Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C06050g2052029971e-140
CAGL0E02387g1951774641e-58
YOL008W2071664414e-55
Scas_644.122101744405e-55
ACL012W2041794293e-53
Sklu_2419.52051824232e-52
Kwal_56.224961941753832e-46
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06050g
         (202 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06050g 533200..533817 similar to sgd|S0005368 Saccharomyce...   388   e-140
CAGL0E02387g 227464..228051 similar to tr|Q08058 Saccharomyces c...   183   1e-58
YOL008W (YOL008W) [4808] chr15 (310312..310935) Member of the UP...   174   4e-55
Scas_644.12                                                           174   5e-55
ACL012W [1037] [Homologous to ScYOL008W - SH] complement(336674....   169   3e-53
Sklu_2419.5 YOL008W, Contig c2419 6103-6720                           167   2e-52
Kwal_56.22496                                                         152   2e-46

>KLLA0C06050g 533200..533817 similar to sgd|S0005368 Saccharomyces
           cerevisiae YOL008w, start by similarity
          Length = 205

 Score =  388 bits (997), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 189/202 (93%), Positives = 189/202 (93%)

Query: 1   MLTVGTGKIAMILSFSKLTPCPQASALGKRSFFNLTTEASSKDEQHYVLKRNIRGTPXXX 60
           MLTVGTGKIAMILSFSKLTPCPQASALGKRSFFNLTTEASSKDEQHYVLKRNIRGTP   
Sbjct: 1   MLTVGTGKIAMILSFSKLTPCPQASALGKRSFFNLTTEASSKDEQHYVLKRNIRGTPNEV 60

Query: 61  XXXXXXXXXXKDFIPYCTESFVNLRDEKNRPVEAGLRVGFQQYDEKFVCKVQCKELSDLV 120
                     KDFIPYCTESFVNLRDEKNRPVEAGLRVGFQQYDEKFVCKVQCKELSDLV
Sbjct: 61  YEVVSEVSNYKDFIPYCTESFVNLRDEKNRPVEAGLRVGFQQYDEKFVCKVQCKELSDLV 120

Query: 121 KSVTAESLSHNLFHVLNSKWVIKAHPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTE 180
           KSVTAESLSHNLFHVLNSKWVIKAHPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTE
Sbjct: 121 KSVTAESLSHNLFHVLNSKWVIKAHPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTE 180

Query: 181 LILKAFDRRVYQLKKKGSIETR 202
           LILKAFDRRVYQLKKKGSIETR
Sbjct: 181 LILKAFDRRVYQLKKKGSIETR 202

>CAGL0E02387g 227464..228051 similar to tr|Q08058 Saccharomyces
           cerevisiae YOL008w, hypothetical start
          Length = 195

 Score =  183 bits (464), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 114/177 (64%), Gaps = 2/177 (1%)

Query: 27  LGKRSFFNLTTEASSKDEQHYVLKRNIRGTPXXXXXXXXXXXXXKDFIPYCTESFVNLRD 86
            G R FF+          Q YVL + I+GTP              +FIPYC +SFVN RD
Sbjct: 17  FGTRGFFDQLNPFHEIKTQKYVLPKIIQGTPSQVYDVVSEVSKYHEFIPYCEDSFVNERD 76

Query: 87  EKNRPVEAGLRVGFQQYDEKFVCKVQCKE--LSDLVKSVTAESLSHNLFHVLNSKWVIKA 144
           + N+P  AGLRVGF+QYDE+FVC V CK       V  V AESLSHNLF +L+S+W I  
Sbjct: 77  DSNKPKVAGLRVGFKQYDERFVCDVDCKSKVSGKEVYVVRAESLSHNLFDILSSQWTIST 136

Query: 145 HPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTELILKAFDRRVYQLKKKGSIET 201
           HP R D + VEL+L+++FKSRLY S++S+FAKSVTEL++ AF RRVY LKK   +E 
Sbjct: 137 HPTRKDASTVELLLKFKFKSRLYNSISSIFAKSVTELVMDAFARRVYHLKKAAVLEN 193

>YOL008W (YOL008W) [4808] chr15 (310312..310935) Member of the
           UPF0083 uncharacterized protein family, has moderate
           similarity to uncharacterized C. albicans Orf6.6771p
           [624 bp, 207 aa]
          Length = 207

 Score =  174 bits (441), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 113/166 (68%), Gaps = 2/166 (1%)

Query: 29  KRSFFNLTTEASSKDEQHYVLKRNIRGTPXXXXXXXXXXXXXKDFIPYCTESFVNLRDE- 87
           KR+FF L+    +  EQ YVL++ I   P             K+FIPYC +SFV+ R+  
Sbjct: 28  KRNFFGLSGTNHTIREQRYVLRKAINAPPSTVYAAVSEVAQYKEFIPYCVDSFVDKRNPV 87

Query: 88  KNRPVEAGLRVGFQQYDEKFVCKVQCKELSDLVKSVTAESLSHNLFHVLNSKWVIKAHPG 147
            N+P+ AGLRVGF+QYDE+F+C V CK+ +D   +V AE++SHNLFH+L SKW I  HP 
Sbjct: 88  DNKPLIAGLRVGFKQYDEEFICNVTCKD-TDHTYTVVAETISHNLFHLLISKWTIMPHPN 146

Query: 148 RTDHTEVELILRYQFKSRLYTSVASLFAKSVTELILKAFDRRVYQL 193
           R +   VEL+LR++FKSR+Y SV+ +FAK+VTEL++ AF +R Y L
Sbjct: 147 RPNAAMVELLLRFKFKSRIYNSVSLIFAKTVTELVMNAFAKRAYHL 192

>Scas_644.12
          Length = 210

 Score =  174 bits (440), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 117/174 (67%), Gaps = 6/174 (3%)

Query: 26  ALGKRSFFNLTTEASSKDEQHYVLKRNIRGTPXXXXXXXXXXXXXKDFIPYCTESFV--- 82
            +G+R+ F L+  +    EQ Y L + I   P               FIPYCTESFV   
Sbjct: 21  TVGRRNLFGLSLGSPEVKEQRYTLLKTINSPPTDVYNVVSEVSQYYKFIPYCTESFVEKR 80

Query: 83  NLRDEKNRPVEAGLRVGFQQYDEKFVCKVQCKEL-SDLVKSVTAESLSHNLFHVLNSKWV 141
           NL D K  P  AGLRVGF+QYDEKFVC+V CK+L +D   +V A SLSHNLFH+L SKW 
Sbjct: 81  NLLDGK--PTIAGLRVGFKQYDEKFVCEVSCKDLLADRDFTVEANSLSHNLFHLLYSKWT 138

Query: 142 IKAHPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTELILKAFDRRVYQLKK 195
           I+ HP R   TEVEL LR++FKSRLY +V+S+FAKSVT+L++ AF++RV++LK+
Sbjct: 139 IRPHPRRPQTTEVELSLRFKFKSRLYNAVSSIFAKSVTKLVMDAFEKRVFELKR 192

>ACL012W [1037] [Homologous to ScYOL008W - SH]
           complement(336674..337288) [615 bp, 204 aa]
          Length = 204

 Score =  169 bits (429), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 113/179 (63%), Gaps = 3/179 (1%)

Query: 20  PCPQASALGKRSFFNLTTEASSKDEQHYVLKRNIRGTPXXXXXXXXXXXXXKDFIPYCTE 79
           P    S + +R+F   T       EQ Y+LKR                   K FIPYCT+
Sbjct: 17  PLATPSCVSRRTFLGFT--GGDTKEQRYILKRVFNAPLHYVYPAVSEVSLYKLFIPYCTD 74

Query: 80  SFVN-LRDEKNRPVEAGLRVGFQQYDEKFVCKVQCKELSDLVKSVTAESLSHNLFHVLNS 138
           SFVN  R   N P EAGLRVGFQQYDE FVC+V C  L    +SV AESL+H+LF  L++
Sbjct: 75  SFVNKRRPGDNMPTEAGLRVGFQQYDETFVCRVDCTTLPGNQRSVVAESLAHHLFETLHT 134

Query: 139 KWVIKAHPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTELILKAFDRRVYQLKKKG 197
           +W++  HP R D + VELILR++FKS+LY SV+S+F   VT++++KAF++RV+QL+K+ 
Sbjct: 135 QWLLSPHPTRPDASVVELILRFKFKSQLYNSVSSIFGTRVTQVVMKAFEKRVFQLRKEA 193

>Sklu_2419.5 YOL008W, Contig c2419 6103-6720
          Length = 205

 Score =  167 bits (423), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 122/182 (67%), Gaps = 4/182 (2%)

Query: 20  PCPQA--SALGKRSFFNLTTEA-SSKDEQHYVLKRNIRGTPXXXXXXXXXXXXXKDFIPY 76
           P P++  + + +RS F L+  + ++  EQ YVL + I                 K+F+PY
Sbjct: 16  PGPKSVSNTVFRRSLFGLSNHSFNNTREQRYVLCKTINAPTVNVYEVVSEVSQYKEFMPY 75

Query: 77  CTESFVNLRDEK-NRPVEAGLRVGFQQYDEKFVCKVQCKELSDLVKSVTAESLSHNLFHV 135
           C ESFVN R++   +PVEAGL + F+ Y EKFVCKV+C    + +K+V AESL+H LF +
Sbjct: 76  CVESFVNKRNQDTGKPVEAGLMISFKHYVEKFVCKVECDSKLEGIKTVVAESLTHTLFDL 135

Query: 136 LNSKWVIKAHPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTELILKAFDRRVYQLKK 195
           L +KW I  HP R + TEVEL+LR++F S+LY S++S+FAKSVT L++KAF++R++QLKK
Sbjct: 136 LYTKWTIAPHPTRPNVTEVELLLRFKFHSKLYNSISSIFAKSVTGLVMKAFEKRIFQLKK 195

Query: 196 KG 197
           + 
Sbjct: 196 ES 197

>Kwal_56.22496
          Length = 194

 Score =  152 bits (383), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 108/175 (61%), Gaps = 5/175 (2%)

Query: 23  QASALGKRSFFNLTTEASSKDEQHYVLKRNIRGTPXXXXXXXXXXXXXKDFIPYCTESFV 82
           Q+  + +RSF    T   SK  Q ++L R I                   FIPYC ESFV
Sbjct: 16  QSKIVQRRSFL---TSTDSK-VQTFLLTRTINAPISDVYSVVSDISEYHKFIPYCLESFV 71

Query: 83  NLRDEK-NRPVEAGLRVGFQQYDEKFVCKVQCKELSDLVKSVTAESLSHNLFHVLNSKWV 141
           N +D+   +P EAG+RVGFQ+YDE FVC++ C +       V A+SL+H+LF  L +KW 
Sbjct: 72  NKKDDTTGKPTEAGMRVGFQRYDETFVCQINCSKGPSDRHVVVADSLTHSLFDFLQTKWT 131

Query: 142 IKAHPGRTDHTEVELILRYQFKSRLYTSVASLFAKSVTELILKAFDRRVYQLKKK 196
           ++ HP R + TE EL L+++FK  LY ++AS+F KSVTE ++K+FDRR+YQL K+
Sbjct: 132 MRPHPSRHNATEAELSLKFKFKFSLYNNIASIFGKSVTEHVMKSFDRRIYQLAKR 186

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,492,665
Number of extensions: 192699
Number of successful extensions: 493
Number of sequences better than 10.0: 13
Number of HSP's gapped: 484
Number of HSP's successfully gapped: 13
Length of query: 202
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 105
Effective length of database: 13,238,163
Effective search space: 1390007115
Effective search space used: 1390007115
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)