Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C08195g2432318981e-123
ADL069W205672505e-26
Scas_704.31*2221802437e-25
Kwal_23.5835157792012e-19
YER063W (THO1)218571877e-17
CAGL0J02992g230591174e-07
YMR003W19845720.21
CAGL0K00319g1014666010.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C08195g
         (240 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C08195g complement(719857..720588) some similarities with s...   350   e-123
ADL069W [1672] [Homologous to ScYER063W (THO1) - SH] complement(...   100   5e-26
Scas_704.31*                                                           98   7e-25
Kwal_23.5835                                                           82   2e-19
YER063W (THO1) [1494] chr5 (281708..282364) Protein that suppres...    77   7e-17
CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces c...    50   4e-07
YMR003W (YMR003W) [3968] chr13 (273118..273714) Protein containi...    32   0.21 
CAGL0K00319g 33461..36505 highly similar to sp|P22515 Saccharomy...    28   10.0 

>KLLA0C08195g complement(719857..720588) some similarities with
           sp|P40040 Saccharomyces cerevisiae YER063w THO1
           singleton, hypothetical start
          Length = 243

 Score =  350 bits (898), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 178/231 (77%)

Query: 1   MLTFDICIRILETTYWHARLPRQLESKTSSFPDPNYSKTYSPLFAMSYSGNTVAQLKELL 60
           MLTFDICIRILETTYWHARLPRQLESKTSSFPDPNYSKTYSPLFAMSYSGNTVAQLKELL
Sbjct: 1   MLTFDICIRILETTYWHARLPRQLESKTSSFPDPNYSKTYSPLFAMSYSGNTVAQLKELL 60

Query: 61  KQRNLSTDGLKADLINRLQDDDSTKNSATNEPXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           KQRNLSTDGLKADLINRLQDDDSTKNSATNEP                            
Sbjct: 61  KQRNLSTDGLKADLINRLQDDDSTKNSATNEPSSIAEVEATASATAAAAPTITSSIPDAV 120

Query: 121 XXXXXXXXXENENVPSTEEDKXXXXXXXXXXXXXXXXSQDQLKQAAIDHLQKKIYRAEKF 180
                    ENENVPSTEEDK                SQDQLKQAAIDHLQKKIYRAEKF
Sbjct: 121 PADASAAVPENENVPSTEEDKLEKTPPATPAPKNPELSQDQLKQAAIDHLQKKIYRAEKF 180

Query: 181 GQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGKGPDAAVGKPDRKSFQ 231
           GQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGKGPDAAVGKPDRKSFQ
Sbjct: 181 GQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGKGPDAAVGKPDRKSFQ 231

>ADL069W [1672] [Homologous to ScYER063W (THO1) - SH]
           complement(558299..558916) [618 bp, 205 aa]
          Length = 205

 Score =  100 bits (250), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 58/67 (86%)

Query: 158 SQDQLKQAAIDHLQKKIYRAEKFGQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGKG 217
           S +++KQAA+ HL KK++RA KFG+DD+ +  LQ+Q+ R+EKFGLDL+TQLA+ELGFG+G
Sbjct: 119 SPEEMKQAAVAHLSKKLHRARKFGEDDAAVGALQKQLARLEKFGLDLTTQLAQELGFGRG 178

Query: 218 PDAAVGK 224
           P AAVGK
Sbjct: 179 PAAAVGK 185

>Scas_704.31*
          Length = 222

 Score = 98.2 bits (243), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 83/180 (46%), Gaps = 4/180 (2%)

Query: 48  YSGNTVAQLKELLKQRNLSTDGLKADLINRLQDDDSTKNSATNE----PXXXXXXXXXXX 103
           YS  TVAQLKELL QR+L  +GLK DL+ RL  +D+   S+  E    P           
Sbjct: 4   YSKLTVAQLKELLTQRSLPLEGLKKDLVERLVKNDAEATSSVGETTATPAEATVAESTEQ 63

Query: 104 XXXXXXXXXXXXXXXXXXXXXXXXXXENENVPSTEEDKXXXXXXXXXXXXXXXXSQDQLK 163
                                         V +  E K                +Q+++K
Sbjct: 64  SEAAAEPSVETAAPAPAVTAPVEPATNAAPVTAATETKEGEPTKPEEKEEKKPLTQEEMK 123

Query: 164 QAAIDHLQKKIYRAEKFGQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGKGPDAAVG 223
             A++ L KKI+RA+KF  + S+ID+L+R I RIEKFGLDL++ LA ELG    P A  G
Sbjct: 124 TMALELLNKKIHRAKKFAAEQSSIDELERMITRIEKFGLDLNSTLAVELGLAPKPKAKTG 183

>Kwal_23.5835
          Length = 157

 Score = 82.0 bits (201), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 56/79 (70%), Gaps = 6/79 (7%)

Query: 166 AIDHLQKKIYRAEKFGQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGKGPDAAVGKP 225
           AI HL++K+ RA+KF  D +T+D L+RQI R+ KFGLD +T+LA+ELG GKGP+ AV  P
Sbjct: 81  AIAHLERKLRRAKKFADDQATLDYLERQIARVRKFGLDTTTELARELGLGKGPETAV--P 138

Query: 226 DR----KSFQKKNRNKSNN 240
            R    ++ +K N+N   N
Sbjct: 139 TRSVRSRTARKSNKNARGN 157

 Score = 35.8 bits (81), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%)

Query: 48 YSGNTVAQLKELLKQRNLSTDGLKADLINRLQDDDSTKN 86
          Y+  TV QL+  L+ R L +DG K+ L+ RL+ DD+ K 
Sbjct: 7  YAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKG 45

>YER063W (THO1) [1494] chr5 (281708..282364) Protein that suppresses
           the transcriptional defects of hpr1 null mutant upon
           overproduction [657 bp, 218 aa]
          Length = 218

 Score = 76.6 bits (187), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 47/57 (82%)

Query: 158 SQDQLKQAAIDHLQKKIYRAEKFGQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGF 214
           S +++K  A+D L KK++RA KFGQD + ID LQRQINR+EKFG+DL+++LA+ELG 
Sbjct: 121 SPEEIKAKALDLLNKKLHRANKFGQDQADIDSLQRQINRVEKFGVDLNSKLAEELGL 177

 Score = 42.7 bits (99), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 48 YSGNTVAQLKELLKQRNLSTDGLKADLINRL-QDDDSTKNSATNEP 92
          YS  TV QLK+LL +RNLS  GLK +L+ RL +DD+ +K  +   P
Sbjct: 4  YSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSP 49

>CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces
           cerevisiae YER063w THO1, start by similarity
          Length = 230

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 40/59 (67%)

Query: 158 SQDQLKQAAIDHLQKKIYRAEKFGQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGK 216
           + +++KQ A + + KK++RA+KFG +   ID L++   RI++FG+D +  +A ELG  K
Sbjct: 131 TAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMSIALELGLVK 189

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%)

Query: 47 SYSGNTVAQLKELLKQRNLSTDGLKADLINRLQDDD 82
          +YS  TV QLKELL +RNLS  GLK  L+ RL +DD
Sbjct: 3  NYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDD 38

>YMR003W (YMR003W) [3968] chr13 (273118..273714) Protein containing
           a SAP domain, which may bind DNA [597 bp, 198 aa]
          Length = 198

 Score = 32.3 bits (72), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 52  TVAQLKELLKQRNLSTDGLKADLINRLQDDDSTKNSAT----NEP 92
           TV  LKE  K R L   G K+DL+ RL   DS  N  +    NEP
Sbjct: 73  TVKVLKEQCKSRGLKLSGRKSDLLQRLITHDSCSNKKSSVKINEP 117

>CAGL0K00319g 33461..36505 highly similar to sp|P22515 Saccharomyces
           cerevisiae YKL210w UBA1, hypothetical start
          Length = 1014

 Score = 27.7 bits (60), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 25/66 (37%), Gaps = 20/66 (30%)

Query: 192 RQINRIEKFGLDLSTQLAKE--------------------LGFGKGPDAAVGKPDRKSFQ 231
           R  N+I  FG+D   +LA                      +G G GPD  +   D  S +
Sbjct: 410 RYDNQIAVFGIDFQRKLANSKVFLVGSGAIGCEMLKNWALMGLGSGPDGRIIVTDNDSIE 469

Query: 232 KKNRNK 237
           K N N+
Sbjct: 470 KSNLNR 475

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,528,036
Number of extensions: 236690
Number of successful extensions: 690
Number of sequences better than 10.0: 16
Number of HSP's gapped: 683
Number of HSP's successfully gapped: 21
Length of query: 240
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 141
Effective length of database: 13,168,927
Effective search space: 1856818707
Effective search space used: 1856818707
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 60 (27.7 bits)