPDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAH 129
           +FAPDYA+EEYV KLEGEIPEK+G+H+IEVPGA KLC +LNKLPKEKWAVATSGT +MA 
Sbjct: 62  KFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQ 121

Query: 130 KWFDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAG 189
           KWF IL I+RP  FITANDVK GKP PEPYLKGR GL +PINKE+P+ SKV+VFEDAPAG
Sbjct: 122 KWFKILNIERPEYFITANDVKQGKPFPEPYLKGREGLGFPINKEDPSKSKVVVFEDAPAG 181

Query: 190 ILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYA 249
           I AGKAAGCKI+GIATTFD +FL EKGCDI++K+H  +RV  Y+PETDEVEFIFD+YLYA
Sbjct: 182 IAAGKAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYA 241

Query: 250 KDD 252
           KDD
Sbjct: 242 KDD 244

>CAGL0M12430g complement(1238150..1238899) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 249

 Score =  381 bits (978), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 188/241 (78%), Positives = 214/241 (88%)

Query: 12  QPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQF 71
           +P+SL+VNAALFDVDGT+IISQPAIA FWRDFGKDKPYFD++HVI ISHGWRTYD I +F
Sbjct: 5   KPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 64

Query: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHKW 131
           APDYA+EEYV KLEGEIPEK+G+H+IEVPGA KLC +LNKLPKEKWAVATSGT +MA KW
Sbjct: 65  APDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQKW 124

Query: 132 FDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGIL 191
           F  L I RP  FITANDVK GKP PEPY+KGR GL YPINKE+P+ SKV+VFEDAPAGI 
Sbjct: 125 FKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDAPAGIA 184

Query: 192 AGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYAKD 251
           AG+AAGCKI+GIATTFD +FL EKGCDI++K+H  +RV  Y+PETDEVEFIFD+YLYAKD
Sbjct: 185 AGQAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAKD 244

Query: 252 D 252
           D
Sbjct: 245 D 245

>YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphate
           phosphatase (sn-glycerol-3-phosphatase) [816 bp, 271 aa]
          Length = 271

 Score =  381 bits (979), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 188/241 (78%), Positives = 215/241 (89%)

Query: 12  QPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQF 71
           +P+SL++NAALFDVDGT+IISQPAIA FWRDFGKDKPYFD++HVI ISHGWRTYD I +F
Sbjct: 27  KPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 86

Query: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHKW 131
           APD+A+EEYV KLEGEIPEK+G+H+IEVPGA KLC  LN LPKEKWAVATSGT +MA KW
Sbjct: 87  APDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKKW 146

Query: 132 FDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGIL 191
           FDIL IKRP  FITANDVK GKPHPEPYLKGRNGL +PIN+++P+ SKV+VFEDAPAGI 
Sbjct: 147 FDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDAPAGIA 206

Query: 192 AGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYAKD 251
           AGKAAGCKIVGIATTFD +FL EKGCDI++K+H  +RV  Y+ ETDEVE IFD+YLYAKD
Sbjct: 207 AGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLYAKD 266

Query: 252 D 252
           D
Sbjct: 267 D 267

>YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycerol
           phosphate phosphatase (sn-glycerol-3-phosphatase) [753
           bp, 250 aa]
          Length = 250

 Score =  374 bits (961), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 184/241 (76%), Positives = 213/241 (88%)

Query: 12  QPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQF 71
           +P+SL+VNAALFDVDGT+IISQPAIA FWRDFGKDKPYFD++HVI +SHGWRT+D I +F
Sbjct: 6   KPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAKF 65

Query: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHKW 131
           APD+ANEEYV KLE EIP K+G+ +IEVPGA KLC  LN LPKEKWAVATSGT +MA KW
Sbjct: 66  APDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQKW 125

Query: 132 FDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGIL 191
           F+ LGI+RP  FITANDVK GKPHPEPYLKGRNGL YPIN+++P+ SKV+VFEDAPAGI 
Sbjct: 126 FEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDAPAGIA 185

Query: 192 AGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYAKD 251
           AGKAAGCKI+GIATTFD +FL EKGCDI++K+H  +RV  Y+ ETDEVEFIFD+YLYAKD
Sbjct: 186 AGKAAGCKIIGIATTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLYAKD 245

Query: 252 D 252
           D
Sbjct: 246 D 246

>Kwal_23.5831
          Length = 249

 Score =  366 bits (940), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 183/244 (75%), Positives = 212/244 (86%)

Query: 9   TAQQPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVI 68
           T  +P+S +VNAALFDVDGT+IISQPAIA FWRDFGKDKPYFD++HVI  SHGWRTYD I
Sbjct: 2   TLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAI 61

Query: 69  KQFAPDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMA 128
            +FAPD+A+E+Y T+LE EIPEK+G+H+IEVPGA KLC +LN LPKEKWAVATSGT  MA
Sbjct: 62  AKFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMA 121

Query: 129 HKWFDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPA 188
            KWF+ LGI++P  FITANDVK GKP PEPYLKGRNGL +PIN+++P+ SKVIVFEDAPA
Sbjct: 122 SKWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDAPA 181

Query: 189 GILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLY 248
           GI AGKAAGCKIVGIATTFD +FL EKGCDI++KDH  +RV  Y  ETDEVEFIFD++LY
Sbjct: 182 GIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLY 241

Query: 249 AKDD 252
           AKDD
Sbjct: 242 AKDD 245

>CAGL0I05874g complement(558102..558845) highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 or sp|P40106
           Saccharomyces cerevisiae YER062c GPP2, hypothetical
           start
          Length = 247

 Score =  357 bits (917), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 180/241 (74%), Positives = 204/241 (84%)

Query: 12  QPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQF 71
           +PI+LRVNAALFDVDGT+IISQPA+A FWRDFGKDKPYFD++HVI +SHGWRTYD I +F
Sbjct: 3   EPITLRVNAALFDVDGTIIISQPALAAFWRDFGKDKPYFDAEHVIHVSHGWRTYDAIAKF 62

Query: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHKW 131
           APD+A+EE VTKLEGEIP+K+G+ AIEV GA KLC   N+LPKEKWAVATSGT EMA KW
Sbjct: 63  APDFADEETVTKLEGEIPDKYGKEAIEVAGAVKLCNSFNELPKEKWAVATSGTREMASKW 122

Query: 132 FDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGIL 191
           F +LGIK+P+ FITANDVK GKP+PEPYLKGR GL YPIN   P  SKV+VFEDAPAGI 
Sbjct: 123 FAVLGIKKPTYFITANDVKKGKPNPEPYLKGREGLGYPINTHYPEKSKVVVFEDAPAGIA 182

Query: 192 AGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLYAKD 251
           AGKAAGCKI+GIATTF    L EKGCDIVIKDH  +RVA Y  ETDEV  +FD+YLY +D
Sbjct: 183 AGKAAGCKIIGIATTFSASSLREKGCDIVIKDHRSVRVAGYDKETDEVILVFDDYLYVRD 242

Query: 252 D 252
           D
Sbjct: 243 D 243

>Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement
          Length = 243

 Score =  144 bits (362), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 123/226 (54%), Gaps = 16/226 (7%)

Query: 16  LRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQFAP-- 73
            +VN  LFD+DGT++ +  A    W++  K K   D + +   SHG RT ++  +F P  
Sbjct: 4   FKVNLCLFDLDGTIVSTTIAAESAWKELCK-KHGVDPEELFKCSHGARTSEIFSKFFPSI 62

Query: 74  DYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNK--------LPKEKWAVATSGTY 125
           D  + + V KLE  I   +      +PGAS+L   L+K          K KWA+ TSG+ 
Sbjct: 63  DNTDNQAVKKLELAIAHDYLDSVGLIPGASELLLSLDKCSDPPFDNFSKRKWAIVTSGSS 122

Query: 126 EMAHKWFDIL--GIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVF 183
           ++A  WFD +   I +P  FITA DV  GKP PE Y K R+ LS   + E P   +++VF
Sbjct: 123 DLAFSWFDTILQHIGKPDVFITAFDVVKGKPDPEGYSKARDQLSKIWSLEFP---EIVVF 179

Query: 184 EDAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRV 229
           EDAP GI AGK  G   VGI +T+ K+ L E G D V+ D T + V
Sbjct: 180 EDAPVGIKAGKEIGAITVGITSTYSKDVLFEAGADYVVSDLTNVIV 225

>CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 251

 Score =  139 bits (350), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/233 (36%), Positives = 124/233 (53%), Gaps = 14/233 (6%)

Query: 9   TAQQPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVI 68
           T ++     V+  LFD+DGT++ +  A    WR     K   D + +   SHG RT +V+
Sbjct: 2   TVKKDNQFSVDVCLFDLDGTIVSTTVAAESAWRMLCA-KEGVDPEELFKFSHGVRTSEVL 60

Query: 69  KQFAP--DYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNK--------LPKEKWA 118
            +F P  D  + +   +LE  +   F      +PGA  L   L+K          + KWA
Sbjct: 61  AKFFPNIDNTDNKMTRELELSMANNFLDTVSLIPGAKDLLLTLDKDTARQGAKFNERKWA 120

Query: 119 VATSGTYEMAHKWFDIL--GIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPA 176
           + TSG+ ++A  WF  +   + +P  FITA DV  GKP PE Y K +  L   +  E+ +
Sbjct: 121 IVTSGSPDLAFSWFKTILKEVGKPDVFITAFDVTKGKPDPEGYAKAKKLLCERLQYESAS 180

Query: 177 ASKVIVFEDAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRV 229
           A+ V VFEDAPAGI AGKA G   VGI +T+D + LI+ G D V+KD T++ V
Sbjct: 181 ATSV-VFEDAPAGIKAGKAMGAITVGITSTYDLQTLIDAGADYVVKDLTQVEV 232

>YHR043C (DOG2) [2331] chr8 complement(192797..193537)
           2-Deoxyglucose-6-phosphate phosphatase, converts
           2-deoxy-D-glucose 6-phosphate to 2-deoxy-D-glucose and
           orthophosphate [741 bp, 246 aa]
          Length = 246

 Score =  137 bits (345), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 121/224 (54%), Gaps = 12/224 (5%)

Query: 18  VNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQFAP--DY 75
           V+  LFD+DGT++ +  A    W+   + +   D   +   SHG R+ +++K+F P  D 
Sbjct: 6   VDLCLFDLDGTIVSTTTAAESAWKKLCR-QHGVDPVELFKHSHGARSQEMMKKFFPKLDN 64

Query: 76  ANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELN-------KLPKEKWAVATSGTYEMA 128
            + + V  LE ++ + +      +PGA  L   L+       KLP+ KWA+ TSG+  +A
Sbjct: 65  TDNKGVLALEKDMADNYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLA 124

Query: 129 HKWFDIL--GIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDA 186
             WF+ +   + +P  FIT  DVKNGKP PE Y + R+ L   +        K +VFEDA
Sbjct: 125 FSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDA 184

Query: 187 PAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVA 230
           P GI AGKA G   VGI +++DK  L + G D V+ D T++ V 
Sbjct: 185 PVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVV 228

>YHR044C (DOG1) [2332] chr8 complement(194060..194800)
           2-Deoxyglucose-6-phosphate phosphatase [741 bp, 246 aa]
          Length = 246

 Score =  135 bits (340), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 118/223 (52%), Gaps = 12/223 (5%)

Query: 19  NAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQFAP--DYA 76
           +  LFD+DGT++ +  A  + W     +    D   +   SHG RT +V+++F P  D  
Sbjct: 7   DLCLFDLDGTIVSTTVAAEKAWTKLCYEYG-VDPSELFKHSHGARTQEVLRRFFPKLDDT 65

Query: 77  NEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELN-------KLPKEKWAVATSGTYEMAH 129
           + + V  LE +I   +      +PGA  L   L+       KLP+ KWA+ TSG+  +A 
Sbjct: 66  DNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAF 125

Query: 130 KWFDIL--GIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAP 187
            WF+ +   + +P  FIT  DVKNGKP PE Y + R+ L   +        K +VFEDAP
Sbjct: 126 SWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAP 185

Query: 188 AGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVA 230
            GI AGKA G   VGI +++DK  L + G D V+ D T++ V 
Sbjct: 186 VGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVV 228

>Scas_690.30
          Length = 259

 Score =  134 bits (336), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 85/226 (37%), Positives = 124/226 (54%), Gaps = 13/226 (5%)

Query: 15  SLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQFAP- 73
           S  V+  LFD+DGTL+ +  A    W D   +    + Q +   SHG +T +V+ ++ P 
Sbjct: 5   SFNVDVCLFDLDGTLVNTIKASEAVWTDLCNEHG-VNPQELFKHSHGVKTSEVLAEWFPM 63

Query: 74  -DYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELN-------KLPKEKWAVATSGTY 125
            D  +++ V  LE  +          VPGA  L  +L+       K   +KWA+ TSG+ 
Sbjct: 64  LDNTDDKAVKYLEESMGRDHLSSVFAVPGAIDLLKQLDIDTDTGKKFKDKKWAIVTSGST 123

Query: 126 EMAHKWF-DILG-IKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVF 183
            +A  WF  IL  +++P  F+TA DVKNGKP PE Y K R+ L    N +   A K +VF
Sbjct: 124 YIAFGWFKSILSELEKPEVFVTAFDVKNGKPDPEGYSKARDELCKTWNFDVKTA-KSVVF 182

Query: 184 EDAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRV 229
           EDAP GI AGKA G   VGI +T+DK+ L + G D V++D +++ +
Sbjct: 183 EDAPVGIQAGKAMGAITVGITSTYDKKVLFDAGADYVVRDLSQITI 228

>CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 246

 Score =  133 bits (335), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 119/223 (53%), Gaps = 14/223 (6%)

Query: 18  VNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQFAPDYAN 77
           V+  LFD+DGT++ +  A+   W+    +    D + +   SHG RT +V  +F PD  N
Sbjct: 7   VDLCLFDLDGTIVSTTRAVEMTWKKLCAEHDV-DPEELFRFSHGTRTGEVFAKFFPDIDN 65

Query: 78  --EEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNK-------LPKEKWAVATSGTYEMA 128
                    E  I +     ++ +PGA +L  +L+K       + + KWA+ TSG+ E+ 
Sbjct: 66  TGNRAAVAFELSIADDLSLISL-IPGAQELLLKLDKNTTDGSAVGERKWAIVTSGSPELT 124

Query: 129 HKWFD--ILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDA 186
             WFD  +  + RP  FI+  DV  GKP PE Y  GRN L   +  +   A + +VFEDA
Sbjct: 125 LSWFDNVLKEVGRPPVFISGADVAKGKPDPEGYYTGRNLLCQKLGLDASHA-RTVVFEDA 183

Query: 187 PAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRV 229
           P GI+AGKA G   VGIA T+DK+ L   G D V+ D  +++V
Sbjct: 184 PVGIMAGKAIGAITVGIAGTYDKDLLYSAGADYVVSDLNQVKV 226

>KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, start by similarity
          Length = 268

 Score =  129 bits (325), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 118/226 (52%), Gaps = 15/226 (6%)

Query: 15  SLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQFAP- 73
           S+ V+  LFD+DGTL+ S  A  E W     DK   D   +  +SHG RT +++ +F P 
Sbjct: 3   SIAVDYVLFDLDGTLVSSTDAAEEAWNKLC-DKYGVDYSTLSKVSHGSRTAEILAKFFPN 61

Query: 74  -DYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNK---------LPKEKWAVATSG 123
            D  N + V + E  I   +      +PG+  L   L++             KWAV TSG
Sbjct: 62  VDNTNNQAVKEFELSIANDYMDIVCLIPGSIDLLISLDRPTGAHPGEVFHHRKWAVVTSG 121

Query: 124 TYEMAHKWFDIL--GIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVI 181
           +  +AH WFD L   IK+P  FITA DV  GKP P  +      L   I +++    + +
Sbjct: 122 SPWVAHAWFDNLLKSIKKPEVFITAFDVSKGKPDPAGFALATKRLK-EIWQDDRKEVRTV 180

Query: 182 VFEDAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKL 227
           VFEDAP G+ AGKA G  +V + +T+DKE L   G D V++D +++
Sbjct: 181 VFEDAPVGVQAGKANGSIVVALTSTYDKELLFAAGADYVVEDLSQV 226

>Scas_690.31
          Length = 244

 Score =  127 bits (319), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 118/224 (52%), Gaps = 11/224 (4%)

Query: 15  SLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQFAPD 74
           +  V+  LFD+DGT++ +  A+   W  F K K   +++ + + SHG R+ +++ +F P 
Sbjct: 3   TFTVDLCLFDLDGTIVSTTIAVERAWIKFCK-KHNVNAEELFEHSHGARSGEIMARFFPH 61

Query: 75  YANEEYVTKLEGEIPEKFGQ--HAIEVPGASKLCGELNKLP-----KEKWAVATSGTYEM 127
             N +     E E+   +        +PG+ KL   L+K       K KWA+ TSG+  +
Sbjct: 62  VDNTDNKATKELELSMAYDNIDTVSLIPGSEKLLLALDKATTKDATKRKWAIVTSGSPYL 121

Query: 128 AHKWFDIL--GIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFED 185
           A  WFD +   + +P  FIT  DV+ GKP PE Y K R+ L      +N    + +VFED
Sbjct: 122 AFSWFDTILKDVGKPDVFITGFDVEKGKPDPEGYGKARDQLCKNWGPDNKHV-RTVVFED 180

Query: 186 APAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRV 229
           AP GI AGKA G   VGI  T+DK  L + G D V+ D T + V
Sbjct: 181 APVGIKAGKAIGAITVGITFTYDKNLLFDAGADYVVADLTHVSV 224

>AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DOG1)
           - SH] complement(131449..132318) [870 bp, 289 aa]
          Length = 289

 Score =  119 bits (298), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 119/237 (50%), Gaps = 14/237 (5%)

Query: 16  LRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQFAPDY 75
           + V+  LFD+DGT++ +  A+   W+  G+     D+  +   SHG R  +  KQ+ PD 
Sbjct: 4   ITVDVCLFDLDGTIVDTTDAVEAAWQKVGR-AHQVDAAKIRRNSHGRRASETFKQYFPDA 62

Query: 76  ANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNK---------LPKEKWAVATSGTYE 126
            N+  V + E  +  +   +   +PGA+ L   L++             +WA+ TS T  
Sbjct: 63  DNDAAVKEFEHALVSQ-SHYVGLIPGANDLLLTLDRPSGCNPGEVFRDNRWAIVTSATPS 121

Query: 127 MAHKWFDIL--GIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFE 184
           +A  WF+ L   +K P  FIT+ DV  GKP PE Y K ++ L+  I   N    + +VFE
Sbjct: 122 LARSWFNTLLKKVKPPKVFITSADVAKGKPDPEGYQKAKDQLA-DILGLNKDKVRAVVFE 180

Query: 185 DAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEF 241
           D+  GI A KA G   VGI +T+ K+ L   G D V++D  ++ V    P+   +E 
Sbjct: 181 DSALGIRAAKAMGAIAVGITSTYSKDVLYRSGADYVVEDLAQVCVMQNGPDGITLEI 237

>CAGL0I07315g 710064..710717 similar to tr|Q12486 Saccharomyces
           cerevisiae YOR131c, hypothetical start
          Length = 217

 Score = 35.0 bits (79), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 86/206 (41%), Gaps = 30/206 (14%)

Query: 17  RVNAALFDVDGTLIISQPAIAEFWRD-FG-KDKPYFDSQHVIDISHGWRTYDVIKQFAPD 74
           +V A +FD+DGTL + QP +    R+  G KD     SQ ++D        D ++Q    
Sbjct: 14  KVAAVIFDMDGTLCLPQPWMFPAMREAIGLKDA----SQDILDFISMMD--DPVQQ---- 63

Query: 75  YANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWA--VATSGTYEMAHKWF 132
              EE + K+E    EK     I  PG   L   +  L ++  A  + T       H + 
Sbjct: 64  KIAEEGLAKVE----EKAMLEMIPQPG---LVETMKYLTQQGIAKNICTRNVGTPVHYFI 116

Query: 133 DILGIKRPSNF--ITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGI 190
           D    K  + F  I   D +  KP+P+P L     +       NP    +I+  D+   +
Sbjct: 117 DKFIPKDYAKFDHIIMRDFRPTKPYPDPLLHIAKQID-----SNP--QHIIMVGDSYDDM 169

Query: 191 LAGKAAGCKIVGIATTFDKEFLIEKG 216
            +G+ AGC  V +    + + + E+ 
Sbjct: 170 KSGRLAGCLTVLLKNKINAKLVEEQS 195

>CAGL0L01969g 228760..229473 similar to tr|Q86ZR7 Saccharomyces
           cerevisiae YKL033wa, hypothetical start
          Length = 237

 Score = 33.9 bits (76), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 85/207 (41%), Gaps = 36/207 (17%)

Query: 17  RVNAALFDVDGTLI----ISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRT-YDVIKQF 71
           RV A LFD+DG LI    I    +    +++G     +D +  +    G      +I+ +
Sbjct: 7   RVKACLFDMDGLLINTEDIYTLTLNRILKEYGLGPLTWDVKIQLQGLPGPEAGKKIIETY 66

Query: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKL-------------CGELNKLPKEKWA 118
                 +E  TK   EI   +   A  +PGA +L             C   NK+   K+ 
Sbjct: 67  KLPLTPKELETK-NIEIQNDYWPTAAFLPGALELLKYLKSKNIPIALCTSSNKI---KFK 122

Query: 119 VATSGTYEMAHKWFDILGIKRPSNFITANDVK----NGKPHPEPYLKGRNGLSYPINKEN 174
             TS   E     FD +        +T +D +     GKP P+ +  G   L+   N  +
Sbjct: 123 GKTSHLGE-GFNLFDAI--------VTGDDERIPSGRGKPFPDVWQVGLKSLNDKFNT-S 172

Query: 175 PAASKVIVFEDAPAGILAGKAAGCKIV 201
            + S+ +VFED   G+ +G+A G  ++
Sbjct: 173 ISPSECLVFEDGIIGVQSGRAFGAHVI 199

>CAGL0A01386g 136693..140001 some similarities with sp|P08640
           Saccharomyces cerevisiae YIR019c STA1, hypothetical
           start
          Length = 1102

 Score = 34.3 bits (77), Expect = 0.098,   Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 224 HTKLRVAAYHPETDEVEFIFDEYLYAKDD 252
           H+K  V  Y P T+E+ + FD YLY  DD
Sbjct: 260 HSKFMVGFYPPNTEEITYDFDGYLYMLDD 288

>Kwal_26.8080
          Length = 223

 Score = 32.7 bits (73), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 143 FITANDVK----NGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGILAGKAAGC 198
            IT +D +     GKP+P+ +  G  GL+   N +     + ++FED   G+ + KAAG 
Sbjct: 124 IITGDDPRIPPGRGKPYPDIWQLGLKGLNEKFNTDI-KPEECLIFEDGLPGVTSAKAAGA 182

Query: 199 KIV 201
            ++
Sbjct: 183 YVI 185

>KLLA0F25696g 2386886..2387554 similar to sp|O59760
           Schizosaccharomyces pombe Haloacid dehalogenase-like
           hydrolase, start by similarity
          Length = 222

 Score = 32.7 bits (73), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 29/119 (24%)

Query: 118 AVATSGTYEMAH----------KWFDILGIKRPSNFITANDVK----NGKPHPEPYLKGR 163
           A+ TS T E  H          K FD++        IT +D +     GKP P+ +  G 
Sbjct: 97  ALCTSSTVEKFHHKTSHLTEAFKAFDVI--------ITGDDPRIPKGRGKPFPDIWQLGL 148

Query: 164 NGLSYPINKENPAASKVIVFEDAPAGILAGKAAGCKIV------GIATTFDKEFLIEKG 216
             L+   N  +  +++ +VFED   G+ AGK+ G  ++       IA   D + L ++G
Sbjct: 149 KELNAKFNT-DIESNECLVFEDGIPGVNAGKSFGAYVIWVPHKDAIALVKDHKILGDRG 206

>YOR131C (YOR131C) [4933] chr15 complement(572182..572838) Protein
           with similarity to E. coli YhfE protein of the dam
           operon [657 bp, 218 aa]
          Length = 218

 Score = 32.3 bits (72), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 87/215 (40%), Gaps = 26/215 (12%)

Query: 18  VNAALFDVDGTLIISQPAIAEFWRD-FGKDKPYFDSQHVIDISHGWRTYDVIKQFAPDYA 76
           + A +FD+DGTL + QP +    R+  G +    D  H ID     +     K+ A D  
Sbjct: 13  IKAVVFDMDGTLCLPQPWMFPAMRNAIGLEDKSIDILHFIDTLPTEKE----KKEAHDRI 68

Query: 77  NEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNK--LPKEKWAVATSGTYEMAHKWFDI 134
                  ++   P+         PG   +   L K  + K           E   K F  
Sbjct: 69  ELVEAKAMKEMQPQ---------PGLVDIMRYLTKNGISKNICTRNVGAPVETFVKRFIP 119

Query: 135 LGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGILAGK 194
             + R  ++I   + +  KP P+P L       +  +K N    ++I+  D+   + +G+
Sbjct: 120 SELSR-FDYIVTREFRPTKPQPDPLL-------HIASKLNIRPLEMIMVGDSFDDMKSGR 171

Query: 195 AAGCKIVGIATTFDKEFLIE--KGCDIVIKDHTKL 227
           +AGC  V +    +   L+E  +  D+ ++D +++
Sbjct: 172 SAGCFTVLLKNHVNGHLLLEHKELVDVSVEDLSEI 206

>Scas_625.3
          Length = 223

 Score = 32.0 bits (71), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 152 GKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGILAGKAAGCKIV 201
           GKPHP+ +  G   L+   +  N  A   +VFED   G+ +G+A G  ++
Sbjct: 137 GKPHPDIWQLGLKLLNEKFH-SNIEAKDCLVFEDGIPGVQSGRAFGAHVI 185

>YKL220C (FRE2) [3055] chr11 complement(9092..11227) Ferric and
           cupric reductase, paralog of Fre1p subject to regulation
           by iron [2136 bp, 711 aa]
          Length = 711

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 149 VKNGKPHPEPYLKGRNGLSYPINKEN 174
           + NG  H  PY+KG   L+YP+  + 
Sbjct: 118 LNNGTRHMTPYVKGSANLTYPVEMDT 143

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,040,371
Number of extensions: 415622
Number of successful extensions: 939
Number of sequences better than 10.0: 28
Number of HSP's gapped: 902
Number of HSP's successfully gapped: 28
Length of query: 252
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 153
Effective length of database: 13,168,927
Effective search space: 2014845831
Effective search space used: 2014845831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)