Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C05984g36435918920.0
Sklu_2419.236735916680.0
Kwal_56.2250236435815760.0
YOL010W (RCL1)36736015710.0
Scas_644.936435815610.0
ACL015W36235615600.0
CAGL0E02343g36435815460.0
CAGL0I00968g99749663.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05984g
         (359 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05984g 528906..530000 highly similar to sp|Q08096 Saccharo...   733   0.0  
Sklu_2419.2 YOL010W, Contig c2419 2010-3113                           647   0.0  
Kwal_56.22502                                                         611   0.0  
YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required fo...   609   0.0  
Scas_644.9                                                            605   0.0  
ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH] complement(...   605   0.0  
CAGL0E02343g 225099..226193 highly similar to sp|Q08096 Saccharo...   600   0.0  
CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces cer...    30   3.9  

>KLLA0C05984g 528906..530000 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1 singleton, start
           by similarity
          Length = 364

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/359 (100%), Positives = 359/359 (100%)

Query: 1   MSSSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTN 60
           MSSSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTN
Sbjct: 1   MSSSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTN 60

Query: 61  GSSIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGI 120
           GSSIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGI
Sbjct: 61  GSSIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGI 120

Query: 121 TSSHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH 180
           TSSHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH
Sbjct: 121 TSSHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH 180

Query: 181 ALDKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGW 240
           ALDKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGW
Sbjct: 181 ALDKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGW 240

Query: 241 GLTLVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMI 300
           GLTLVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMI
Sbjct: 241 GLTLVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMI 300

Query: 301 IGKEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDDNTTDLIATIKGIGFTNT 359
           IGKEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDDNTTDLIATIKGIGFTNT
Sbjct: 301 IGKEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDDNTTDLIATIKGIGFTNT 359

>Sklu_2419.2 YOL010W, Contig c2419 2010-3113
          Length = 367

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/359 (84%), Positives = 337/359 (93%), Gaps = 1/359 (0%)

Query: 2   SSSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNG 61
           ++SSRY  F+G+RNFRLR+++ATLSGKAIK+EKIRSDDLNPGLKDYEVSFLRLMEAVTNG
Sbjct: 4   ANSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTNG 63

Query: 62  SSIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGIT 121
           S+IEISYTGTTVI++PGII GGSYTH CP+SKPVGYF EPMLYLAPFSKKKFSILFRGIT
Sbjct: 64  SAIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGIT 123

Query: 122 SSHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHA 181
           +SHNDAGI+AIKWG++P+MEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHA
Sbjct: 124 ASHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHA 183

Query: 182 LDKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWG 241
           LD  +ISSIRGVSYSTRVSPS+VNRMIDGAK VLK+  CEVNITADVWRG+NSGKSPGWG
Sbjct: 184 LDTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGWG 243

Query: 242 LTLVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMII 301
           +TLVAENK+GWR FSEAIGDAGDVPEDIG  VAY LLEEISKSGVVGR QLPL I YM+I
Sbjct: 244 ITLVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYMVI 303

Query: 302 GKEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDD-NTTDLIATIKGIGFTNT 359
           GKEDIGRLRI K+QIDE+F+WLLRDIK+VFGTE+ LKP D+ ++ DLIATIKGIGFTNT
Sbjct: 304 GKEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFTNT 362

>Kwal_56.22502
          Length = 364

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/358 (80%), Positives = 326/358 (91%), Gaps = 1/358 (0%)

Query: 3   SSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNGS 62
           SS R  +F+G RNFRL +V+ATLSGK IKIEKIRSDDLNPGL+D+EVSFLRLMEAVTNGS
Sbjct: 2   SSMRINSFQGVRNFRLLIVLATLSGKPIKIEKIRSDDLNPGLRDHEVSFLRLMEAVTNGS 61

Query: 63  SIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGITS 122
           +IEISYTGTTVI++PGII GGSYTH CP  KPVGY+ EPMLYLAPFSKKKFSI+FRG+T+
Sbjct: 62  TIEISYTGTTVIYKPGIIIGGSYTHNCPPGKPVGYYVEPMLYLAPFSKKKFSIIFRGVTA 121

Query: 123 SHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHAL 182
           SHNDAGI+AIKWGLMP+MEKFGVRECALHTLKRG+PPLGGGEVHLVVDSLIAQPITMHAL
Sbjct: 122 SHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHAL 181

Query: 183 DKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWGL 242
           D   I+SIRGV+YSTRVSPS+VNRMI+GA+ VLK+  CEV+ITADVWRGENSGKSPGWG+
Sbjct: 182 DTPQIASIRGVAYSTRVSPSMVNRMIEGARNVLKNVGCEVDITADVWRGENSGKSPGWGI 241

Query: 243 TLVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMIIG 302
           TLVAE K+GW+ FSE IG AGDVPEDIGA +AY LLEEIS S VVGRNQL L I+YM+IG
Sbjct: 242 TLVAETKKGWKYFSEGIGGAGDVPEDIGAQIAYELLEEISTSAVVGRNQLALAIIYMVIG 301

Query: 303 KEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDD-NTTDLIATIKGIGFTNT 359
           KEDIGRLRITK QIDE+F+WLLR IK++FGTE+ LKPVDD ++ DLIAT+KGIGF+NT
Sbjct: 302 KEDIGRLRITKAQIDEKFIWLLRHIKQIFGTEVFLKPVDDADSDDLIATVKGIGFSNT 359

>YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required for
           pre-rRNA processing at cleavage sites A0, A1 and A2, has
           similarity to RNA 3'-terminal phosphate cyclase,
           interacts with Bms1p [1104 bp, 367 aa]
          Length = 367

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/360 (80%), Positives = 327/360 (90%), Gaps = 2/360 (0%)

Query: 2   SSSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNG 61
           SS+ +Y TF+GS+NFRLR+V+ATLSGK IKIEKIRS DLNPGLKDYEVSFLRL+E+VTNG
Sbjct: 3   SSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNG 62

Query: 62  SSIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGIT 121
           S IEISYTGTTVI+RPGII GG+ TH CP+SKPVGYF EPMLYLAPFSKKKFSILF+GIT
Sbjct: 63  SVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGIT 122

Query: 122 SSHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHA 181
           +SHNDAGI+AIKWGLMP+MEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH 
Sbjct: 123 ASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHE 182

Query: 182 LDKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWG 241
           +D+ +ISSI GV+YSTRVSPSLVNRMIDGAKKVLK+  CEVNITADVWRGENSGKSPGWG
Sbjct: 183 IDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWG 242

Query: 242 LTLVAENKQ-GWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMI 300
           +TLVA++KQ GW  F+E IGDAG +PE++G  VA  LLEEISKS  VGRNQLPL I+YM+
Sbjct: 243 ITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYMV 302

Query: 301 IGKEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDD-NTTDLIATIKGIGFTNT 359
           IGKEDIGRLRI K+QIDERF+ LLRDIKK+F TE+ LKPVD+ +  D+IATIKGIGFTNT
Sbjct: 303 IGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTNT 362

>Scas_644.9
          Length = 364

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/358 (79%), Positives = 326/358 (91%), Gaps = 1/358 (0%)

Query: 3   SSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNGS 62
           SS  Y+TF+GS+NFRLR++++TLSGK+IKIEKIRS DLNPGLKDYEVSFLRLME+VTNGS
Sbjct: 2   SSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNGS 61

Query: 63  SIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGITS 122
            IEISYTGTT+++RPGII+GG++TH CP SKPVGYF EPMLYLAPFSKKKFSI+F+GIT+
Sbjct: 62  VIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPFSKKKFSIIFKGITA 121

Query: 123 SHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHAL 182
           SH+DAGI+AIKWGL+PI+EKFG RECALHTLKRGSPP GGGEVHLVVDSLIAQPITMH L
Sbjct: 122 SHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHEL 181

Query: 183 DKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWGL 242
           ++  I+++RGV+YSTRVSPS+VNRMID AKKVL   SC V ITADVWRGENSGKSPGWG+
Sbjct: 182 ERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWGI 241

Query: 243 TLVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMIIG 302
           TLVA++K+GW  FSEAIGDAGDVPEDIG  VAY LLEEIS S  VGRNQL L I+YM+IG
Sbjct: 242 TLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVIG 301

Query: 303 KEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDD-NTTDLIATIKGIGFTNT 359
           KEDIGRLRITKDQIDE F++LLRDIKKVFGTE+ LKPVDD N+ D+IATIKG+GFTNT
Sbjct: 302 KEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNT 359

>ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH]
           complement(332683..333771) [1089 bp, 362 aa]
          Length = 362

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/356 (79%), Positives = 321/356 (90%)

Query: 4   SSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNGSS 63
           SS+YVTF G+ NFR R+VMATLSGKA+KIEKIRS+D+NPGL+D+EVSFLRL+EAVTNGS 
Sbjct: 2   SSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGSV 61

Query: 64  IEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGITSS 123
           IEISYTGTTVI+RPGII GGS+TH CPN K VGY+ EP+LYLAPFSKKKFSI+ RG+TS+
Sbjct: 62  IEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTST 121

Query: 124 HNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHALD 183
           H DAGI+AIKWGLMP+MEKFGVRECALHTLKRG+PPLGGGEVHLVVDSLIAQPITMHAL+
Sbjct: 122 HQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHALE 181

Query: 184 KTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWGLT 243
           + +IS+IRGV+YSTRVSPS+VNRMIDGAK VLK   CE NITADVWRG NSGKSPGWG+T
Sbjct: 182 RPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGIT 241

Query: 244 LVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMIIGK 303
           LVAE K+GWR F+EAIGDAG+VPEDIG   AY+LLEEIS+S VV R+QLPL I+YM+IGK
Sbjct: 242 LVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVIGK 301

Query: 304 EDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDDNTTDLIATIKGIGFTNT 359
           EDIGRLRI + Q+DE  V LLRDIK++FGTE LLKP DD+T DLI TIKGIGFTNT
Sbjct: 302 EDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADDDTDDLIVTIKGIGFTNT 357

>CAGL0E02343g 225099..226193 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1, start by
           similarity
          Length = 364

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/358 (79%), Positives = 321/358 (89%), Gaps = 2/358 (0%)

Query: 4   SSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNGSS 63
           SS+YV F+G  NFR R++ ATLSGK IKIEKIRS DLNPGL+D+EVSFLRLMEAVTNGS 
Sbjct: 2   SSQYVVFQGPENFRHRIIFATLSGKPIKIEKIRSQDLNPGLRDHEVSFLRLMEAVTNGSV 61

Query: 64  IEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGITSS 123
           IEISYTGTTVI+RPGII GG YTH CP SKPVGYF EPMLYLAPFSKKKFSI+F+GIT+S
Sbjct: 62  IEISYTGTTVIYRPGIIIGGPYTHTCPPSKPVGYFVEPMLYLAPFSKKKFSIVFKGITAS 121

Query: 124 HNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHALD 183
           HNDAGI+AIKWGLMP+MEKFGVRECALHTLKRGSPP GGGEVHLVVDSLIAQPITMH LD
Sbjct: 122 HNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPQGGGEVHLVVDSLIAQPITMHELD 181

Query: 184 KTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWGLT 243
           + +ISSIRGV+YSTRVSPS+VNRMIDGAK+VLK+  CEVNITADVWRGENSGKSPGWG+T
Sbjct: 182 RPVISSIRGVAYSTRVSPSMVNRMIDGAKQVLKNVKCEVNITADVWRGENSGKSPGWGIT 241

Query: 244 LVAE-NKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMIIG 302
           +VAE  K+GW  F+E IG +GD+PE+IG+ VAY L+EEISKS  V RNQLPL I YM+IG
Sbjct: 242 IVAETKKKGWCYFAEEIGGSGDIPEEIGSKVAYKLIEEISKSAAVDRNQLPLAITYMVIG 301

Query: 303 KEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDD-NTTDLIATIKGIGFTNT 359
           KEDIGRLRIT++Q+DERF+ +LRDIKK+FGTE+ LKPVDD  + D IAT+KGIGFTNT
Sbjct: 302 KEDIGRLRITREQVDERFIQMLRDIKKIFGTEVFLKPVDDIGSDDFIATVKGIGFTNT 359

>CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces
           cerevisiae YOR038c HIR2 histone transcription regulator,
           hypothetical start
          Length = 997

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 267 EDIGASVAYHLLEEISKSGVVGRNQLPLTILYMIIGKEDIGRLRITKDQ 315
           +D+G +V    +E I +S ++     PL I Y+I   + +G +  +K+Q
Sbjct: 357 DDLGKTVPMEEIENIRQSNIIKE---PLPIAYVITASDGLGDISTSKNQ 402

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,458,400
Number of extensions: 488726
Number of successful extensions: 1041
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1068
Number of HSP's successfully gapped: 11
Length of query: 359
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 256
Effective length of database: 13,030,455
Effective search space: 3335796480
Effective search space used: 3335796480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)