Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C06028g30530015080.0
Sklu_2419.42992478251e-110
ACL013C2632357482e-99
Kwal_56.224972802577345e-97
YOL009C (MDM12)2712666502e-84
Scas_644.112722416451e-83
CAGL0E02365g2572556181e-79
KLLA0F15796g434170973e-04
Scas_638.2445582957e-04
Sklu_2275.5454123840.015
Kwal_33.15169442115810.033
YLL006W (MMM1)426116790.070
YDR365C62871730.39
AAL166C444137720.50
KLLA0B14476g39576700.72
Kwal_55.2144464465700.79
CAGL0D05698g431109662.3
Scas_705.42767126636.0
YNL014W (HEF3)104436636.1
Sklu_2204.187696619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06028g
         (300 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06028g complement(532044..532961) some similarities with s...   585   0.0  
Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement        322   e-110
ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH] (335717..3...   292   2e-99
Kwal_56.22497                                                         287   5e-97
YOL009C (MDM12) [4807] chr15 complement(309324..310139) Mitochon...   254   2e-84
Scas_644.11                                                           253   1e-83
CAGL0E02365g complement(226360..227133) similar to sp|Q92328 Sac...   242   1e-79
KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces...    42   3e-04
Scas_638.24                                                            41   7e-04
Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement         37   0.015
Kwal_33.15169                                                          36   0.033
YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential f...    35   0.070
YDR365C (ESF1) [1191] chr4 complement(1204485..1206371) Protein ...    33   0.39 
AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315...    32   0.50 
KLLA0B14476g 1271319..1272506 similar to sp|P39676 Saccharomyces...    32   0.72 
Kwal_55.21444                                                          32   0.79 
CAGL0D05698g 541045..542340 similar to sp|P41800 Saccharomyces c...    30   2.3  
Scas_705.42                                                            29   6.0  
YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongat...    29   6.1  
Sklu_2204.1 YPR091C, Contig c2204 342-2972                             28   9.9  

>KLLA0C06028g complement(532044..532961) some similarities with
           sp|Q92328 Saccharomyces cerevisiae YOL009c MDM12
           involved in mitochondrial inheritance singleton,
           hypothetical start
          Length = 305

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/300 (96%), Positives = 290/300 (96%)

Query: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60
           MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD
Sbjct: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60

Query: 61  DPLDEFYSYLLQEGDISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMIL 120
           DPLDEFYSYLLQEGDISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMIL
Sbjct: 61  DPLDEFYSYLLQEGDISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMIL 120

Query: 121 PVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLENDKLQVDPSGPNFMGKRALERI 180
           PVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLENDKLQVDPSGPNFMGKRALERI
Sbjct: 121 PVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLENDKLQVDPSGPNFMGKRALERI 180

Query: 181 SLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDFTXXXX 240
           SLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDFT    
Sbjct: 181 SLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDFTPEDP 240

Query: 241 XXXXXXGRENDLVADSSNDGKDIEMKSGTEETLGAGIQESVQHVSPAVTSIDQESRVNSN 300
                 GRENDLVADSSNDGKDIEMKSGTEETLGAGIQESVQHVSPAVTSIDQESRVNSN
Sbjct: 241 EDPEEEGRENDLVADSSNDGKDIEMKSGTEETLGAGIQESVQHVSPAVTSIDQESRVNSN 300

>Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement
          Length = 299

 Score =  322 bits (825), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 152/247 (61%), Positives = 189/247 (76%), Gaps = 14/247 (5%)

Query: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60
           MS EI+WD ++ D  +NQ +KDF N  L+   LPSYVNN++VTNF LG +PP++ LKQ+D
Sbjct: 19  MSFEINWDKLQEDTRINQSIKDFFNDHLRSISLPSYVNNVQVTNFSLGNIPPHITLKQID 78

Query: 61  DPLDEFYSYLLQEGDISKEAAKD--------------KNTDVQLLVELDYKGDMSIELSA 106
           DPL+EFY Y+ +E +   E+  D              K  D+Q LVE+DYKGDM IE+ A
Sbjct: 79  DPLEEFYGYISKESNEKIESTSDEIEHDPQCPIVMDGKQNDIQFLVEIDYKGDMLIEVGA 138

Query: 107 DLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLENDKLQVDP 166
           +LVLNYPSP FM LPVKL ISDIGMH LCL+AYL KQLFISFLCDVSDP+L+N +  +D 
Sbjct: 139 ELVLNYPSPTFMTLPVKLSISDIGMHSLCLIAYLSKQLFISFLCDVSDPILDNSESILDT 198

Query: 167 SGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAA 226
           +GPNFM KR+LERISLIR+IKI +E+G+   GEGS LRSVGKLE+FLV++FRN +RKEAA
Sbjct: 199 NGPNFMSKRSLERISLIRSIKIQSEIGEYKDGEGSTLRSVGKLEQFLVEIFRNALRKEAA 258

Query: 227 WPSWIDL 233
           WPSWI+L
Sbjct: 259 WPSWINL 265

>ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH]
           (335717..336511) [795 bp, 264 aa]
          Length = 263

 Score =  292 bits (748), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 183/235 (77%), Gaps = 5/235 (2%)

Query: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60
           MS +I+W+ I  D ++NQ  + FLN  L+  +LPSYV+N+K+T+F LGT+PP + LKQ+D
Sbjct: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60

Query: 61  DPLDEFYSYLLQEGDISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMIL 120
           +PLD+FY  L  EG     A+     DVQ L+E+DYKGDM IELSA+LVLNYPSP FM L
Sbjct: 61  NPLDDFYEALRLEG-----ASIGGRDDVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQL 115

Query: 121 PVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLENDKLQVDPSGPNFMGKRALERI 180
           PVKL ISDI +H LCL+AYL++QLFISFL  VSD  L+N +  +D +GP F+G +A+ERI
Sbjct: 116 PVKLTISDIAIHSLCLVAYLQRQLFISFLGHVSDHALDNVESPLDSNGPAFLGSKAVERI 175

Query: 181 SLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDF 235
           SLIR+IKI TE+G  D  EG++LRSVGKLE+FL D+F+NL+RKEAAWPSWI+LDF
Sbjct: 176 SLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAAWPSWINLDF 230

>Kwal_56.22497
          Length = 280

 Score =  287 bits (734), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 183/257 (71%), Gaps = 22/257 (8%)

Query: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60
           MS EI+W+++  D  VN  +KDFLNS LQ   LPSYV +L+VT+F LG  PP + L+++ 
Sbjct: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60

Query: 61  DPLDEFYSYLLQE----------------------GDISKEAAKDKNTDVQLLVELDYKG 98
           +PL+EFY ++  E                       D S +  KD ++D+Q LVE+DYKG
Sbjct: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHGENDDSGKDEKDSDSDLQFLVEIDYKG 120

Query: 99  DMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLE 158
           DM I +SA+L LNYPSP FM LPVKL ISD+GMH LCL+AYL KQLFISFLCDV+DP+L+
Sbjct: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180

Query: 159 NDKLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFR 218
             +  +D     F+G R+LERISLIR+IKI +E+G+ +  EGSVLRSVG+LE+FL+++FR
Sbjct: 181 AQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVFR 240

Query: 219 NLIRKEAAWPSWIDLDF 235
            +++ EAAWPSWI+LDF
Sbjct: 241 TILKTEAAWPSWINLDF 257

>YOL009C (MDM12) [4807] chr15 complement(309324..310139)
           Mitochondrial inheritance protein which may function in
           a complex with Mdm10p at the mitochondrial surface [816
           bp, 271 aa]
          Length = 271

 Score =  254 bits (650), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 174/266 (65%), Gaps = 31/266 (11%)

Query: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60
           MS +I+W  +  D  +N  ++  LNS LQ  +LPSYV+NL+V +FDLG + P + LK++ 
Sbjct: 1   MSFDINWSTLESDNRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAITLKEIT 60

Query: 61  DPLDEFYSYLLQEGDISKEAAKDKN-------------------------------TDVQ 89
           DPLDEFY  + +E D   E   D                                  D+Q
Sbjct: 61  DPLDEFYDSIREEADQETEENNDNKEDSEHICPDRTIANHEGPKDDFEAPVVMPSPNDIQ 120

Query: 90  LLVELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFL 149
            L+E++YKGD+ + + ADLVLNYP  +FM LPVKL ISDIG+H LC++A L KQLF+SFL
Sbjct: 121 FLLEVEYKGDLLVTIGADLVLNYPVEKFMTLPVKLSISDIGLHSLCIVACLSKQLFLSFL 180

Query: 150 CDVSDPLLENDKLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKL 209
           CDVSDP L++++  +DP GP     + LERIS++R++KI TE+G+  QG+GSVLRSVG+L
Sbjct: 181 CDVSDPALDDNQTVLDPKGPILAATKPLERISIVRSMKIETEIGEQYQGQGSVLRSVGEL 240

Query: 210 EEFLVDLFRNLIRKEAAWPSWIDLDF 235
           E+FL  +F++ +RKE AWPSWI+LDF
Sbjct: 241 EQFLFTIFKDFLRKELAWPSWINLDF 266

>Scas_644.11
          Length = 272

 Score =  253 bits (645), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 122/241 (50%), Positives = 174/241 (72%), Gaps = 7/241 (2%)

Query: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60
           MS  I+W  I  D S+++ VKD L+S LQ   LPS+VNNLK+T+F  G + P +ILK++ 
Sbjct: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60

Query: 61  DPLDEFYSYL---LQEGDISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQF 117
           DPL +FY  +   L EGD  +       +D Q L+E++YKGD+ + +S +LVLNYPS +F
Sbjct: 61  DPLPDFYESVNEGLVEGD--EGWTIPSPSDTQFLIEVEYKGDLFVTMSGELVLNYPSQEF 118

Query: 118 MILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLL--ENDKLQVDPSGPNFMGKR 175
           + LP+KL +++IG H LCL+AYL KQ+F+S LCDVSDP+L  +N +  +DP+G     K+
Sbjct: 119 IKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQNSEPLLDPNGTFMAPKK 178

Query: 176 ALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDF 235
             ERIS+IR++ I TE+GQ  QGEGS L++VGKLE+FL++ F++L+RKE AWPSWI+LD 
Sbjct: 179 PFERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFKDLLRKEIAWPSWINLDL 238

Query: 236 T 236
           +
Sbjct: 239 S 239

>CAGL0E02365g complement(226360..227133) similar to sp|Q92328
           Saccharomyces cerevisiae YOL009c MDM12, start by
           similarity
          Length = 257

 Score =  242 bits (618), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 171/255 (67%), Gaps = 20/255 (7%)

Query: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60
           MS EI+W+ +  D  +   +++ LN   QE ELPSYV  +++ +F  G + PN+ L+++ 
Sbjct: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60

Query: 61  DPLDEFYSYLLQE-------------------GDISKEAA-KDKNTDVQLLVELDYKGDM 100
            PL +FY  + +E                   G+  +EA  + K TD Q L+E +YKGDM
Sbjct: 61  SPLQDFYDAVNEEYEEDNETSSEMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM 120

Query: 101 SIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLEND 160
           S+ L+A+LVLNYP  +FM LP+K+ IS+IG+H LCL++YL KQ+FIS LCDVSDP+L++ 
Sbjct: 121 SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMLCDVSDPVLDDV 180

Query: 161 KLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNL 220
              +DP+GP  +  + LERIS+IR++KI TE+G   + +GS LRSVG+LEEF+V   ++ 
Sbjct: 181 DCVLDPNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLKDF 240

Query: 221 IRKEAAWPSWIDLDF 235
           +RKE AWPSW++LDF
Sbjct: 241 LRKELAWPSWVNLDF 255

>KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1 required for mitochondrial shape
           and structure singleton, start by similarity
          Length = 434

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 72/170 (42%), Gaps = 33/170 (19%)

Query: 5   IDWDNIRGDLSVNQ-------------GVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMP 51
           +DW N+    +++Q              + DF+  R  E  LP Y++ +K+T  D+G   
Sbjct: 198 LDWFNVLIAQTIHQFREEALQKNNILNSLNDFIERRSNE--LPQYLDQIKITEVDIGD-- 253

Query: 52  PNVILKQMDDPLDEFYSYLLQEGDISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLN 111
                   D P+  F + ++Q    S +   +   D+      D    +++ +   L+LN
Sbjct: 254 --------DFPI--FSNCIIQYSPNSNKKRLEAKIDI------DLSDRLALGIETKLLLN 297

Query: 112 YPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLENDK 161
           YP P    LP+KL +S +       ++    + F+    + +D  + NDK
Sbjct: 298 YPKPFSAALPIKLTVSIVRFQACLTVSLTTDEQFVPTSEETNDDEMGNDK 347

>Scas_638.24
          Length = 455

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 87  DVQLLVELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFI 146
           ++Q  +++D    ++  +  +L+LNYP   F  LP+KL ++ +       +++   + FI
Sbjct: 287 NLQAKIDIDMNDRLAFGVETELMLNYPRAAFATLPIKLNVAIVRFQGCLNVSFTTAEDFI 346

Query: 147 SFLCD---VSDPLLENDKLQVD 165
           S   D    ++P  ENDK + D
Sbjct: 347 SKSSDTKTTTEPNNENDKNERD 368

>Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement
          Length = 454

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 55/123 (44%), Gaps = 21/123 (17%)

Query: 18  QGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEGDIS 77
             + DF+  +    ELP Y++++KVT  D+G               D+F  +       S
Sbjct: 243 HSLNDFIQRK--STELPHYLSSIKVTELDIG---------------DDFPIFSNCRIQYS 285

Query: 78  KEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLL 137
             + K +   ++  +++D    +++ +   L++NYP P    LPV+L +S +     CL 
Sbjct: 286 PNSNKKR---LEAKIDIDLSDRLALGIETKLLMNYPKPFTAALPVQLTVSIVRFQA-CLT 341

Query: 138 AYL 140
             L
Sbjct: 342 VSL 344

>Kwal_33.15169
          Length = 442

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 55/115 (47%), Gaps = 18/115 (15%)

Query: 32  ELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEGDISKEAAKDKNTDVQLL 91
           ELP Y++++K+T  D+G           D P+  F +  +Q    S  + K +   ++  
Sbjct: 247 ELPQYLDSIKITELDIGE----------DFPI--FSNCRIQ---YSPNSNKQR---LEAK 288

Query: 92  VELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFI 146
           +++D    +++ +   L++NYP P    LPV+L +S +       ++    + F+
Sbjct: 289 IDIDLSDRLALGIETKLLINYPKPFTAALPVQLTVSVVRFQACLTVSLTAAEEFV 343

>YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential for
           establishment and maintenance of mitochondrial shape and
           structure, involved in coupling mitochondria to the
           actin cytoskeleton, required for maintenance of
           mitochondrial genome [1281 bp, 426 aa]
          Length = 426

 Score = 35.0 bits (79), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 50/116 (43%), Gaps = 18/116 (15%)

Query: 32  ELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEGDISKEAAKDKNTDVQLL 91
           +LP Y++ +K+T  D G           D P+  F +  +Q       +    N  ++  
Sbjct: 236 DLPEYLDTIKITELDTGD----------DFPI--FSNCRIQY------SPNSGNKKLEAK 277

Query: 92  VELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFIS 147
           +++D    +++ +   L+LNYP P    LP+ L +S +       ++    + F S
Sbjct: 278 IDIDLNDHLTLGVETKLLLNYPKPGIAALPINLVVSIVRFQACLTVSLTNAEEFAS 333

>YDR365C (ESF1) [1191] chr4 complement(1204485..1206371) Protein of
           unknown function, has high similarity to uncharacterized
           C. albicans Orf6.504p [1887 bp, 628 aa]
          Length = 628

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 6/71 (8%)

Query: 139 YLKKQLFI--SFLCDVSDP----LLENDKLQVDPSGPNFMGKRALERISLIRNIKIHTEL 192
           Y KK+  +  +F  D+ DP    + E+    +DP+ P F G +A+ +I   R+ ++  + 
Sbjct: 530 YQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKK 589

Query: 193 GQLDQGEGSVL 203
            +L   E ++ 
Sbjct: 590 RKLGGSENNMT 600

>AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315)
           [1335 bp, 444 aa]
          Length = 444

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/137 (18%), Positives = 59/137 (43%), Gaps = 20/137 (14%)

Query: 18  QGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEGDIS 77
             + DF++ +  +  LP+Y++ +K+T  D+G               D+F  +       S
Sbjct: 234 HSLNDFISRKSSQ--LPNYLDAVKITELDIG---------------DDFPIFSNCRIKYS 276

Query: 78  KEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLL 137
               K +   ++  +++D    +++ +   L++NYP      LPVKL +S +       +
Sbjct: 277 PPLNKKR---LEAKIDIDLSDRLTLGIETRLLMNYPKYLTASLPVKLTVSMLRFQACLTV 333

Query: 138 AYLKKQLFISFLCDVSD 154
           +    + F+  +   +D
Sbjct: 334 SLTTAEEFVPTMAATTD 350

>KLLA0B14476g 1271319..1272506 similar to sp|P39676 Saccharomyces
           cerevisiae YGR234w YHB1 flavohemoglobin singleton, start
           by similarity
          Length = 395

 Score = 31.6 bits (70), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 13/76 (17%)

Query: 158 ENDKLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLF 217
           ++  LQV+P+  + +GK  L  I  +        LG     E  ++++ G+  + + D+F
Sbjct: 84  KHRALQVEPAQYDIVGKYLLLAIKEV--------LGSAATPE--IIQAWGEAYKVIADIF 133

Query: 218 RNL---IRKEAAWPSW 230
            ++   + K+AAWPSW
Sbjct: 134 ISVEKEMYKKAAWPSW 149

>Kwal_55.21444
          Length = 644

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 148 FLCDVSDP----LLENDKLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVL 203
           F  D++DP    + E+    +DPS P F G  A+++I   R  + H    +  + +G++ 
Sbjct: 562 FKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQNKKRKADGNLA 621

Query: 204 RSVGK 208
              G+
Sbjct: 622 NQNGQ 626

>CAGL0D05698g 541045..542340 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1, start by similarity
          Length = 431

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 47/109 (43%), Gaps = 19/109 (17%)

Query: 32  ELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEGDISKEAAKDKNTDVQLL 91
           +LP Y++ + +T  D+G           D P+  F +  +Q       A    +  ++  
Sbjct: 234 DLPDYLDKITITELDIGE----------DFPI--FSNCRIQY------APNSSDKKLEAK 275

Query: 92  VELDYKGDMSIELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYL 140
           +++D    ++  +S  L+LNYP      LP+ L +S +     CL   L
Sbjct: 276 IDIDLNDKITFGMSTRLLLNYPKKCTAALPIDLAVSMVRFQA-CLTVSL 323

>Scas_705.42
          Length = 767

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 24/126 (19%), Positives = 59/126 (46%), Gaps = 23/126 (18%)

Query: 15  SVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEG 74
           ++N+ + + ++ +L +   P +++NL V   D+GT  P +    +               
Sbjct: 302 TLNKALLEKVHKKLNKINKPGFLDNLVVEEIDVGTSAPFITNPSLR-------------- 347

Query: 75  DISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPS---PQFMILPVKLRISDIGM 131
           +IS E         ++ + L YKG++S+ +S  + +N  S   P+ + + + +++ +I  
Sbjct: 348 EISPEGL------TKIALNLQYKGNLSVIISTKVNINLGSRFKPREVSVQLAIKVKEISG 401

Query: 132 HCLCLL 137
             + L+
Sbjct: 402 PLIVLI 407

>YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongation
           factor EF-3B, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 7/36 (19%)

Query: 3   VEIDWDNIRGDLSV-------NQGVKDFLNSRLQEF 31
           VE D DN   D+SV       N G KD + S+L+EF
Sbjct: 495 VEHDIDNTHSDMSVLDFVYSGNVGTKDVITSKLKEF 530

>Sklu_2204.1 YPR091C, Contig c2204 342-2972
          Length = 876

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/96 (18%), Positives = 48/96 (50%), Gaps = 20/96 (20%)

Query: 16  VNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMDDPLDEFYSYLLQEGD 75
           ++Q +++ ++ +L +   P ++++ K+ N D+GT  P     ++++        L  EG 
Sbjct: 275 LSQVLREKIHKKLTKINKPGFLDDFKIENVDVGTSTPMFTHPRLEE--------LTPEGL 326

Query: 76  ISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLN 111
           +            ++ + + YKG++S+ +S  + +N
Sbjct: 327 M------------KIGLNMSYKGNLSLIISTKMNIN 350

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.136    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,661,957
Number of extensions: 420657
Number of successful extensions: 1157
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1143
Number of HSP's successfully gapped: 27
Length of query: 300
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 199
Effective length of database: 13,099,691
Effective search space: 2606838509
Effective search space used: 2606838509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)