Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C06006g51250426170.0
Sklu_2419.353139314200.0
ACL014C52447014170.0
Kwal_56.2249952739313071e-177
Scas_644.1051242212281e-165
YMR004W (MVP1)51144112041e-161
CAGL0J11704g50939811651e-156
KLLA0C10967g4002361512e-10
ACR074W4101871485e-10
Kwal_23.28964212301461e-09
Scas_690.224282041389e-09
Scas_663.19169961273e-08
CAGL0G06424g164961212e-07
ADR390C163971193e-07
YOR357C (GRD19)162951132e-06
CAGL0J01001g4301771147e-06
YJL036W (SNX4)4232021121e-05
Kwal_26.68581601571052e-05
Scas_580.31831171001e-04
ADR211W600991042e-04
Scas_322.217682982e-04
Sklu_1971.416582973e-04
CAGL0I01144g173102955e-04
ADR192C60366987e-04
Kwal_23.343861475970.001
KLLA0F16643g665109970.001
YDL113C (ATG20)64035970.001
Scas_613.2164934920.005
YOR069W (VPS5)67585910.005
CAGL0M12254g814105910.005
KLLA0E09141g63634900.007
Sklu_2428.6647100860.019
Sklu_2404.316368810.030
Sklu_2219.263432840.035
CAGL0H10428g75331840.035
Sklu_2167.434959830.037
Sklu_2221.567165840.040
Scas_714.5863682830.055
Scas_712.33357105810.073
CAGL0L10472g638101810.076
Kwal_14.104123079790.092
Kwal_47.1860162232790.15
Kwal_55.2153315967750.18
YHR105W (YPT35)21487760.21
YKR078W585172770.25
KLLA0A03718g16476730.30
KLLA0D01485g115141760.35
Kwal_26.913923071740.36
Scas_698.32699106750.42
YNL231C (PDR16)35158740.50
Kwal_47.1907934583711.2
YGL212W (VAM7)316281691.7
Kwal_55.21745629104692.0
CAGL0H01177g29765682.2
AFL124C62969692.6
CAGL0M09515g201130662.9
Kwal_47.1760915572635.6
YOR269W (PAC1)49482655.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C06006g
         (504 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C06006g complement(530169..531707) similar to sp|P40959 Sac...  1012   0.0  
Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement        551   0.0  
ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH] (333900..33...   550   0.0  
Kwal_56.22499                                                         508   e-177
Scas_644.10                                                           477   e-165
YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required fo...   468   e-161
CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces...   453   e-156
KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces c...    63   2e-10
ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH] complement(...    62   5e-10
Kwal_23.2896                                                           61   1e-09
Scas_690.22                                                            58   9e-09
Scas_663.19                                                            54   3e-08
CAGL0G06424g complement(621136..621630) highly similar to sp|Q08...    51   2e-07
ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH] (1410245.....    50   3e-07
YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protei...    48   2e-06
CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces cer...    49   7e-06
YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sort...    48   1e-05
Kwal_26.6858                                                           45   2e-05
Scas_580.3                                                             43   1e-04
ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -...    45   2e-04
Scas_322.2                                                             42   2e-04
Sklu_1971.4 YHR105W, Contig c1971 6476-6973                            42   3e-04
CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces cer...    41   5e-04
ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)...    42   7e-04
Kwal_23.3438                                                           42   0.001
KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces...    42   0.001
YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein th...    42   0.001
Scas_613.21                                                            40   0.005
YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorti...    40   0.005
CAGL0M12254g 1220771..1223215 weakly similar to sp|P39723 Saccha...    40   0.005
KLLA0E09141g complement(817829..819739) similar to sgd|S0002271 ...    39   0.007
Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement        38   0.019
Sklu_2404.3 YOR357C, Contig c2404 1457-1948                            36   0.030
Sklu_2219.2 YDL113C, Contig c2219 4054-5958                            37   0.035
CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces...    37   0.035
Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement         37   0.037
Sklu_2221.5 YDR425W, Contig c2221 7089-9104                            37   0.040
Scas_714.58                                                            37   0.055
Scas_712.33                                                            36   0.073
CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces...    36   0.076
Kwal_14.1041                                                           35   0.092
Kwal_47.18601                                                          35   0.15 
Kwal_55.21533                                                          33   0.18 
YHR105W (YPT35) [2393] chr8 (324768..325412) Protein that may pl...    34   0.21 
YKR078W (YKR078W) [3328] chr11 (584594..586351) Protein with sim...    34   0.25 
KLLA0A03718g 334828..335322 similar to sp|Q08826 Saccharomyces c...    33   0.30 
KLLA0D01485g 129351..132806 some similarities with sp|Q03735 Sac...    34   0.35 
Kwal_26.9139                                                           33   0.36 
Scas_698.32                                                            33   0.42 
YNL231C (PDR16) [4375] chr14 complement(215986..217041) Phosphat...    33   0.50 
Kwal_47.19079                                                          32   1.2  
YGL212W (VAM7) [1784] chr7 (91435..92385) Subunit of the vacuola...    31   1.7  
Kwal_55.21745                                                          31   2.0  
CAGL0H01177g 108423..109316 similar to tr|Q05521 Saccharomyces c...    31   2.2  
AFL124C [3071] [Homologous to ScYMR172W (HOT1) - SH] (201644..20...    31   2.6  
CAGL0M09515g 945440..946045 highly similar to sp|P25046 Saccharo...    30   2.9  
Kwal_47.17609                                                          29   5.6  
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    30   5.9  

>KLLA0C06006g complement(530169..531707) similar to sp|P40959
           Saccharomyces cerevisiae YMR004w MVP1 required for
           vacuolar protein sorting singleton, start by similarity
          Length = 512

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/504 (97%), Positives = 492/504 (97%)

Query: 1   MDLEADPWRVXXXXXXXXXXXXVWEPDNSSVNALKSYSADSLQQEANKRVNDDYLGVNIF 60
           MDLEADPWRV            VWEPDNSSVNALKSYSADSLQQEANKRVNDDYLGVNIF
Sbjct: 1   MDLEADPWRVNSEENGNNISGSVWEPDNSSVNALKSYSADSLQQEANKRVNDDYLGVNIF 60

Query: 61  SNGDNIVRGTASNVYQNDVLWDRPNIGSTTQETDIRGVNRFQATDTPQYAANDEYKNWVE 120
           SNGDNIVRGTASNVYQNDVLWDRPNIGSTTQETDIRGVNRFQATDTPQYAANDEYKNWVE
Sbjct: 61  SNGDNIVRGTASNVYQNDVLWDRPNIGSTTQETDIRGVNRFQATDTPQYAANDEYKNWVE 120

Query: 121 SVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDW 180
           SVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDW
Sbjct: 121 SVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDW 180

Query: 181 LQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLT 240
           LQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLT
Sbjct: 181 LQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLT 240

Query: 241 FLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKADERIDIALDTWVK 300
           FLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKADERIDIALDTWVK
Sbjct: 241 FLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKADERIDIALDTWVK 300

Query: 301 VTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALYPQSTATVSQINEGVGLIVEHLNS 360
           VTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALYPQSTATVSQINEGVGLIVEHLNS
Sbjct: 301 VTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALYPQSTATVSQINEGVGLIVEHLNS 360

Query: 361 CADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQLQRRVEINQERLN 420
           CADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQLQRRVEINQERLN
Sbjct: 361 CADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQLQRRVEINQERLN 420

Query: 421 TLESNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFTIFHETQFLITDCFQ 480
           TLESNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFTIFHETQFLITDCFQ
Sbjct: 421 TLESNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFTIFHETQFLITDCFQ 480

Query: 481 RWIEINLRYTNNNVDNWEKICKKL 504
           RWIEINLRYTNNNVDNWEKICKKL
Sbjct: 481 RWIEINLRYTNNNVDNWEKICKKL 504

>Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement
          Length = 531

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/393 (64%), Positives = 314/393 (79%)

Query: 112 NDEYKNWVESVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSDDRTV 171
           +D    W+E+VR TY PL+ DIV VEEIPEREG++FKHTNYLVKHL  LP+TDPS DR+V
Sbjct: 131 DDVLATWIEAVRTTYNPLSTDIVIVEEIPEREGILFKHTNYLVKHLIVLPDTDPSSDRSV 190

Query: 172 VRRYSDFDWLQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKHPV 231
           +RRYSDF WLQ+VLL+KYPFRM+PELPPKKIGS +AD  FL KRR+GLSRFINLVMKHPV
Sbjct: 191 IRRYSDFVWLQEVLLKKYPFRMIPELPPKKIGSHSADRAFLLKRRRGLSRFINLVMKHPV 250

Query: 232 LRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKADERI 291
           L  DDLVLTFLTVPTDLSGWRKQA YDTT+EFTDK IS SFM +WRKE +EQWN+AD +I
Sbjct: 251 LNHDDLVLTFLTVPTDLSGWRKQASYDTTEEFTDKKISKSFMKMWRKELAEQWNEADSKI 310

Query: 292 DIALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALYPQSTATVSQINEGV 351
           D+AL+TW K+TVL+ERY +R+KQ++ +R L   I+N    T  +LYP +  T+  IN   
Sbjct: 311 DLALETWAKITVLVERYSRRLKQISEDRTLFESIVNEFTQTAPSLYPINKDTIEDINAHT 370

Query: 352 GLIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQLQRR 411
           G+I +HL+ C  +  +E EE    L V+FK FID+I +LKGLFERYK++AGNNI QLQRR
Sbjct: 371 GIITKHLSDCNQLTSKEIEETHLNLLVKFKIFIDMIFSLKGLFERYKILAGNNIAQLQRR 430

Query: 412 VEINQERLNTLESNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFTIFHET 471
           VE+N E +N ++  PDV+GAEYD+VKQ++ RDKR+I +QMNRSWLIRECILEEFTIF ET
Sbjct: 431 VELNIETMNNMKGKPDVRGAEYDKVKQAVQRDKRTIAEQMNRSWLIRECILEEFTIFQET 490

Query: 472 QFLITDCFQRWIEINLRYTNNNVDNWEKICKKL 504
           QF+IT  FQ W ++N++Y + N + WE++   L
Sbjct: 491 QFVITHSFQEWAKLNMKYADLNSNEWERLFDSL 523

>ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH]
           (333900..335474) [1575 bp, 524 aa]
          Length = 524

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/470 (55%), Positives = 347/470 (73%), Gaps = 18/470 (3%)

Query: 41  SLQQEANKRVNDDYLGVNIFSNGDNIVRGTASNVYQNDVLWDRPNIGSTTQETDIRGVNR 100
           SL  E  + + ++Y    ++  G   +  T         +W  P    +  +  I G++ 
Sbjct: 59  SLSAEVKETMRNNYNERKMYEPGTPALEQT---------VWGAP---PSQLDASISGLDT 106

Query: 101 FQATDTPQYAANDEY-----KNWVESVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVK 155
             A    Q +  DE      +NW+ S RKTY PLA++IV VEEIPEREG++FKHTNYLVK
Sbjct: 107 SMAPVASQSSMCDELHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVK 166

Query: 156 HLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKR 215
           HL  LPNT+PS ++TV+RRYSDF+WLQ+VLL+KYPFRM+PELPPKKIG+QNADP+FLA+R
Sbjct: 167 HLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARR 226

Query: 216 RKGLSRFINLVMKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNL 275
           RKGL RFINLV+ HPVL+ DDLVLTFLTVPTDL  WRKQA+YDTT+EFTD+ I  +F++L
Sbjct: 227 RKGLCRFINLVIMHPVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISL 286

Query: 276 WRKEFSEQWNKADERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEA 335
           W KE S QWNKAD +ID  L++W+K +VL+ERYE+RM+QV+ ER+LLG+++    D +  
Sbjct: 287 WHKELSNQWNKADAKIDELLESWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVT 346

Query: 336 LYP-QSTATVSQINEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKGLF 394
           LYP +       IN  +  I +HLNS AD  ++E +EV+  LSV+FK FID+IIALKG+F
Sbjct: 347 LYPLEEGHLFHDINSHISTISKHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVF 406

Query: 395 ERYKMMAGNNIPQLQRRVEINQERLNTLESNPDVKGAEYDRVKQSISRDKRSILDQMNRS 454
           +RYK+MAGNNI  LQRRVEIN ++L ++ESNPDVKGAEYD+++Q+I RDKR+I +Q+NRS
Sbjct: 407 DRYKIMAGNNIAHLQRRVEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRS 466

Query: 455 WLIRECILEEFTIFHETQFLITDCFQRWIEINLRYTNNNVDNWEKICKKL 504
           WLIR+CILEEF IF ETQF IT  FQ W +++++Y N   ++WEK+   L
Sbjct: 467 WLIRKCILEEFVIFQETQFCITHVFQEWAKMHVKYANETTESWEKVYANL 516

>Kwal_56.22499
          Length = 527

 Score =  508 bits (1307), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 224/393 (56%), Positives = 303/393 (77%)

Query: 110 AANDEYKNWVESVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSDDR 169
           +   ++++W E+VRK+Y PL  DI+ VEE+PEREGL+FKHTNYLV+HL  LP+T PS DR
Sbjct: 125 SGRQDFESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDR 184

Query: 170 TVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKH 229
           +V+RRYSDF WLQ+VLL+KYPFRM+P+LPPK+IGS   DP+F  KRR GLSRFINLV+KH
Sbjct: 185 SVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKH 244

Query: 230 PVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKADE 289
           PV + DDLVLTFLTVPTDL GWRKQA YDT+DEFTD+ +S +F+ +W K  +E+WN+AD 
Sbjct: 245 PVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAERWNEADA 304

Query: 290 RIDIALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALYPQSTATVSQINE 349
            ID AL+ W K+TVLI+RYE+RM  +A +R +L  +L+   +    L+     + + I +
Sbjct: 305 NIDTALELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGSTNVIGD 364

Query: 350 GVGLIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQLQ 409
            +G + +H  SC +++ +EN+E    LS RF+ F D ++ALKGLFERYK MAGNN+PQLQ
Sbjct: 365 HLGRVSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMAGNNVPQLQ 424

Query: 410 RRVEINQERLNTLESNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFTIFH 469
           RR+E+N +RL  ++  PD+KGAEYDRVKQSI RD+++I +QMNRSWL+RECIL+E+  F 
Sbjct: 425 RRIEVNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQEYVYFQ 484

Query: 470 ETQFLITDCFQRWIEINLRYTNNNVDNWEKICK 502
           E QFLI+D FQRW+ +N++Y   N + W+K+ +
Sbjct: 485 EAQFLISDIFQRWVLLNMKYYELNSNEWDKLLQ 517

>Scas_644.10
          Length = 512

 Score =  477 bits (1228), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/422 (52%), Positives = 307/422 (72%), Gaps = 5/422 (1%)

Query: 84  PNIGSTTQETDIRGVNRFQATDTPQYAANDEYKNWVESVRKTYFPLAEDIVSVEEIPERE 143
           PNI    Q    +G +  Q+++  Q   ++ +  W + +RK+Y PL  DI+++EEIPERE
Sbjct: 87  PNINQP-QSGPTQGQSHEQSSELDQ---SELFGQWCDQIRKSYNPLGPDIITIEEIPERE 142

Query: 144 GLVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIG 203
           GL+FKHTNY VKHL  LP  D + D  VVRRYSDF WLQ+ LLR+YPFRMVPELPPKK+G
Sbjct: 143 GLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLG 202

Query: 204 SQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEF 263
           SQ AD +FL KRRKGL RFINLVMKHPV + DDLVLTFLTVPT+LS WRKQA +DT+DEF
Sbjct: 203 SQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWRKQASFDTSDEF 262

Query: 264 TDKHISSSFMNLWRKEFSEQWNKADERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLG 323
            DK I++SF+ +W K  SEQWN A   I+  ++ W ++ +L+ER+E+++KQ+AHE+ + G
Sbjct: 263 IDKRIAASFVKMWHKGISEQWNNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFG 322

Query: 324 QILNAIPDTTEALYP-QSTATVSQINEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKA 382
            ++N + + T  LYP + + TV  IN    +I +HLN   D+ +    +  + L  +FK 
Sbjct: 323 SLVNDLSNLTPNLYPIEQSDTVLDINNHFSIIKKHLNKTQDIAQDNATKTCNSLLPKFKL 382

Query: 383 FIDVIIALKGLFERYKMMAGNNIPQLQRRVEINQERLNTLESNPDVKGAEYDRVKQSISR 442
           F D++++L+GLFERYK+MA NNIPQLQR V +N+E+L  ++  PD  G EYDR+K SI+R
Sbjct: 383 FTDILLSLRGLFERYKIMATNNIPQLQRHVVLNREKLEAMKGKPDANGVEYDRIKMSITR 442

Query: 443 DKRSILDQMNRSWLIRECILEEFTIFHETQFLITDCFQRWIEINLRYTNNNVDNWEKICK 502
           DK+SI +Q+NR+WL+R+CILEEFTIF ETQF++T  FQ W ++N  +   N++ WEK+ +
Sbjct: 443 DKKSISEQLNRAWLVRKCILEEFTIFQETQFMLTRAFQDWSKLNASFVGINLNEWEKLEE 502

Query: 503 KL 504
           +L
Sbjct: 503 QL 504

>YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required for
           sorting proteins to the vacuole, interacts genetically
           with Vps1p [1536 bp, 511 aa]
          Length = 511

 Score =  468 bits (1204), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 321/441 (72%), Gaps = 13/441 (2%)

Query: 77  NDVL----WD--RPNIGST--TQETDIRG----VNRFQATDTPQYAANDEYKNWVESVRK 124
           NDVL    WD  R  +G+T  +Q  +I      +++  A D     +  +  +W  +VRK
Sbjct: 63  NDVLEESIWDDSRNPLGATGMSQTPNIAANETVIDKNDARDQNIEESEADLLDWTNNVRK 122

Query: 125 TYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDV 184
           TY PL  DI+ +EEIPEREGL+FKH NYLVKHL  LP+T PS++RTVVRRYSDF WL+++
Sbjct: 123 TYRPLDADIIIIEEIPEREGLLFKHANYLVKHLIALPSTSPSEERTVVRRYSDFLWLREI 182

Query: 185 LLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLTV 244
           LL++YPFRM+PELPPK+IGSQNAD LFL KRR GLSRFINLVMKHP L +DDLVLTFLTV
Sbjct: 183 LLKRYPFRMIPELPPKRIGSQNADQLFLKKRRIGLSRFINLVMKHPKLSNDDLVLTFLTV 242

Query: 245 PTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKADERIDIALDTWVKVTVL 304
            TDL+ WRKQA YDT++EF DK IS  FM +W+KEF+EQWN+A   ID +++ W ++T+L
Sbjct: 243 RTDLTSWRKQATYDTSNEFADKKISQEFMKMWKKEFAEQWNQAASCIDTSMELWYRITLL 302

Query: 305 IERYEKRMKQVAHERKLLGQILNAIPDTTEALYP-QSTATVSQINEGVGLIVEHLNSCAD 363
           +ER+EKR+ Q+ HER     +++   + T  LYP Q   T+  IN  + +I +HL + + 
Sbjct: 303 LERHEKRIMQMVHERNFFETLVDNFSEVTPKLYPVQQNDTILDINNNLSIIKKHLETTSS 362

Query: 364 VIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQLQRRVEINQERLNTLE 423
           + ++E EE+   LS +FK F D++++L+ LFERYK+MA NN+ +LQR VE+N+E+L +++
Sbjct: 363 ICKQETEEISGTLSPKFKIFTDILLSLRSLFERYKIMAANNVVELQRHVELNKEKLESMK 422

Query: 424 SNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFTIFHETQFLITDCFQRWI 483
             PDV GAEYDR+K+ I +D+RSI++Q NR+WLIR+CILEEFTIF ETQFLIT  FQ W 
Sbjct: 423 GKPDVSGAEYDRIKKIIQKDRRSIIEQSNRAWLIRQCILEEFTIFQETQFLITRAFQDWA 482

Query: 484 EINLRYTNNNVDNWEKICKKL 504
           ++N  +    ++ WEK+   +
Sbjct: 483 KLNSNHAGLKLNEWEKLVTSI 503

>CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces
           cerevisiae YMR004w MVP1 required for vacuolar protein
           sorting, hypothetical start
          Length = 509

 Score =  453 bits (1165), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 203/398 (51%), Positives = 290/398 (72%), Gaps = 1/398 (0%)

Query: 108 QYAANDEYKNWVESVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSD 167
           Q +  +  ++W+  VRKTY P   DI+S+EEIPEREGL+FKH NY VKHL  LPNT+P  
Sbjct: 104 QNSFTESLESWINEVRKTYNPQQLDIISIEEIPEREGLLFKHANYSVKHLIDLPNTEPPK 163

Query: 168 DRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVM 227
           +RTVVRRYSDF WLQ+VLL++YPFRM+P+LPPKKIGSQN DP+FL KRR GLS+FINLVM
Sbjct: 164 NRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLVM 223

Query: 228 KHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKA 287
           KHP L  DDLVLTFLTVPTDL+ WRKQ  YDT DEFTDK IS  F+ +W+K+ +E WN  
Sbjct: 224 KHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKKDLAEIWNNT 283

Query: 288 DERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALYP-QSTATVSQ 346
              ID  +D W K+++L++R+EKR++ +A+ERK++  +++ + + T+++YP     T+  
Sbjct: 284 ANCIDELIDKWTKISILVDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPIDQNPTILD 343

Query: 347 INEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIP 406
           IN G+ +I +H+    +   ++  +    +  +F+ + D++ ALK +FERYKM+A NN+ 
Sbjct: 344 INSGMTVISKHIEKTNENYNQQALDTKQKVLPKFRMYTDILRALKNVFERYKMLATNNVS 403

Query: 407 QLQRRVEINQERLNTLESNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFT 466
            LQ+ +++N ++L  ++  PD  G EYDR+K +I +D++ + +Q NR+WLIRECILEEFT
Sbjct: 404 MLQKHIDLNLQKLEDMKGKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLIRECILEEFT 463

Query: 467 IFHETQFLITDCFQRWIEINLRYTNNNVDNWEKICKKL 504
           IF ETQF+IT CFQ W ++   Y++ N++ WE +   +
Sbjct: 464 IFQETQFMITGCFQEWAKVQSTYSSLNLNEWENVTNHI 501

>KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4 singleton, hypothetical start
          Length = 400

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 107/236 (45%), Gaps = 31/236 (13%)

Query: 171 VVRRYSDFDWLQDVLLRKYPFRMVPELPPKKI----GSQNADPLFLAKRRKGLSRFINLV 226
           VVRRY+DF  L  +L+  +P  +VP LP KK+            F  KR + L  F+  +
Sbjct: 52  VVRRYNDFVLLHQILINDHPALLVPPLPDKKVLNYLSGDRFSHSFTQKRCRSLQTFMRRL 111

Query: 227 MKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYD-TTDEFTDKHISS-SFMNLWRKEFSEQW 284
           + H  L    ++ TFLT  TD   +R+      +T E +D  I++   +N  R EF E  
Sbjct: 112 LSHSELSKSRILETFLT-STDWDVYRRSLTGQISTSEVSDVLINAFKHVNRQRDEFVEIK 170

Query: 285 NKADERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALY------P 338
            K+ E++D  L    K+      + K +K+V     L+GQ L  +  +   L        
Sbjct: 171 EKS-EKLDHNLSHLDKL------FHKSVKRV----DLIGQNLKKLQSSLSGLQELCCDEK 219

Query: 339 QSTATVSQINEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKGLF 394
           + + ++   N+G   +++ LN         N+ VD   +V  K  I+ I ALK L 
Sbjct: 220 ELSNSIKAFNDGTMQLIDSLNDL-------NKYVDYEYNVDIKDMINYIEALKQLI 268

>ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH]
           complement(496156..497388) [1233 bp, 410 aa]
          Length = 410

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 88/187 (47%), Gaps = 19/187 (10%)

Query: 151 NYLVKHLTPLPNTDP-----SDDRTVV-RRYSDFDWLQDVLLRKYPFRMVPELPPKKIGS 204
           +Y+   ++  P T+       DD TVV RRYSDF  L  +L   YP  +VP LP KK+ +
Sbjct: 29  SYVTYQISSKPATEGDKRSGEDDITVVHRRYSDFVLLYQILANDYPACIVPPLPDKKVLN 88

Query: 205 --QNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDE 262
                   F  KR   L  F+  + +HPVL    ++ TFL V +D   ++K       + 
Sbjct: 89  YLDRFSQSFTQKRCHSLQNFLQRLAQHPVLSQSKILHTFL-VSSDWDAYQKSLAETVGNL 147

Query: 263 FTDKHISSSFMNLWRKEFSEQWNKADERIDI-----ALDTWV-KVTVLIERYEKRMKQVA 316
              + ++ + MN ++   S+    +DE ++I      LD  V K+  L  R  K+ + +A
Sbjct: 148 SNKEELTETIMNAFKSVHSQ----SDEFVEIKEKSGKLDHNVSKIDKLFHRVVKKQEAIA 203

Query: 317 HERKLLG 323
            +   LG
Sbjct: 204 EDYGKLG 210

>Kwal_23.2896
          Length = 421

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 102/230 (44%), Gaps = 29/230 (12%)

Query: 158 TPLPNTDPSDDRTVV---RRYSDFDWLQDVLLRKYPFRMVPELPPKK----IGSQNADPL 210
           T   NT P ++  ++   RRYSDF  LQ +L + +P  ++P LP KK    I        
Sbjct: 54  TKSQNTTPLEEIDIIVVHRRYSDFLLLQSILSQDHPTCVIPPLPDKKVFQYIAGDRFSQS 113

Query: 211 FLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISS 270
           F  KR   L  F+  + +HP+L    +++TFL +  D   +R+      +     + +S 
Sbjct: 114 FTQKRCHSLQNFLRRISEHPILSKSQVLMTFL-MSNDWEAYRRSLSGSLSG--NKEEVSD 170

Query: 271 SFMNLWR------KEFSEQWNKADERIDIALDTWV-KVTVLIERYEKRMKQVAHERKLLG 323
           +FMN ++      +EF+E   K+D+     LD  V K+  +  R  KR   ++ +     
Sbjct: 171 TFMNAFKTVHNQTEEFAEIKEKSDK-----LDHNVSKIDKVFHRVVKRQDAISEDYAKFS 225

Query: 324 QILNAIPD-----TTEALYPQSTATVSQINEGVGLIVEHLNSCADVIERE 368
             L  + +     T E    +S A +   NEGV  +   L   +  +E E
Sbjct: 226 TNLQELQELVADSTAEDETLRSKAKL--FNEGVSQLSYGLRDLSKFLEYE 273

>Scas_690.22
          Length = 428

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 88/204 (43%), Gaps = 9/204 (4%)

Query: 171 VVRRYSDFDWLQDVLLRKYPFRMVPELPPKK----IGSQNADPLFLAKRRKGLSRFINLV 226
           V RRYSD   L D+L+  +P  ++P LP KK    I        F  KR   L  F+  V
Sbjct: 77  VHRRYSDLVLLHDILMNDHPTCIIPPLPDKKVLQYIAGDRFSQRFTQKRCHSLQNFLRRV 136

Query: 227 MKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWR--KEFSEQW 284
             HP+L    ++ TFL +  D   +RK    +   +   + ++ +FMN ++   + SE++
Sbjct: 137 SLHPILSKSKILETFL-IDADWDAYRKSLSGNI--QTNKEEVTDAFMNAFKTVHKQSEEF 193

Query: 285 NKADERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPDTTEALYPQSTATV 344
            +  E+ D    T  K+     +  K+ + ++ +   L Q L  + +            +
Sbjct: 194 VEIKEKSDKLDHTLSKLDKNFHKMTKKNESISEDYGKLEQTLQDLNELISGDNEPLGRKL 253

Query: 345 SQINEGVGLIVEHLNSCADVIERE 368
              NEG+  +   LN     I+ E
Sbjct: 254 KFFNEGITQLSYGLNDLNKYIDYE 277

>Scas_663.19
          Length = 169

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 7/96 (7%)

Query: 150 TNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRK------YPFRMVPELPPKKIG 203
           T+Y +   T LPN   S +  V RRYSDF++ +  LL++      +P  M+P LP K   
Sbjct: 64  TDYEIVCHTNLPNFK-SRNSKVRRRYSDFEFFKKCLLKEISMFTNHPRIMIPHLPGKIFL 122

Query: 204 SQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVL 239
           +   +P  + +R +GL +++  V  HP+L+S   VL
Sbjct: 123 NNRFNPEVIEERMQGLDKWLKTVAGHPLLQSGSKVL 158

>CAGL0G06424g complement(621136..621630) highly similar to sp|Q08826
           Saccharomyces cerevisiae YOR357c GRD19, hypothetical
           start
          Length = 164

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 6/96 (6%)

Query: 149 HTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKY-----PFRMVPELPPKKIG 203
           +T+Y +   T LPN      R V RRYSDF++ +  LL++      P  +VP LP K   
Sbjct: 59  YTDYEIICRTNLPNFHKRASR-VRRRYSDFEFFRKCLLKEISMLNNPRVVVPHLPGKIYL 117

Query: 204 SQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVL 239
           S       + +RR+GL+R++ +V  HP+L+S    L
Sbjct: 118 SNRFSDEVIEERRQGLNRWMQIVAGHPLLQSGSKTL 153

>ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH]
           (1410245..1410736) [492 bp, 163 aa]
          Length = 163

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 56/97 (57%), Gaps = 6/97 (6%)

Query: 149 HTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRK-----YPFRMVPELPPKKIG 203
           +T+YLV   T LP+  P     V RRYSDF++ +  L ++     +P  ++P LP K + 
Sbjct: 58  YTDYLVVCRTNLPSF-PQRVSHVRRRYSDFEFFKRCLFKELSLSAHPRVVIPALPGKILW 116

Query: 204 SQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLT 240
           ++      + +RR+GL+++++ V  HP+L+S   VL 
Sbjct: 117 ARRFHDEVIEERREGLAQWLSTVAGHPLLQSGSKVLV 153

>YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protein
           involved in retrieval of late Golgi membrane proteins
           from the prevacuolar compartment [489 bp, 162 aa]
          Length = 162

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 6/95 (6%)

Query: 150 TNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRK-----YPFRMVPELPPKKIGS 204
           T+Y +   T LP+      + V RRYSDF++ +  L+++     +P  MVP LP K + S
Sbjct: 58  TDYEIICRTNLPSFHKRVSK-VRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLS 116

Query: 205 QNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVL 239
                  + +RR+GL+ ++  V  HP+L+S   VL
Sbjct: 117 NRFSNEVIEERRQGLNTWMQSVAGHPLLQSGSKVL 151

>CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4, hypothetical start
          Length = 430

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 19/177 (10%)

Query: 167 DDRTVV-RRYSDFDWLQDVLLRKYPFRMVPELPPKK----IGSQNADPLFLAKRRKGLSR 221
           DD  VV RRY+D   L D+L   +P  ++P LP KK    I        F  +R   L  
Sbjct: 75  DDIIVVHRRYNDVVLLHDILQNDHPTCIIPPLPDKKVLQYIAGDRFGRRFTQRRCHSLQN 134

Query: 222 FINLVMKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRK--- 278
           F+  V +HP+L +  ++  FL V  +   +RK     T      + ++ + MN ++K   
Sbjct: 135 FLRRVSQHPILSTSKVLEIFL-VGNEWDTYRKNIA-GTLQNAQKEDVTDAVMNAFKKVHN 192

Query: 279 ---EFSEQWNKADERIDIALDTWV-KVTVLIERYEKRMKQVAHERKLLGQILNAIPD 331
              EF+E  +++D+     LD  V ++  +  R  K+ + +  +   LG  L  + +
Sbjct: 193 QNEEFTEIRDRSDK-----LDNSVNRINKVFHRVVKKNEAIIEDYSKLGLTLQELQE 244

>YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sorting
           protein, possibly involved in proteasome function [1272
           bp, 423 aa]
          Length = 423

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 86/202 (42%), Gaps = 25/202 (12%)

Query: 164 DPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKK----IGSQNADPLFLAKRRKGL 219
           DP     V RRYSD   L D+LL ++P  ++P LP KK    I        F  KR   L
Sbjct: 68  DPESIIVVHRRYSDLLLLHDILLNRFPTCIIPPLPDKKVFQYIAGDRFSQRFTQKRCHSL 127

Query: 220 SRFINLVMKHPVLRSDDLVLTFLTVPTDLSGWRK---QAHYDTTDEFTDKHISSSFMNLW 276
             F+  V  HP L    +  TFL V  D    RK    +     DE TD     +FMN +
Sbjct: 128 QNFLRRVSLHPDLSQSKVFKTFL-VSKDWESHRKVLQDSLQPNKDEVTD-----AFMNAF 181

Query: 277 R------KEFSEQWNKADERIDIALD-TWVKVTVLIERYEKRMKQVAHERKLLGQILNAI 329
           +      +EF+E   K+D+     LD T  K+  L  +  K+   ++ +   LG  L  +
Sbjct: 182 KTVHKQNEEFTEIREKSDK-----LDRTVTKIDKLFHKVVKKNDSMSEDYTKLGSNLQEL 236

Query: 330 PDTTEALYPQSTATVSQINEGV 351
            +       +  A +   NEGV
Sbjct: 237 QELVTGENEELAAKLKIFNEGV 258

>Kwal_26.6858
          Length = 160

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 78/157 (49%), Gaps = 20/157 (12%)

Query: 88  STTQETDIRGVNRFQATDTPQYAANDEYKNWVESVRKTYFPLAEDIVSVEEIPEREGLVF 147
           ST+ E+ +   ++ Q T +  YA  + +     +  KT+FP           P++ G+  
Sbjct: 8   STSVESSLLQPHK-QQTSSEIYAEPENFLEIEVTNPKTHFPQ----------PDQHGM-- 54

Query: 148 KHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRK-----YPFRMVPELPPKKI 202
            +T+Y V   T +P       + V RRYS+F+  +  L+++     +P  +VP LP K +
Sbjct: 55  -YTDYEVICRTNVPAFSKRMSK-VRRRYSEFELFRKCLIKELSLSSHPKVVVPHLPGKIL 112

Query: 203 GSQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVL 239
                +   + +R++GL++++  V  HP+L+S   VL
Sbjct: 113 LGNRFNDEVIEERKQGLNKWLVAVAGHPLLQSGSKVL 149

>Scas_580.3
          Length = 183

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 18/117 (15%)

Query: 146 VFKHTNYLVKHLTPLPNTDPSDDRTVV--------RRYSDFDWLQDVLLRKYPFRM-VPE 196
           V+K T ++     P P T  S     +        +RYSDF   ++ ++ K   RM +P 
Sbjct: 67  VWKITVFVASRYGPNPPTSSSPTNIPIGSPQIQTYKRYSDFVAFRNSIMNKLGDRMEIPS 126

Query: 197 LPPK-------KIGSQNADPLFLAKRRKGLSRFINLVM--KHPVLRSDDLVLTFLTV 244
           LPP        K    N D  +LAKRR+GL RF+  V+  +  VL + + + TFL +
Sbjct: 127 LPPGVPWYDSWKYQDVNFDKKWLAKRRRGLERFLEQVLLDRELVLLAKNEIRTFLGL 183

>ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -
           SH] complement(1072310..1074112) [1803 bp, 600 aa]
          Length = 600

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 6/99 (6%)

Query: 146 VFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPK-KIGS 204
            F H  Y V+  +PL       + +V RRY DF WL   L   +  +++P  P K K+G 
Sbjct: 218 TFSHVEYSVRTRSPLVG---DAEVSVQRRYRDFRWLYRQLQSNHWGKVIPPPPDKQKVGR 274

Query: 205 QNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLT 243
              D  F+  RR  + R +  + ++  L++D   L FLT
Sbjct: 275 FKQD--FIENRRFQMERMLQRIAQNAALQNDQDFLLFLT 311

>Scas_322.2
          Length = 176

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 11/82 (13%)

Query: 157 LTPLPNTDPSDDRT-VVRRYSDFDWLQDVLLRKYPFRM---VPELPPK-------KIGSQ 205
           L P   +  S  R  + +RYSDF+ L++ L++  P  +   +P LPPK       +    
Sbjct: 76  LAPTDRSGGSSPRIQLYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDV 135

Query: 206 NADPLFLAKRRKGLSRFINLVM 227
           N D  +LAKRR GL  F+N V+
Sbjct: 136 NFDKKWLAKRRAGLEYFLNQVL 157

>Sklu_1971.4 YHR105W, Contig c1971 6476-6973
          Length = 165

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 11/82 (13%)

Query: 157 LTPLPNTDPSDDRT-VVRRYSDFDWLQDVLLRKYPFRM---VPELPPK-------KIGSQ 205
           L P   +  S  R  + +RYSDF+ L++ L++  P  +   +P LPPK       +    
Sbjct: 65  LAPTDRSGGSSPRIQLYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDV 124

Query: 206 NADPLFLAKRRKGLSRFINLVM 227
           N D  +LAKRR GL  F+N V+
Sbjct: 125 NFDKKWLAKRRAGLEYFLNQVL 146

>CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces
           cerevisiae YHR105w, start by similarity
          Length = 173

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 49/102 (48%), Gaps = 16/102 (15%)

Query: 157 LTPL-PNTDPSDDRTVVRRYSDFDWLQDVLL------RKYPFRMVPELPPK-------KI 202
           L PL PN+  S      +RYSDF   ++ LL      R      +PELPP        K 
Sbjct: 68  LHPLNPNSSGSYRIHTYKRYSDFVEFRNALLDRVRTKRPASVSEIPELPPPVKWYYSWKY 127

Query: 203 GSQNADPLFLAKRRKGLSRFINLVM--KHPVLRSDDLVLTFL 242
              N +  +LA RRKGL  FIN V+   + V  + DLV+ FL
Sbjct: 128 NEINLNKEWLANRRKGLELFINQVLLNGNIVDIAKDLVIQFL 169

>ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)
           [1812 bp, 603 aa]
          Length = 603

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 167 DDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKK------IGSQNA--DPLFLAKRRKG 218
           + R V RRYS+FD L+  L R  P  ++P +P K       +   NA  D   + KRR+ 
Sbjct: 152 EGRQVTRRYSEFDSLRQALARLLPTVIIPPIPSKHPLIRYFLNPLNAENDIRIIEKRRRL 211

Query: 219 LSRFIN 224
           LSRF+N
Sbjct: 212 LSRFLN 217

>Kwal_23.3438
          Length = 614

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 11/75 (14%)

Query: 128 PLAEDIVSVEEIPE-REGLVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLL 186
           PL+ D V + E  +  EG    +  Y +K+           D+ V RRYSDF+ L+ +L+
Sbjct: 135 PLSGDKVYILEASKASEGQGRTYIAYTIKY----------GDKVVKRRYSDFESLRKILI 184

Query: 187 RKYPFRMVPELPPKK 201
           + +P  ++P +P K+
Sbjct: 185 KLFPMSLIPPIPEKQ 199

>KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w VPS5 involved in Golgi retention and
           vacuolar sorting, start by similarity
          Length = 665

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (48%), Gaps = 15/109 (13%)

Query: 171 VVRRYSDFDWLQDVLLRKYPFRMVPELPPKK-IGSQNADPLFLAKRRKGLSRFINLVMKH 229
           V RRY DF WL   L   +  +++P  P K+ +G    D  F+  RR  + R +  +  +
Sbjct: 306 VKRRYRDFRWLYRQLQHNHWGKIIPPPPEKQAVGRFKQD--FIENRRAQMERMLQHIASN 363

Query: 230 PVLRSDDLVLTFLT---------VPTDLSGWRKQAHYDTTDEFTDKHIS 269
            VL+ D+  + FLT         V   +SG +  A +D+ D  +D HIS
Sbjct: 364 HVLQKDEDFILFLTSEKWSQESKVREQISGSK--ASHDSND-ISDIHIS 409

>YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein that
           may play a role in vesicular transport, has similarity
           to human SNX1 [1923 bp, 640 aa]
          Length = 640

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 26/35 (74%)

Query: 167 DDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKK 201
           ++ TV RRYSDF+ L+ +L+R +P  ++P +P K+
Sbjct: 185 ENSTVQRRYSDFESLRSILIRLFPMTLIPPIPEKQ 219

>Scas_613.21
          Length = 649

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 25/34 (73%)

Query: 168 DRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKK 201
           D  V RRYSDF+ L++VL+R +P  ++P +P K+
Sbjct: 201 DVCVRRRYSDFESLRNVLVRLFPITLIPPIPEKE 234

>YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorting
           nexin family involved in Golgi retention and vacuolar
           sorting [2028 bp, 675 aa]
          Length = 675

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 171 VVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKHP 230
           V RRY DF WL   L   +  +++P  PP+K    +    F+  RR  +   +  + + P
Sbjct: 317 VSRRYRDFRWLYRQLQNNHWGKVIPP-PPEKQSVGSFKENFIENRRFQMESMLKKICQDP 375

Query: 231 VLRSDDLVLTFLTVPTDLSGWRKQA 255
           VL+ D   L FLT     S  +K+A
Sbjct: 376 VLQKDKDFLLFLTSDDFSSESKKRA 400

>CAGL0M12254g 1220771..1223215 weakly similar to sp|P39723
           Saccharomyces cerevisiae YAL047c SPI6 STU2P Interactant,
           hypothetical start
          Length = 814

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 304 LIERYEKRMKQVAHERKLLGQILNAIPDTTEALYPQSTATVSQINEGVGLIVEHLNSCAD 363
           LI  YE ++++V   RK L + ++ + +  + +Y QS+  +  + + V  + E   S  D
Sbjct: 570 LIGSYEDQLEEVNLSRKQLSKTVSDLKNEIQEIYQQSSENMKLLEQDVASLQEKCQSYND 629

Query: 364 VIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQL 408
            + + +++ +S LS + +AF      LK +F++ +  A NN   L
Sbjct: 630 EVFQLSKQ-NSALSAKLEAFTKNSENLKLMFQQLEKSAKNNQKSL 673

>KLLA0E09141g complement(817829..819739) similar to sgd|S0002271
           Saccharomyces cerevisiae YDL113c, start by similarity
          Length = 636

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (70%)

Query: 168 DRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKK 201
           D  V RRYSDF+ L+ VL++ +P  ++P +P K+
Sbjct: 190 DSIVKRRYSDFESLRKVLVKLFPISLIPPIPEKQ 223

>Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement
          Length = 647

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 145 LVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKK-IG 203
           L   H  Y VK  T      PS+ + V RRY DF WL   L      R++P  P K+ +G
Sbjct: 264 LTSAHVEYTVK--TKSNAIQPSECQ-VKRRYRDFRWLYRQLQNNNWGRIIPPPPEKQTVG 320

Query: 204 SQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLT 243
               D  F+  RR  + R +  +    +L+ D+  + FLT
Sbjct: 321 RFKED--FIESRRFQMERMLKKISSDSILQKDEDFIMFLT 358

>Sklu_2404.3 YOR357C, Contig c2404 1457-1948
          Length = 163

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 177 DFDWLQDVLLRK-----YPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKHPV 231
           DF++ +  L+++     +P  +VP LP K + S   +   + +RR+GL +++  V  HP+
Sbjct: 85  DFEFFRKCLVKELALSSHPRVVVPHLPGKILLSNRFNDEIIEERRQGLQQWLLNVAGHPL 144

Query: 232 LRSDDLVL 239
           L+S   VL
Sbjct: 145 LQSGSKVL 152

>Sklu_2219.2 YDL113C, Contig c2219 4054-5958
          Length = 634

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 24/32 (75%)

Query: 170 TVVRRYSDFDWLQDVLLRKYPFRMVPELPPKK 201
           TV RRYS+F+ L+ +L++ +P  ++P +P K+
Sbjct: 188 TVRRRYSEFESLRKILVKLFPMTLIPPIPEKQ 219

>CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces
           cerevisiae YDL113c, hypothetical start
          Length = 753

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 23/31 (74%)

Query: 171 VVRRYSDFDWLQDVLLRKYPFRMVPELPPKK 201
           V RRYSDF+ L+ +L++ +P  ++P +P K+
Sbjct: 316 VRRRYSDFESLRSILVKLFPLMVIPPIPEKE 346

>Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement
          Length = 349

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 170 TVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIG-----SQNADPLFLAKRRKGLSRFI 223
           TV RR+S+F  L+  L +++   +  ELPP+  G     S + DP  + +R+  LS F+
Sbjct: 42  TVSRRFSEFVSLKKQLEQEFNAELPYELPPRHYGFWNKSSHSCDPQVIQERKSKLSTFL 100

>Sklu_2221.5 YDR425W, Contig c2221 7089-9104
          Length = 671

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 168 DRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKK------IGSQNA--DPLFLAKRRKGL 219
           ++ V RRYS+FD L+  L R  P  ++P +P K       +   NA  D   + KR++ L
Sbjct: 206 NKQVTRRYSEFDTLRQALCRLLPSVIIPPIPSKHPLIKYFLNPLNAENDVKIIDKRKRLL 265

Query: 220 SRFIN 224
           + F+N
Sbjct: 266 TSFLN 270

>Scas_714.58
          Length = 636

 Score = 36.6 bits (83), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 169 RTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIG--------SQNADPLFLAKRRKGLS 220
           + V RRYS+FD L  VL R  P  ++P +P K           + N D   + KR++  +
Sbjct: 195 KRVTRRYSEFDSLYQVLKRLLPTIVIPPIPTKHPLINYLINPINVNNDTKIIDKRKRKFN 254

Query: 221 RFINLVMKHPVLRSDDLVLTFL 242
            F+N     P +R+  +   FL
Sbjct: 255 SFLNNCNDIPEIRNHVVFQKFL 276

>Scas_712.33
          Length = 357

 Score = 35.8 bits (81), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 55/105 (52%), Gaps = 12/105 (11%)

Query: 167 DDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIG---------SQNADPLFLAKRRK 217
           +DR + +R+S+F  L+  L +++   +  ELP +  G         + + DP+   +RR 
Sbjct: 48  EDRHIYKRFSEFLELKRRLEKEFNSELPYELPSRHHGPIFNVWTRSTTSIDPVITEERRI 107

Query: 218 GLSRFINLVMKHPV---LRSDDLVLTFLTVPTDLSGWRKQAHYDT 259
            L++F++ ++        ++ +LV  FL +P + + +R + H ++
Sbjct: 108 QLAKFVSDMLNDSFDTKWKNSELVRVFLQLPLNWNDYRLRDHQES 152

>CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w, start by similarity
          Length = 638

 Score = 35.8 bits (81), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 42/101 (41%), Gaps = 8/101 (7%)

Query: 145 LVFKHTNYLVKHLTPL--PNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKI 202
           L   H  Y V   + L  PN +      V RRY DF WL   L   +  +++P  PP+K 
Sbjct: 253 LTSSHIKYTVNAESELLSPNQN-----QVSRRYRDFRWLYRQLQNNHWGKVIPP-PPEKQ 306

Query: 203 GSQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLT 243
                 P F+  RR  L   +  +     L+ D+    FLT
Sbjct: 307 TVGTFQPEFVETRRLQLQTMLRRIANDSDLQRDEHFHMFLT 347

>Kwal_14.1041
          Length = 230

 Score = 35.0 bits (79), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 29/79 (36%), Gaps = 16/79 (20%)

Query: 272 FMNLWRKEFSEQWNKADERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPD 331
           F +LWR   S   N A E ID                EK  K   HER+L   I N   D
Sbjct: 70  FFSLWRLRLSNTINSACETID----------------EKSRKYYHHERRLTSTIANLHSD 113

Query: 332 TTEALYPQSTATVSQINEG 350
             E L P  T T+     G
Sbjct: 114 PRELLLPGMTYTLVAAMSG 132

>Kwal_47.18601
          Length = 622

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 169 RTVVRRYSDFDWLQDVLLRKYPFRMVPELPPK 200
           + VVRRYS+FD L+  L R  P  +VP +P K
Sbjct: 151 KHVVRRYSEFDTLRHALHRLLPTVIVPPIPSK 182

>Kwal_55.21533
          Length = 159

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 10/67 (14%)

Query: 171 VVRRYSDFDWLQDVLLRKYPFRM---VPELPPK-------KIGSQNADPLFLAKRRKGLS 220
           + +RYSDF   ++ L+     ++   +P LPPK       +    N    +LA+RR GL 
Sbjct: 74  IYKRYSDFVRFREELMATLSPKLRTGIPALPPKLSWFDSWRYDDANFKSAWLARRRAGLE 133

Query: 221 RFINLVM 227
            F+N V+
Sbjct: 134 FFLNQVL 140

>YHR105W (YPT35) [2393] chr8 (324768..325412) Protein that may play
           a role in vesicular transport, has similarity to Grd19p,
           bacterial helix-turn-helix regulator protein of the argR
           group, and human SNX1 [645 bp, 214 aa]
          Length = 214

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 17/87 (19%)

Query: 173 RRYSDFDWLQDVLLRKY----PFRM----VPELPPK-------KIGSQNADPLFLAKRRK 217
           +RYSDF  L++ LL +     P ++    +P LPP        K    N +  +LAKR++
Sbjct: 121 KRYSDFVRLRENLLTRIKTAKPEKLNCLQIPHLPPSVQWYSSWKYQEVNLNKDWLAKRQR 180

Query: 218 GLSRFINLVMKHPVL--RSDDLVLTFL 242
           GL  F+N ++ +  L   + D+++ FL
Sbjct: 181 GLEYFLNHIILNSSLVEMTKDILIQFL 207

>YKR078W (YKR078W) [3328] chr11 (584594..586351) Protein with
           similarity to Uso1p [1758 bp, 585 aa]
          Length = 585

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 73/172 (42%), Gaps = 32/172 (18%)

Query: 162 NTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKI------------------G 203
           +T P  ++T+ R +SDF WL   L   +  + +P  PP +                    
Sbjct: 140 STQPDVEKTIARAFSDFYWLYHQLQNNHWGKTIP--PPTRSNILVEKDEFAINHLFMIRN 197

Query: 204 SQNADPLFLAKRRKGLSRFINLVMKH----PVLRSDDLVLTFLTVPTDLSGWRKQAHYDT 259
           ++  DP+F  K    +S  +  ++KH     VLR D   + F++   DL    +    D+
Sbjct: 198 NEKYDPIFNFKPEYIISLQLMAMIKHIFNDKVLRLDSNFIDFISWDDDLPESLQIVVDDS 257

Query: 260 TDEFTDKHI---SSSFMNLWRKEFSEQWNKADERIDIALDTWVKVTVLIERY 308
           T  FT   I   SS F  L  KEF +Q  K  E I  +  + + VT L E Y
Sbjct: 258 T--FTGDKILMTSSQFREL--KEFHKQSKKV-ESITNSHASLIPVTELTEIY 304

>KLLA0A03718g 334828..335322 similar to sp|Q08826 Saccharomyces
           cerevisiae YOR357c GRD19 singleton, start by similarity
          Length = 164

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 6/76 (7%)

Query: 177 DFDWLQDVLLRK-----YPFRMVPELPPKKIGSQNADPLFLAKRRKGLSRFINLVMKHPV 231
           DF+  + +L+++     +P   V  LP K + S       + +RR+GL++++  V  HP+
Sbjct: 86  DFELFRKLLIKELQLSNHPKVSVQHLPGKILLSNRFSDAVIEERRQGLNKWLASVAGHPL 145

Query: 232 LRSDDLVLT-FLTVPT 246
           L++   VL  F+  PT
Sbjct: 146 LQTGSKVLVRFIQDPT 161

>KLLA0D01485g 129351..132806 some similarities with sp|Q03735
           Saccharomyces cerevisiae YML117w, hypothetical start
          Length = 1151

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 69  GTASNVYQNDVLWDRPNIGSTTQETDIRGVNRFQATDTPQY 109
           GT++N YQ  +++ RP +G   Q  D+ G N       PQY
Sbjct: 4   GTSANHYQPSLIYGRPPVGYEQQVYDVAGRNGGSNHHPPQY 44

>Kwal_26.9139
          Length = 230

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 12/71 (16%)

Query: 230 PVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLWRKEFSEQWNKADE 289
           PVL+   L   F+       G  +  H D  DE+  KH  SSF     +EF E   + +E
Sbjct: 95  PVLKDSGLRERFM-------GEIQGMHLDQADEYAKKHGKSSF-----REFGETAEEFEE 142

Query: 290 RIDIALDTWVK 300
           R+  A+   VK
Sbjct: 143 RLTSAVKQIVK 153

>Scas_698.32
          Length = 699

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 7/106 (6%)

Query: 140 PEREG-LVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELP 198
           P + G L   H  Y+V     +  +  S    V RRY DF WL   L   +  +++P  P
Sbjct: 308 PRKVGELTSAHIEYMVVAEAKILESGCS---IVYRRYRDFRWLYRQLQNNHWGKIIPPPP 364

Query: 199 PKK-IGSQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLT 243
            K+ +G    D  F+  RR  +   +  +     L++D   + FLT
Sbjct: 365 EKQAVGRFKQD--FIENRRLQMENMLQTIASSDSLQNDSDFILFLT 408

>YNL231C (PDR16) [4375] chr14 complement(215986..217041)
           Phosphatidylinositol transfer protein, involved in
           regulation of phospholipase D (Spo14p) activity,
           involved in lipid biosynthesis and multidrug resistance
           [1056 bp, 351 aa]
          Length = 351

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 424 SNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILEEFTIFHETQFLITDCFQR 481
           SNPD+K    ++ K   S D    L++  ++WL REC L        T++++ DC  R
Sbjct: 56  SNPDLKVYTSEKNK---SEDDLKPLEEEEKAWLTRECFLR---YLRATKWVLKDCIDR 107

>Kwal_47.19079
          Length = 345

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 173 RRYSDFDWLQDVLLRKYPFRMVPELPPKKIG-----SQNADPLFLAKRRKGLSRFINLVM 227
           RR+SDF  L+  L ++    +  ELPP++       S + DP  + +R K LS F++ ++
Sbjct: 46  RRFSDFVKLKKDLEQEVGSELPYELPPRRFNKWMRPSGSCDPDVIEERVKELSTFLHDLL 105

Query: 228 KHPV---LRSDDLVLTFLTVPTD 247
                   +    V  FL +P+D
Sbjct: 106 NDSFDTRWKKSPYVCHFLQIPSD 128

>YGL212W (VAM7) [1784] chr7 (91435..92385) Subunit of the vacuolar
           SNARE complex involved in morphogenesis of the vacuole;
           homologous to SNAP-25 [951 bp, 316 aa]
          Length = 316

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 113/281 (40%), Gaps = 34/281 (12%)

Query: 168 DRTVVRRYSDFDWLQDVLLRK------YPFRMVPELPPKKIGSQNADPLFLAKRRKGLSR 221
           ++ + +RYS+F  L+  L R       Y F   P +  ++   +  DP  + +RR GL R
Sbjct: 35  NKRLYKRYSEFWKLKTRLERDVGSTIPYDFPEKPGVLDRRWQRRYDDPEMIDERRIGLER 94

Query: 222 FINLVMKHPV---LRSDDLVLTFLTVPT-DLSGWRKQAHYDTTDEFT-DKHISSSFMNLW 276
           F+N +         R   +   FL +   ++S  + Q H +T DE   D+ I    ++L 
Sbjct: 95  FLNELYNDRFDSRWRDTKIAQDFLQLSKPNVSQEKSQQHLETADEVGWDEMIRDIKLDL- 153

Query: 277 RKEFSEQWNKADERIDIALDTWVKVTVLIERYEKRMK-------QVAHERKLLGQILNAI 329
                ++ +     +  AL    K+  L ER E+ ++       +V     LL  +L   
Sbjct: 154 -----DKESDGTPSVRGALRARTKLHKLRERLEQDVQKKSLPSTEVTRRAALLRSLLKEC 208

Query: 330 PDTTEALYPQSTATVSQINEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIA 389
            D   A   Q    +      +G+     +S  +V  R N ++  G     +     ++A
Sbjct: 209 DDIGTANIAQDRGRL------LGVATSDNSSTTEVQGRTNNDLQQGQMQMVRDQEQELVA 262

Query: 390 LKGLFERYKMMAGNNIPQLQRRVEINQERLNTLESNPDVKG 430
           L  + +  + +A     +LQ + E+    L  LE + D  G
Sbjct: 263 LHRIIQAQRGLALEMNEELQTQNEL----LTALEDDVDNTG 299

>Kwal_55.21745
          Length = 629

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 5/104 (4%)

Query: 140 PEREG-LVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELP 198
           P++ G L   H  Y +  L+   N +  + R V RRY DF WL   L   +  +++P  P
Sbjct: 243 PQKVGDLTSAHVEYTI--LSKSDNLNNPEVR-VQRRYRDFRWLYRQLQNNHWGKIIPPPP 299

Query: 199 PKKIGSQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFL 242
            K+   +  D  F+  RR  + R +  + +   L+ D   + FL
Sbjct: 300 EKQTVGRFKDD-FIENRRFQMERMLTKISQDKDLQEDVDFVMFL 342

>CAGL0H01177g 108423..109316 similar to tr|Q05521 Saccharomyces
           cerevisiae YDR284c DPP1 diacylglycerol pyrophosphate
           phosphatase, hypothetical start
          Length = 297

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 145 LVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIGS 204
           L+    NY V +  P       DDRT+   Y++ + + DV+L  Y F +VP L    +  
Sbjct: 41  LIIMVVNYPVYYQEPFQRQFSLDDRTISHPYAEVERVNDVMLFIYSF-IVPALSIFVVWL 99

Query: 205 QNADP 209
             ADP
Sbjct: 100 LFADP 104

>AFL124C [3071] [Homologous to ScYMR172W (HOT1) - SH]
           (201644..203533) [1890 bp, 629 aa]
          Length = 629

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 97  GVNRFQATDTPQYAANDEYKNWVESVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKH 156
           G N+ +    P+ A  +        VR+  F  +   VSV   PE E LV K+ +   K+
Sbjct: 445 GGNQGEDEAGPRAAGRNPKSLPSSIVRR--FANSGSQVSVSGTPETERLVLKNNDKYDKN 502

Query: 157 LTPLPNTDP 165
             P PNT P
Sbjct: 503 TMPAPNTKP 511

>CAGL0M09515g 945440..946045 highly similar to sp|P25046
           Saccharomyces cerevisiae YBL093c transcription factor,
           hypothetical start
          Length = 201

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/130 (20%), Positives = 58/130 (44%), Gaps = 21/130 (16%)

Query: 353 LIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQLQRR- 411
           + V HL+  +  + R NE+    + +R K++ + I  L G F        ++IP  + R 
Sbjct: 32  ITVYHLDDISRQVARTNEDGTKAVKLR-KSYKNQITDLSGKF--------SSIPNRENRK 82

Query: 412 --------VEINQERLNTLESNPDVKGAEYDRVKQSISRDKRSILDQMNRSWLIRECILE 463
                    + N + +N +  +PD+   ++   ++++     S+    N  W + + +L 
Sbjct: 83  GGEIAHILFQNNPDMMNQVHRSPDMTDEQW---REALMNVDASLFQAPNMDWEVCQSVLS 139

Query: 464 EFTIFHETQF 473
           +F   + T+F
Sbjct: 140 QFDRSYPTEF 149

>Kwal_47.17609
          Length = 155

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 348 NEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKGLFERYKMMAGNNIPQ 407
           N+GV L  E ++S    ++  +EE + GL +R   F          F+R ++++  N+  
Sbjct: 30  NKGVSLSNEVISSLYSHLQAHDEEYNEGLKLRLAEF----------FKRCRVLSRQNLET 79

Query: 408 LQRRVEINQERL 419
           LQ +  I+ E L
Sbjct: 80  LQLQESISVEDL 91

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 12/82 (14%)

Query: 111 ANDEYKNWVESVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPLPNTDPSDDRT 170
           + D YKNW   ++       +  + + EIP            L+ H  P+PN   S+ R 
Sbjct: 361 STDRYKNW--GMQYCVSASRDRTIKIWEIP---------LPTLMAHRAPIPNPTDSNFRC 409

Query: 171 VVRRYSDFDWLQDVLLR-KYPF 191
           V+       W++D+ +R +Y F
Sbjct: 410 VLTLKGHLSWVRDISIRGQYLF 431

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,155,353
Number of extensions: 770943
Number of successful extensions: 2570
Number of sequences better than 10.0: 83
Number of HSP's gapped: 2626
Number of HSP's successfully gapped: 83
Length of query: 504
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 398
Effective length of database: 12,926,601
Effective search space: 5144787198
Effective search space used: 5144787198
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)