Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C05962g36636017240.0
ACL016C36136710511e-143
Kwal_56.225054033989291e-123
Scas_611.23363677781e-102
CAGL0J11726g3362527761e-101
YMR005W (TAF4)3883107523e-97
YJR107W32853710.74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05962g
         (360 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05962g complement(527216..528316) similar to sp|P50105 Sac...   668   0.0  
ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH] (331298..33...   409   e-143
Kwal_56.22505                                                         362   e-123
Scas_611.2                                                            304   e-102
CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces...   303   e-101
YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA po...   294   3e-97
YJR107W (YJR107W) [2999] chr10 (627254..628240) Protein of unkno...    32   0.74 

>KLLA0C05962g complement(527216..528316) similar to sp|P50105
           Saccharomyces cerevisiae YMR005w MPT1 required for
           protein synthesis singleton, start by similarity
          Length = 366

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/360 (91%), Positives = 330/360 (91%)

Query: 1   MAKSPKRKNSEPEDLSSNKRSKSFEFGKVENGLEPSGSDFGSDLPTPFDTMVTEQPLALP 60
           MAKSPKRKNSEPEDLSSNKRSKSFEFGKVENGLEPSGSDFGSDLPTPFDTMVTEQPLALP
Sbjct: 1   MAKSPKRKNSEPEDLSSNKRSKSFEFGKVENGLEPSGSDFGSDLPTPFDTMVTEQPLALP 60

Query: 61  KASSPTTNLASPRNSSTPNLXXXXXXXXXXXXXXXXXNXXXXXXXXXXXXXKPQQSDPDK 120
           KASSPTTNLASPRNSSTPNL                 N             KPQQSDPDK
Sbjct: 61  KASSPTTNLASPRNSSTPNLKTTSTTSKQSQKAEQKKNAGGSTGSTTASTTKPQQSDPDK 120

Query: 121 LSDALLSAGVDIREEEALLSSTVARTKATGISANNQVPSHPPFLHPKNISDFMKRIASEQ 180
           LSDALLSAGVDIREEEALLSSTVARTKATGISANNQVPSHPPFLHPKNISDFMKRIASEQ
Sbjct: 121 LSDALLSAGVDIREEEALLSSTVARTKATGISANNQVPSHPPFLHPKNISDFMKRIASEQ 180

Query: 181 NFHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRRSEVSRSLRDLA 240
           NFHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRRSEVSRSLRDLA
Sbjct: 181 NFHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRRSEVSRSLRDLA 240

Query: 241 LRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGGNKKKYSWLTAG 300
           LRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGGNKKKYSWLTAG
Sbjct: 241 LRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGGNKKKYSWLTAG 300

Query: 301 SKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALENRRVGVNNVITKG 360
           SKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALENRRVGVNNVITKG
Sbjct: 301 SKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALENRRVGVNNVITKG 360

>ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH]
           (331298..332383) [1086 bp, 361 aa]
          Length = 361

 Score =  409 bits (1051), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 212/367 (57%), Positives = 264/367 (71%), Gaps = 19/367 (5%)

Query: 1   MAKSPKRKNSEPEDLSSNKRSKS---FEFGKVENGLEPSGSDFGSDLPTPFDTMVTEQPL 57
           M KSPK  + + +  +  K++K    F FG     +EP+GSDF +D+PTPFD  V +   
Sbjct: 1   MGKSPKAAD-QGDTGAGGKKTKGEDGFSFGIDAEEVEPTGSDFSNDMPTPFDNFVGQDEQ 59

Query: 58  A----LPKASSPTTNLASPRNSSTPNLXXXXXXXXXXXXXXXXXNXXXXXXXXXXXXXKP 113
           +    LP++  P T LA P   +                                     
Sbjct: 60  SNRAELPESGQPATTLALPAGGAGSGAGRKSPQKMQRAGMRRAAGAGAPK---------- 109

Query: 114 QQSDPDKLSDALLSAGVDIREEEALLSSTVARTKATGISANNQVPSHPPFLHPKNISDFM 173
           QQSDPDKLSDALLSAGVDI+EEEALLSSTV   K+    +N+Q+P HPPFLHP +++  M
Sbjct: 110 QQSDPDKLSDALLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPSHVASMM 169

Query: 174 KRIASEQNFHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRRSEVS 233
           K++A+EQNF+QDF+K++++L LMSTACELY+RD+ITNS+I+S HRRK VKLN+GRRSE +
Sbjct: 170 KKVAAEQNFNQDFSKSSELLSLMSTACELYIRDIITNSIIISRHRRKAVKLNSGRRSETT 229

Query: 234 RSLRDLALRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGGNKKK 293
           R LRDLAL+Q+ QEERRV+RRIALGLEK+ TD +LD+ ET +RASNATAN+MIAGG KKK
Sbjct: 230 RVLRDLALKQREQEERRVKRRIALGLEKEITDTKLDSGETLHRASNATANMMIAGG-KKK 288

Query: 294 YSWLTAGSKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALENRRVGV 353
           YSWLT+GSK ++TDLKN G VSSAVAARG++GIK+REAREEPGIVMRDLL ALENRRVGV
Sbjct: 289 YSWLTSGSKVNATDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRRVGV 348

Query: 354 NNVITKG 360
           NN I KG
Sbjct: 349 NNTIAKG 355

>Kwal_56.22505
          Length = 403

 Score =  362 bits (929), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 199/398 (50%), Positives = 257/398 (64%), Gaps = 39/398 (9%)

Query: 1   MAKSPKRKNSEPEDLSSNKRSKS-------------FEFGKVENGLEPSGSDFGSDLPTP 47
           MAKSPKR+    +D+   K+ K+             FE G       P  +D  ++  TP
Sbjct: 1   MAKSPKRQAPITQDVPRAKKPKTEEQEGVFEIKERAFEQGGANVNGSPGKTDSSTEFSTP 60

Query: 48  FDTMVTE--QPLALPKASSPTTNLA---SPRNSSTPNLXXXXXXXXXXXXXXXXXNXXXX 102
           F   V E     +LP+++SP+ NL    S ++S                           
Sbjct: 61  FGGNVEEGRTSASLPESASPSINLVEGQSAKDSDDRKKNRGGGSQQQYQKAGGPAAKRSV 120

Query: 103 XXXXXXXXXKPQ----------------QSDPDKLSDALLSAGVDIREEEALLSSTVART 146
                     P                 Q+DPDKLSDAL SAGVDIREEEALL+S++  T
Sbjct: 121 MTQSTATVQHPSQQQSQAPNQQQASSKMQTDPDKLSDALFSAGVDIREEEALLNSSMNIT 180

Query: 147 KATGISA----NNQVPSHPPFLHPKNISDFMKRIASEQNFHQDFNKNTDILGLMSTACEL 202
           K++  +     NNQ+P  PP LHP +I+ FMK++ SEQNF+QDF+K  D+L LMSTACE 
Sbjct: 181 KSSAQAGAQAINNQIPPQPPLLHPTHIASFMKKVGSEQNFNQDFSKAHDVLSLMSTACEF 240

Query: 203 YMRDVITNSLILSIHRRKGVKLNTGRRSEVSRSLRDLALRQKTQEERRVQRRIALGLEKQ 262
           +M D+ITNSL++S HRR+ +KLN+GRRSEVSR+LRDLA++QK QEERRV+RRI++GLEK+
Sbjct: 241 FMTDIITNSLVISRHRRRSIKLNSGRRSEVSRALRDLAIQQKEQEERRVKRRISMGLEKE 300

Query: 263 TTDARLDTEETQYRASNATANLMIAGGNKKKYSWLTAGSKSSSTDLKNQGNVSSAVAARG 322
           T +A+++T+ET +RASNATAN+MIAGG KKKYSWL AG+K+++  +K  G VSS VAARG
Sbjct: 301 TAEAKMETDETLHRASNATANMMIAGG-KKKYSWLNAGAKANNNSVKVLGKVSSDVAARG 359

Query: 323 EMGIKYREAREEPGIVMRDLLLALENRRVGVNNVITKG 360
           E+GI+YREAREEPGIVMRDLL ALENRRVGVN VI KG
Sbjct: 360 EIGIRYREAREEPGIVMRDLLNALENRRVGVNKVIPKG 397

>Scas_611.2
          Length = 336

 Score =  304 bits (778), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/367 (46%), Positives = 238/367 (64%), Gaps = 44/367 (11%)

Query: 1   MAKSPKRKNSEPEDLSSNKRSKSFEFGKVENGLEPSGSDFGSDLPTPFDTM----VTEQP 56
           MA SPKRK    +  +++K+ K+   G   N   P G    SDL  P  +      +  P
Sbjct: 1   MASSPKRKQENDQSETNSKKVKTSNEG--TNSNVPGG---FSDLALPRSSTDLSSKSTVP 55

Query: 57  LALPKASSPTTNLASPRNSSTPNLXXXXXXXXXXXXXXXXXNXXXXXXXXXXXXXKPQQS 116
           LALP  S  +    +  N+ST N+                               + +QS
Sbjct: 56  LALP-ISKMSKQSKTAGNASTTNVSQ-----------------------------QQKQS 85

Query: 117 DPDKLSDALLSAGVDIREEEALLSSTVARTKATGISANNQVPSHPPFLHPKNISDFMKRI 176
           DP+K+ D L SAGVDIREEEALL+S++  +K    + + ++PSHPPFLHP  ++ FM+R+
Sbjct: 86  DPNKMQDVLFSAGVDIREEEALLNSSIIASKNKINTMDVRIPSHPPFLHPDQVARFMQRV 145

Query: 177 ASEQN--FHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRRSEVSR 234
           A EQ     QDF+K  ++L +MSTACE YMRD++TN+L++S HRR+ +KLN GRRSE+S 
Sbjct: 146 AKEQQRRTRQDFSKYPELLSMMSTACETYMRDILTNALVISRHRRRAIKLNAGRRSEISM 205

Query: 235 SLRDLALRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGGNKKKY 294
            LR++AL++K  EE+RV++RIALGLEK+  + ++D+EET +RASN TA L    G+KK+Y
Sbjct: 206 ILRNIALKEKKDEEKRVKKRIALGLEKEDLENKIDSEETLHRASNVTAGLR--AGSKKQY 263

Query: 295 SWLTAG-SKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALENRRVGV 353
            WLT+  SK ++T +K+ G V+S +AARGE G+K+REAREEPGIVMRDLL ALENRR GV
Sbjct: 264 GWLTSSVSKPTNTSVKSAGKVASDIAARGETGLKFREAREEPGIVMRDLLYALENRRNGV 323

Query: 354 NNVITKG 360
           +NVI+KG
Sbjct: 324 HNVISKG 330

>CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces
           cerevisiae YMR005w MPT1 required for protein synthesis,
           hypothetical start
          Length = 336

 Score =  303 bits (776), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 201/252 (79%), Gaps = 9/252 (3%)

Query: 112 KPQQSDPDKLSDALLSAGVDIREEEALLSSTV--ARTKATGISANNQVPSHPPFLHPKNI 169
           K + +DP+K+ D L+SAGVD++EEEALLSSTV  ++T+   +     +P HPPFLHP  +
Sbjct: 85  KQKATDPNKMQDVLISAGVDLKEEEALLSSTVNVSKTQQNAVV----IPPHPPFLHPDQV 140

Query: 170 SDFMKRIASEQNFHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRR 229
           S+FMK++A  QNF+  F KNT+IL +MS+ACE Y+RD+ITN++++S HRRKGVK+N GRR
Sbjct: 141 SNFMKKVAKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYGRR 200

Query: 230 SEVSRSLRDLALRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGG 289
           S+V+ +LR +A+ QK +EERR+++RIALGLEK+  + ++D+EET +RASN TA L    G
Sbjct: 201 SQVAAALRSIAINQKKEEERRMKKRIALGLEKEDYENKMDSEETLHRASNVTATLR--AG 258

Query: 290 NKKKYSWLTAG-SKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALEN 348
           +KK+Y WLT+  +K +S  +K+ G V++ +AARGE G+K+REAREEPGIVMRDLL ALE+
Sbjct: 259 SKKQYGWLTSSINKPASIGVKSAGKVATEIAARGESGLKFREAREEPGIVMRDLLFALEH 318

Query: 349 RRVGVNNVITKG 360
           RR+GV+N+I+KG
Sbjct: 319 RRIGVHNIISKG 330

>YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA
           polymerase II general transcription factor TFIID [1167
           bp, 388 aa]
          Length = 388

 Score =  294 bits (752), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 208/310 (67%), Gaps = 10/310 (3%)

Query: 59  LPKASSPTTNLASPRNSSTPN-------LXXXXXXXXXXXXXXXXXNXXXXXXXXXXXXX 111
           LPK  SPTTNL    N  T N       L                 +             
Sbjct: 75  LPKNVSPTTNLRVESNGDTNNMFSSPAGLALPKKDDKKKNKGTSKADSKDGKASNSSGQN 134

Query: 112 KPQQSDPDKLSDALLSAGVDIREEEALLSSTVARTKATGISANNQVPSHPPFLHPKNISD 171
             QQSDP+K+ D L SAG+D+REEEALL+S++  +K+   + N ++P+H PFLHP+ +S+
Sbjct: 135 AQQQSDPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKIPNHLPFLHPEQVSN 194

Query: 172 FMKRIASEQNFHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRRSE 231
           +M+++  EQNF+    KN +IL +MS+ACE YMRD++TN++++S HRRK VK+N+GRRSE
Sbjct: 195 YMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRKAVKINSGRRSE 254

Query: 232 VSRSLRDLALRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGGNK 291
           VS +LR +AL QK +EERRV++RIALGLEK+  + ++D+EET +RASN TA L    G+K
Sbjct: 255 VSAALRAIALIQKKEEERRVKKRIALGLEKEDYENKIDSEETLHRASNVTAGLR--AGSK 312

Query: 292 KKYSWLTAG-SKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALENRR 350
           K+Y WLT+  +K +S   K+ G V+S + ARGE G+K+REAREEPGIVMRDLL ALENRR
Sbjct: 313 KQYGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMRDLLFALENRR 372

Query: 351 VGVNNVITKG 360
             V  +I+KG
Sbjct: 373 NSVQTIISKG 382

>YJR107W (YJR107W) [2999] chr10 (627254..628240) Protein of unknown
           function, has similarity to acylglycerol lipase [987 bp,
           328 aa]
          Length = 328

 Score = 32.0 bits (71), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 131 DIREEEALLSSTVARTKATG--ISANNQVPSHPPFLHPKNISDFMKRIASEQN 181
           D  E+E++L   +   K     +   + +P  PPF HP  +  F+ ++   QN
Sbjct: 227 DAIEKESILKDEIQFRKGYFRVVHTGDYIPMVPPFYHPAGLEMFINKVGLPQN 279

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.126    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,279,993
Number of extensions: 413427
Number of successful extensions: 1352
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1338
Number of HSP's successfully gapped: 24
Length of query: 360
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 257
Effective length of database: 13,030,455
Effective search space: 3348826935
Effective search space used: 3348826935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)