Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C06094g1491475962e-80
Sklu_2419.61581564314e-55
Kwal_56.224921521524252e-54
YMR002W1561544236e-54
CAGL0J11682g1591573871e-48
ACL010C1531443342e-40
Scas_686.141521412951e-34
Kwal_56.228819537680.12
Sklu_1778.19537680.14
CAGL0K01375g9537640.56
AER199C9537630.57
KLLA0E13365g9537620.90
Scas_633.179537601.6
AGR088W288730622.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06094g
         (147 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06094g complement(535470..535919) similar to sp|Q03667 Sac...   234   2e-80
Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement        170   4e-55
Kwal_56.22492                                                         168   2e-54
YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the DU...   167   6e-54
CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces...   153   1e-48
ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [...   133   2e-40
Scas_686.14                                                           118   1e-34
Kwal_56.22881                                                          31   0.12 
Sklu_1778.1 YDL045W-A, Contig c1778 432-719                            31   0.14 
CAGL0K01375g 122162..122449 highly similar to tr|O75012 Saccharo...    29   0.56 
AER199C [2701] [Homologous to ScYDL045W-A (MRP10) - SH] (1012038...    29   0.57 
KLLA0E13365g 1179450..1179737 some similarities with sgd|S000643...    28   0.90 
Scas_633.17                                                            28   1.6  
AGR088W [4398] [Homologous to ScYLR087C (CSF1) - SH] complement(...    28   2.2  

>KLLA0C06094g complement(535470..535919) similar to sp|Q03667
           Saccharomyces cerevisiae YMR002w singleton, start by
           similarity
          Length = 149

 Score =  234 bits (596), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 118/147 (80%)

Query: 1   MARSRGSARPVSRPQTRSASTVXXXXXXXXXXXXXYSHPPHTAQPQQPGMFAQMASTAAG 60
           MARSRGSARPVSRPQTRSASTV             YSHPPHTAQPQQPGMFAQMASTAAG
Sbjct: 1   MARSRGSARPVSRPQTRSASTVAAPAPAQHQAPNAYSHPPHTAQPQQPGMFAQMASTAAG 60

Query: 61  VAVGSTIGHTLGAGITGMFSGSSSXXXXXXXXXXXXXXXXDTFQNQQATHCDVDARNFTR 120
           VAVGSTIGHTLGAGITGMFSGSSS                DTFQNQQATHCDVDARNFTR
Sbjct: 61  VAVGSTIGHTLGAGITGMFSGSSSAPAEQQQQQVAAPVQADTFQNQQATHCDVDARNFTR 120

Query: 121 CLEDNGGNMQICDYYLQQLKACQEAAR 147
           CLEDNGGNMQICDYYLQQLKACQEAAR
Sbjct: 121 CLEDNGGNMQICDYYLQQLKACQEAAR 147

>Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement
          Length = 158

 Score =  170 bits (431), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 104/156 (66%), Gaps = 9/156 (5%)

Query: 1   MARSRGSARPVSRP-QTRSASTVXX---XXXXXXXXXXXYSHPPHTA--QPQQPGMFAQM 54
           MARSRGSAR  +RP  TRSAST+                YSHPP  A  QPQQPG+FAQM
Sbjct: 1   MARSRGSARSAARPTHTRSASTMAAPPPSSAHVQPQQTAYSHPPAAAGAQPQQPGLFAQM 60

Query: 55  ASTAAGVAVGSTIGHTLGAGITGMFSGSSSXXXXXXXXXXXXXXXXD---TFQNQQATHC 111
           ASTAAGVAVGS +GHT+GAG+TG+FSGS S                    +    QATHC
Sbjct: 61  ASTAAGVAVGSAVGHTVGAGLTGLFSGSGSSAAPAEQQQQQQLAAAPAQQSLAQNQATHC 120

Query: 112 DVDARNFTRCLEDNGGNMQICDYYLQQLKACQEAAR 147
           DVDARNFTRCLE+N GN QICD+YLQQLKACQEAAR
Sbjct: 121 DVDARNFTRCLEENDGNFQICDFYLQQLKACQEAAR 156

>Kwal_56.22492
          Length = 152

 Score =  168 bits (425), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 92/152 (60%), Positives = 102/152 (67%), Gaps = 7/152 (4%)

Query: 1   MARSRGSARPVSRP---QTRSASTVXXX--XXXXXXXXXXYSHPPHTAQPQQPGMFAQMA 55
           MARSRG  R  SRP   QTRSAST+               YSHP   AQP+QPG+FAQMA
Sbjct: 1   MARSRGGVR--SRPAPAQTRSASTMAAHPPAQQHAAPSSAYSHPQSAAQPRQPGLFAQMA 58

Query: 56  STAAGVAVGSTIGHTLGAGITGMFSGSSSXXXXXXXXXXXXXXXXDTFQNQQATHCDVDA 115
           STAAGVAVGS +GHT+GAG+TGMFSGSSS                  F  +Q   CDVDA
Sbjct: 59  STAAGVAVGSAVGHTVGAGLTGMFSGSSSAPAEQQQQQLAAAPAQQGFAQEQGRACDVDA 118

Query: 116 RNFTRCLEDNGGNMQICDYYLQQLKACQEAAR 147
           R+FTRCLE+N GNMQICD+YLQQLKACQEAAR
Sbjct: 119 RSFTRCLEENNGNMQICDFYLQQLKACQEAAR 150

>YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the
           DUF657 protein of unknown function family, which may
           bind metal, has high similarity to uncharacterized C.
           albicans Orf6.159p [471 bp, 156 aa]
          Length = 156

 Score =  167 bits (423), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 95/154 (61%), Positives = 103/154 (66%), Gaps = 7/154 (4%)

Query: 1   MARSRGSARPVSRP---QTRSASTVXX-XXXXXXXXXXXYSHPPHT-AQPQQPGMFAQMA 55
           MARSRGS+RP+SR    QTRSAST+              YSHPP   AQ +QPGMFAQMA
Sbjct: 1   MARSRGSSRPISRSRPTQTRSASTMAAPVHPQQQQQPNAYSHPPAAGAQTRQPGMFAQMA 60

Query: 56  STAAGVAVGSTIGHTLGAGITGMFSGSSSXXXXXXXXXXXXXXXXDTFQNQQ--ATHCDV 113
           STAAGVAVGSTIGHTLGAGITGMFSGS S                   Q  Q     C++
Sbjct: 61  STAAGVAVGSTIGHTLGAGITGMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRTCEI 120

Query: 114 DARNFTRCLEDNGGNMQICDYYLQQLKACQEAAR 147
           DARNFTRCL++N GN QICDYYLQQLKACQEAAR
Sbjct: 121 DARNFTRCLDENNGNFQICDYYLQQLKACQEAAR 154

>CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces
           cerevisiae YMR002w, start by similarity
          Length = 159

 Score =  153 bits (387), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 94/157 (59%), Positives = 101/157 (64%), Gaps = 10/157 (6%)

Query: 1   MARSRGSARP------VSRPQ-TRSASTVXXXXX--XXXXXXXXYSHPPHTAQPQQPGMF 51
           MARSRG +RP       SRPQ +RSAST                 +HP   AQPQQPG+F
Sbjct: 1   MARSRGGSRPAGRSSAFSRPQQSRSASTAAYPAAPPRQQPVAPANAHPQAGAQPQQPGLF 60

Query: 52  AQMASTAAGVAVGSTIGHTLGAGITGMFSGS-SSXXXXXXXXXXXXXXXXDTFQNQQATH 110
           AQMASTAAGVAVGSTIGHTLGAGITGMFSGS SS                   Q QQ   
Sbjct: 61  AQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPMQNFDAAAQQQQQQFRT 120

Query: 111 CDVDARNFTRCLEDNGGNMQICDYYLQQLKACQEAAR 147
           CD DA+NFTRCL++N GN QICDYYLQQLKACQEAAR
Sbjct: 121 CDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAAR 157

>ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [462
           bp, 153 aa]
          Length = 153

 Score =  133 bits (334), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/144 (56%), Positives = 94/144 (65%), Gaps = 2/144 (1%)

Query: 1   MARSRGSARPVSRPQTRSASTVXXXXXXXXXXXXXYSHPPHTAQPQQPGMFAQMASTAAG 60
           MARSRG AR  +  Q+RSAS++              +H P  A PQQPG+FAQMASTAAG
Sbjct: 1   MARSRGPARRPAPVQSRSASSMAAPAAHAPPAPAPAAHAPAQAAPQQPGLFAQMASTAAG 60

Query: 61  VAVGSTIGHTLGAGITGMFSGS-SSXXXXXXXXXXXXXXXXDTFQNQQATHCDVDARNFT 119
           VAVGS +GHT+GAG+TG+FSGS S+                DTFQ  QA HCD DARNFT
Sbjct: 61  VAVGSAVGHTIGAGLTGLFSGSGSAPAEAQPQQLAAAPVQQDTFQT-QARHCDTDARNFT 119

Query: 120 RCLEDNGGNMQICDYYLQQLKACQ 143
           RCLEDN GN QICDYYLQQ +  Q
Sbjct: 120 RCLEDNNGNFQICDYYLQQFEGLQ 143

>Scas_686.14
          Length = 152

 Score =  118 bits (295), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 80/141 (56%), Gaps = 10/141 (7%)

Query: 14  PQTRSASTVXXXXXXXXXXXXXYSHPPHTA-------QPQQPGMFAQMASTAAGVAVGST 66
           PQ RSAST              YS PP  +       QP+QPGMFAQMASTAAGVAVGST
Sbjct: 13  PQRRSASTAAISRPAPPASNA-YSQPPAASAGAGAGAQPRQPGMFAQMASTAAGVAVGST 71

Query: 67  IGHTLGAGITGMFSGSSSXXXXXXXXXXXXXXXXDTFQNQQATHCDVDARNFTRCLEDNG 126
           +GH +   + G   GS+                  T   + A  CD  A++FT+CL++N 
Sbjct: 72  VGHAVSGLLFG--GGSAPAEQPVQQQAMDPYASQRTLDQEPAQSCDGAAKSFTKCLDENN 129

Query: 127 GNMQICDYYLQQLKACQEAAR 147
           GN QICDYYLQQLKACQEAAR
Sbjct: 130 GNFQICDYYLQQLKACQEAAR 150

>Kwal_56.22881
          Length = 95

 Score = 30.8 bits (68), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 106 QQATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKAC 142
           Q+A  C V   N  +C   NG    +C+  +++LK C
Sbjct: 25  QEANKCLVLMSNLLQCWSSNGHMNPVCENLVKELKVC 61

>Sklu_1778.1 YDL045W-A, Contig c1778 432-719
          Length = 95

 Score = 30.8 bits (68), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 18/37 (48%)

Query: 106 QQATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKAC 142
           Q+A  C V   N  +C   NG    +C+    QLKAC
Sbjct: 25  QEANRCLVLMSNLLQCWSSNGHMNPVCENLAGQLKAC 61

>CAGL0K01375g 122162..122449 highly similar to tr|O75012
           Saccharomyces cerevisiae YDL045wa MRP10, start by
           similarity
          Length = 95

 Score = 29.3 bits (64), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 18/37 (48%)

Query: 106 QQATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKAC 142
           Q+A  C V   N  +C   NG    +C+   ++LK C
Sbjct: 25  QEANKCLVLMSNLLQCWSSNGHMSTVCEGLAKELKLC 61

>AER199C [2701] [Homologous to ScYDL045W-A (MRP10) - SH]
           (1012038..1012325) [288 bp, 95 aa]
          Length = 95

 Score = 28.9 bits (63), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 17/37 (45%)

Query: 106 QQATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKAC 142
           Q+A  C V   N  +C   NG    +C+     LKAC
Sbjct: 25  QEANRCLVLMSNLLQCWSSNGHMNPVCEKLATDLKAC 61

>KLLA0E13365g 1179450..1179737 some similarities with sgd|S0006430
           Saccharomyces cerevisiae YDL045wa MRP10 mitochondrial
           ribosomal protein, hypothetical start
          Length = 95

 Score = 28.5 bits (62), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 17/37 (45%)

Query: 106 QQATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKAC 142
           Q+A  C V   N  +C   NG     C+   Q LKAC
Sbjct: 25  QEANRCLVLMSNLLQCWSSNGHMYGACETLAQDLKAC 61

>Scas_633.17
          Length = 95

 Score = 27.7 bits (60), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 17/37 (45%)

Query: 106 QQATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKAC 142
           Q+A  C V   N  +C   NG     C+    +LKAC
Sbjct: 25  QEANKCLVLMSNLLQCWSSNGHMNPACETLATELKAC 61

>AGR088W [4398] [Homologous to ScYLR087C (CSF1) - SH]
           complement(892686..901349) [8664 bp, 2887 aa]
          Length = 2887

 Score = 28.5 bits (62), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 110 HCDVDARNFTRCLEDNGGNMQICDYYLQQL 139
           H D+DAR   + +ED G  +   D YL Q 
Sbjct: 823 HTDIDARTLFKVIEDIGIPIDASDAYLSQF 852

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.126    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,358,225
Number of extensions: 93720
Number of successful extensions: 199
Number of sequences better than 10.0: 15
Number of HSP's gapped: 185
Number of HSP's successfully gapped: 15
Length of query: 147
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 55
Effective length of database: 13,411,253
Effective search space: 737618915
Effective search space used: 737618915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)