Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C06072g25324913120.0
Kwal_56.224942702283862e-45
ACL011C2812703793e-44
YMR003W198641244e-08
KLLA0A02189g78231820.022
CAGL0L04290g75448710.43
Kwal_55.1950439183681.1
Kwal_23.583515731641.9
Kwal_38.1637250183634.9
YDR169C (STB3)51371625.2
Kwal_29.1287560583625.6
AAR121W89723626.6
Kwal_18.269760583617.3
CAGL0B00484g83731609.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06072g
         (249 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06072g complement(534152..534913) no similarity, hypotheti...   509   0.0  
Kwal_56.22494                                                         153   2e-45
ACL011C [1038] [Homologous to ScYMR003W - SH] (337457..338302) [...   150   3e-44
YMR003W (YMR003W) [3968] chr13 (273118..273714) Protein containi...    52   4e-08
KLLA0A02189g complement(194500..196848) some similarities with s...    36   0.022
CAGL0L04290g complement(499514..501778) similar to sp|Q12216 Sac...    32   0.43 
Kwal_55.19504                                                          31   1.1  
Kwal_23.5835                                                           29   1.9  
Kwal_38.16372                                                          29   4.9  
YDR169C (STB3) [1011] chr4 complement(792342..793883) Sin3p-bind...    28   5.2  
Kwal_29.12875                                                          28   5.6  
AAR121W [308] [Homologous to ScYDR409W (SIZ1) - SH; ScYOR156C (N...    28   6.6  
Kwal_18.2697                                                           28   7.3  
CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomy...    28   9.9  

>KLLA0C06072g complement(534152..534913) no similarity, hypothetical
           start
          Length = 253

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/249 (100%), Positives = 249/249 (100%)

Query: 1   MSLRKVRSLPSLRVLAEVSNPLVRVPPPSFTYQTRQVHNTKKNEHSPMLSSDSHASFTRM 60
           MSLRKVRSLPSLRVLAEVSNPLVRVPPPSFTYQTRQVHNTKKNEHSPMLSSDSHASFTRM
Sbjct: 1   MSLRKVRSLPSLRVLAEVSNPLVRVPPPSFTYQTRQVHNTKKNEHSPMLSSDSHASFTRM 60

Query: 61  SLKTLKNECRTRGLKVSGKKTELVERILLFEGSSSKKLHTSAIQRAKNDSSHIDSMKIPN 120
           SLKTLKNECRTRGLKVSGKKTELVERILLFEGSSSKKLHTSAIQRAKNDSSHIDSMKIPN
Sbjct: 61  SLKTLKNECRTRGLKVSGKKTELVERILLFEGSSSKKLHTSAIQRAKNDSSHIDSMKIPN 120

Query: 121 VAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEKKLQPADKKPLAENVGTVATP 180
           VAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEKKLQPADKKPLAENVGTVATP
Sbjct: 121 VAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEKKLQPADKKPLAENVGTVATP 180

Query: 181 DADNVIQTPSVSDSIKVVNPEEELRSGSSEQGRSYSQQDEELTSRDKKFLLGFAGTVAAW 240
           DADNVIQTPSVSDSIKVVNPEEELRSGSSEQGRSYSQQDEELTSRDKKFLLGFAGTVAAW
Sbjct: 181 DADNVIQTPSVSDSIKVVNPEEELRSGSSEQGRSYSQQDEELTSRDKKFLLGFAGTVAAW 240

Query: 241 WSLRFWKKE 249
           WSLRFWKKE
Sbjct: 241 WSLRFWKKE 249

>Kwal_56.22494
          Length = 270

 Score =  153 bits (386), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/228 (40%), Positives = 134/228 (58%), Gaps = 18/228 (7%)

Query: 34  TRQVHNTKKNEHSPMLSSDSHASFTRMSLKTLKNECRTRGLKVSGKKTELVERILLFEG- 92
           TR VH+T K +H+ +LS+D  A+F  MSLK LK+ECRTRGL+VSG+K +LV+RIL +E  
Sbjct: 42  TRMVHSTPKQDHTTLLSNDRLANFNVMSLKALKSECRTRGLRVSGRKGDLVDRILAYESS 101

Query: 93  ---------SSSKKLHTSAIQRAKNDSSHIDSMKIPNVAKLEAEAESRKTDYIVKVPSIV 143
                    SS ++ H S   ++K D   +D++ +P++A  E   E+   +YIV +  + 
Sbjct: 102 GALAGNNNMSSIRQFHVSKSTKSKGDVRPVDAVSMPDIAATEESLETLDKEYIVHITPLS 161

Query: 144 NNAATEPKTKIEKDYEKKLQPADKKPLAENVGTVATPDADNVI-QTPSVSDSIKVVNPEE 202
           ++A   P TK+EK+ +     A K        +V+T D + VI Q  S  +S +VVN E 
Sbjct: 162 DSADQRPVTKVEKELD-----AAKNDTGIVSPSVSTTDHEKVIFQADSALESFEVVNEEA 216

Query: 203 ELRSG--SSEQGRSYSQQDEELTSRDKKFLLGFAGTVAAWWSLRFWKK 248
           EL S   S +  R  S   EEL+SRD+ FLL FA  VA+WWSL+   K
Sbjct: 217 ELDSDKESYQNKRQESSAGEELSSRDRIFLLSFAAVVASWWSLKVLGK 264

>ACL011C [1038] [Homologous to ScYMR003W - SH] (337457..338302) [846
           bp, 281 aa]
          Length = 281

 Score =  150 bits (379), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 149/270 (55%), Gaps = 31/270 (11%)

Query: 1   MSLRKVRSLPSLRVLAEVSNPLVRVPP-PSFTYQ-------------TRQVHNTKKNEHS 46
           MSLR+ +SLPSL+ +AEV+ P+ + PP P   ++              R VHNT     +
Sbjct: 1   MSLRRAKSLPSLKNIAEVAKPITKAPPLPLLAFEGPGLSTCRWYPTTVRTVHNTPSKAQT 60

Query: 47  PMLSS-DSHASFTRMSLKTLKNECRTRGLKVSGKKTELVERILLFE--GSSSKKLHTSAI 103
            +LS+    ++F+ M+LK L+NECR+RGL+VSG+K++L+ERI+ FE  G   ++    A 
Sbjct: 61  TLLSTAKKESAFSAMNLKALRNECRSRGLQVSGRKSDLIERIVDFELKGPLGRRGTRRAF 120

Query: 104 QRAKNDSSH----IDSMKIPNVAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYE 159
                 S+     +D + +P++A  E   +  + +YI+++PS+   AA+ P TK EKD  
Sbjct: 121 HSPGTSSASVCRPVDKVTMPDIALTERAVQQPEKNYILRIPSLSREAASHPVTKSEKDLA 180

Query: 160 KKLQPADKKPLAENVGTVATPDADNVIQTPSVSDSIKVVNPEEELRSGS--SEQGRSYSQ 217
           +     D  P +E  G V TPD+D  I++P V + I+++N ++ L+  S  S   +  SQ
Sbjct: 181 QGAD-EDADPTSEE-GRVLTPDSDLHIESPVVINKIEIINEDDYLQDDSRQSSDSQGGSQ 238

Query: 218 QDEELTS------RDKKFLLGFAGTVAAWW 241
           QD + T       RD++F  G    V  WW
Sbjct: 239 QDSDGTGQQNFSPRDRRFFAGLTAAVGLWW 268

>YMR003W (YMR003W) [3968] chr13 (273118..273714) Protein containing
           a SAP domain, which may bind DNA [597 bp, 198 aa]
          Length = 198

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 46/64 (71%), Gaps = 1/64 (1%)

Query: 35  RQVHNTKKNEH-SPMLSSDSHASFTRMSLKTLKNECRTRGLKVSGKKTELVERILLFEGS 93
           R VH+T+   H S +++++    F + ++K LK +C++RGLK+SG+K++L++R++  +  
Sbjct: 46  RYVHSTQTKSHLSFLMNNNDITPFQKFTVKVLKEQCKSRGLKLSGRKSDLLQRLITHDSC 105

Query: 94  SSKK 97
           S+KK
Sbjct: 106 SNKK 109

>KLLA0A02189g complement(194500..196848) some similarities with
          sgd|S0002817 Saccharomyces cerevisiae YDR409w,
          hypothetical start
          Length = 782

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 60 MSLKTLKNECRTRGLKVSGKKTELVERILLF 90
          + +  LKN CR+ GL +SG+KTEL +R+  F
Sbjct: 20 LKVAELKNVCRSIGLPISGRKTELQDRLSSF 50

>CAGL0L04290g complement(499514..501778) similar to sp|Q12216
          Saccharomyces cerevisiae YOR156c NFI1 interacts with
          CDC12P in 2-hybrid assay, hypothetical start
          Length = 754

 Score = 32.0 bits (71), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 52 DSHASFTRMSLKTLKNECRTRGLKVSGKKTELVERILLFEGSSSKKLH 99
          D+  S   + +  LK  CR+  L V+G+K EL +RI  F   S  K H
Sbjct: 13 DAANSIESLRVSDLKAICRSISLGVTGRKVELQDRIKQFIKQSMAKGH 60

>Kwal_55.19504
          Length = 391

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 35/83 (42%), Gaps = 10/83 (12%)

Query: 110 SSHIDSMKIPNVAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEKKLQP---AD 166
           S+ ID + I  VA       + KT Y V+ PS  +N  T         Y   L     AD
Sbjct: 254 STAIDVVTIDGVA-------TTKTVYYVETPSSGSNVYTPWTGSYTSTYSTDLSTFTGAD 306

Query: 167 KKPLAENVGTVATPDADNVIQTP 189
            KP  + V  V TP + + + TP
Sbjct: 307 GKPTTKTVYYVETPSSGSNVYTP 329

>Kwal_23.5835
          Length = 157

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 22/31 (70%)

Query: 57 FTRMSLKTLKNECRTRGLKVSGKKTELVERI 87
          +   +++ L+NE ++R L   G+K++LVER+
Sbjct: 7  YAEQTVEQLQNELQSRQLDSDGEKSQLVERL 37

>Kwal_38.16372
          Length = 501

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 34/83 (40%), Gaps = 10/83 (12%)

Query: 110 SSHIDSMKIPNVAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEKKLQP---AD 166
           S+ ID + I  VA       + KT Y V+ PS  +N  T         Y   L     AD
Sbjct: 196 STAIDVVTIDGVA-------TTKTVYYVETPSSGSNVYTPWTGSFTSTYSTDLSTFTGAD 248

Query: 167 KKPLAENVGTVATPDADNVIQTP 189
            KP  + V  V TP   + + TP
Sbjct: 249 GKPTTKTVYYVETPSIGSNVYTP 271

>YDR169C (STB3) [1011] chr4 complement(792342..793883) Sin3p-binding
           protein [1542 bp, 513 aa]
          Length = 513

 Score = 28.5 bits (62), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 2   SLRKVRSLPSLRVLAEVSNPLVRVPP--PSFTY-QTRQV-----HNTKKNEHSPMLSSDS 53
           SLR     P++  +A  +N +V   P  PSFT  Q   +     H+ +K+E  P    D+
Sbjct: 443 SLRNNSLAPNIDSVASSTNGVVSPKPTNPSFTNSQNGDIEPPLQHDQQKHEQQPRNGEDN 502

Query: 54  HASFTRMSLKT 64
            A+F  MSLK+
Sbjct: 503 SAAFLLMSLKS 513

>Kwal_29.12875
          Length = 605

 Score = 28.5 bits (62), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 34/83 (40%), Gaps = 10/83 (12%)

Query: 110 SSHIDSMKIPNVAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEKKLQP---AD 166
           S+ ID + I  VA       + KT Y V+ PS  +N  T         Y   L     AD
Sbjct: 482 STAIDVVTIDGVA-------TTKTVYYVETPSSGSNVYTPWTGSFTSTYSTDLSTFTGAD 534

Query: 167 KKPLAENVGTVATPDADNVIQTP 189
            KP  + V  V TP A   + TP
Sbjct: 535 GKPTTKTVYYVETPTAATTVFTP 557

>AAR121W [308] [Homologous to ScYDR409W (SIZ1) - SH; ScYOR156C
          (NFI1) - SH] complement(559426..562119) [2694 bp, 897
          aa]
          Length = 897

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 65 LKNECRTRGLKVSGKKTELVERI 87
          LK  CR+ GL +SG+K +L  RI
Sbjct: 24 LKAVCRSIGLPLSGRKADLQARI 46

>Kwal_18.2697
          Length = 605

 Score = 28.1 bits (61), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 34/83 (40%), Gaps = 10/83 (12%)

Query: 110 SSHIDSMKIPNVAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEKKLQP---AD 166
           S+ ID + I  VA       + KT Y V+ PS  +N  T         Y   L     AD
Sbjct: 482 STAIDVVTIDGVA-------TTKTVYYVETPSSGSNVYTPWTGSFTSTYSTDLSTFTGAD 534

Query: 167 KKPLAENVGTVATPDADNVIQTP 189
            KP  + V  V TP A   + TP
Sbjct: 535 GKPTTKTVYYVETPTAATTVFTP 557

>CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1, start by similarity
          Length = 837

 Score = 27.7 bits (60), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 169 PLAENVGTVATPDADNVIQTPSVSDSIKVVN 199
           PL ENV  +     D+V+ + SV D+ K+ N
Sbjct: 560 PLFENVQPILQSKTDDVVDSESVGDATKISN 590

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.124    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,097,851
Number of extensions: 343468
Number of successful extensions: 1534
Number of sequences better than 10.0: 98
Number of HSP's gapped: 1522
Number of HSP's successfully gapped: 98
Length of query: 249
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 150
Effective length of database: 13,168,927
Effective search space: 1975339050
Effective search space used: 1975339050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 60 (27.7 bits)