Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C05940g64063030510.0
Scas_611.164656820650.0
YMR008C (PLB1)66456920170.0
Sklu_1900.165858219970.0
Kwal_56.2251064157819600.0
CAGL0J11770g65958619430.0
YOL011W (PLB3)68658319120.0
Scas_685.367757818310.0
YMR006C (PLB2)70657317930.0
Scas_644.870458117710.0
CAGL0E02321g70458016300.0
CAGL0J11748g69555915420.0
Scas_92.0d2362116934e-87
AAL027W5924224927e-54
Kwal_0.1735074174721e-51
Sklu_2442.195844334742e-51
YNL012W (SPO1)6315854341e-45
KLLA0F12232g6804254183e-43
CAGL0H03575g5145274001e-41
Scas_695.105534003481e-34
KLLA0A01760g58343692.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05940g
         (630 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...  1179   0.0  
Scas_611.1                                                            800   0.0  
YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...   781   0.0  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement        773   0.0  
Kwal_56.22510                                                         759   0.0  
CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...   753   0.0  
YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...   741   0.0  
Scas_685.3                                                            709   0.0  
YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...   695   0.0  
Scas_644.8                                                            686   0.0  
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...   632   0.0  
CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...   598   0.0  
Scas_92.0d                                                            271   4e-87
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   194   7e-54
Kwal_0.173                                                            186   1e-51
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     187   2e-51
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   171   1e-45
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   165   3e-43
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   158   1e-41
Scas_695.10                                                           138   1e-34
KLLA0A01760g 154859..156610 gi|2497468|sp|P56095|AP1_KLULA Kluyv...    31   2.7  

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score = 1179 bits (3051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/630 (92%), Positives = 581/630 (92%)

Query: 1   MWFLNSVNLLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWL 60
           MWFLNSVNLLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWL
Sbjct: 1   MWFLNSVNLLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWL 60

Query: 61  KVRHESTVPALKDFLQRGFKGFTNDTSIIDKLLATQDTAPKVAIACSGGGYRAMLSGAGM 120
           KVRHESTVPALKDFLQRGFKGFTNDTSIIDKLLATQDTAPKVAIACSGGGYRAMLSGAGM
Sbjct: 61  KVRHESTVPALKDFLQRGFKGFTNDTSIIDKLLATQDTAPKVAIACSGGGYRAMLSGAGM 120

Query: 121 ISAMDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSI 180
           ISAMDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSI
Sbjct: 121 ISAMDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSI 180

Query: 181 WDISNSIVNPGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEG 240
           WDISNSIVNPGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEG
Sbjct: 181 WDISNSIVNPGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEG 240

Query: 241 GVGYTWNTLRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHT 300
           GVGYTWNTLRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHT
Sbjct: 241 GVGYTWNTLRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHT 300

Query: 301 FTDVRYAXXXXXXXXXXXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNLL 360
           FTDVRYA             KCVAGFDNTGFVMG                DLPSFLYNLL
Sbjct: 301 FTDVRYAGTNVTNGTPNVTGKCVAGFDNTGFVMGTSSSLFNQFLLQLNTTDLPSFLYNLL 360

Query: 361 HGFLTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLL 420
           HGFLTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLL
Sbjct: 361 HGFLTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLL 420

Query: 421 QTEREIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLN 480
           QTEREIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLN
Sbjct: 421 QTEREIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLN 480

Query: 481 TRPTFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAV 540
           TRPTFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAV
Sbjct: 481 TRPTFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAV 540

Query: 541 TMKNLTKDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVDAXXXXXXXXXX 600
           TMKNLTKDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVDA          
Sbjct: 541 TMKNLTKDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVDATTPISSTTSS 600

Query: 601 XXXXXXXXXXGNKENSARILAPRSTLSLLI 630
                     GNKENSARILAPRSTLSLLI
Sbjct: 601 SASSTSTSDSGNKENSARILAPRSTLSLLI 630

>Scas_611.1
          Length = 646

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/568 (67%), Positives = 441/568 (77%), Gaps = 2/568 (0%)

Query: 23  VNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQRGFKGF 82
           V AWSP+N Y P  V CD+NINL+R+A+++SDDE  WL  R   T  AL+ FL+R    F
Sbjct: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77

Query: 83  TNDTSIIDKLLA-TQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQ 141
           + DTS+I +L +    +AP++ +ACSGGGYRAMLSGAGM++AMDNRTDGAN+HGLGGLLQ
Sbjct: 78  S-DTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQ 136

Query: 142 SSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISR 201
            +TYLAGLSGGNWL  TL +NNWTSVQAI+NNMT+D+SIWDIS+SI+NPGG NI  +  R
Sbjct: 137 GATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNDDSIWDISHSIINPGGWNILETGER 196

Query: 202 WDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMP 261
           WD ISDAV+ K+ AGFN S+ DVWGRALSYNFFPSL  GG GYTW+TLRD DVFKN EMP
Sbjct: 197 WDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMP 256

Query: 262 FPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXXXXXXXK 321
           FPISVA GRYPGT V+NLNATVFEFNPFEMGSWD TL+TFTDV+Y              K
Sbjct: 257 FPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGK 316

Query: 322 CVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNLLHGFLTDASDDYDDISIWAPNP 381
           C+AGFDNTGF+ G                 LPSF+  L   FL D S DY+DI+I++PNP
Sbjct: 317 CIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNP 376

Query: 382 FYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNSADTDQS 441
           F +   I SNYS+SI +   L+LVDGGED QNIPL PLLQ ERE+DVIFALDNSADT+QS
Sbjct: 377 FRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQS 436

Query: 442 WPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTDLESIPP 501
           WPDG SL  TY RQFG+QG G+AFPYVPD NTF NLGLN RPTFFGCDARNLTDLE IPP
Sbjct: 437 WPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPP 496

Query: 502 LVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILR 561
           LVVY+PN R SFN N STFKMSYSTSERF MIQNGFE+ T  N T D +F+GCI CAI+R
Sbjct: 497 LVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMR 556

Query: 562 RKQESLNYTLPSECDACFEKYCWNGTVD 589
           RKQ+S+N TLP+EC+ CF  YCWNGT+D
Sbjct: 557 RKQQSMNATLPTECNQCFTNYCWNGTID 584

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/569 (65%), Positives = 436/569 (76%), Gaps = 2/569 (0%)

Query: 23  VNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQRGFKGF 82
           VNAWSP N Y P  V CD++INLVR+A  +SD+E +WLK R   T  AL  FL R    F
Sbjct: 20  VNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNF 79

Query: 83  TNDTSIIDKLLATQDT-APKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQ 141
           + DTS++  L  +  +  PK+A+ACSGGGYRAMLSGAGM++AMDNRTDGAN+HGLGGLLQ
Sbjct: 80  S-DTSLLSTLFGSNSSNMPKIAVACSGGGYRAMLSGAGMLAAMDNRTDGANEHGLGGLLQ 138

Query: 142 SSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISR 201
            +TYLAGLSGGNWL  TLA+NNWTSVQAI++N T+ NSIWDIS+SI+ P GINIF + SR
Sbjct: 139 GATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSR 198

Query: 202 WDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMP 261
           WDDISD V++KK AGFN S+ DVWGRAL+YNF+PSL  GGVGYTW+TLR+ DVFKNGEMP
Sbjct: 199 WDDISDDVQDKKDAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMP 258

Query: 262 FPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXXXXXXXK 321
           FPI+VA GRYPGT V+NLNAT+FEFNPFEMGSWD TL+ FTDV+Y              +
Sbjct: 259 FPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQ 318

Query: 322 CVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNLLHGFLTDASDDYDDISIWAPNP 381
           C+AGFDNTGF+                  DLPSF+ NL   FL D SD+ DDI+I+APNP
Sbjct: 319 CIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNP 378

Query: 382 FYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNSADTDQS 441
           F E   +  N + SI E + L+LVDGGED QNIPL PLLQ ERE+DVIFALDNSADTD  
Sbjct: 379 FKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDY 438

Query: 442 WPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTDLESIPP 501
           WPDG SL  TY RQFG QG  ++FPYVPDVNTF NLGLN +PTFFGCDARNLTDLE IPP
Sbjct: 439 WPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPP 498

Query: 502 LVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILR 561
           L+VY+PN+R SFN N STFKMSYS SER  MI+NGFEA TM N T D +F+GC+ CAI+R
Sbjct: 499 LIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIR 558

Query: 562 RKQESLNYTLPSECDACFEKYCWNGTVDA 590
           RKQ++LN TLPSEC  CF  YCWNGT+D+
Sbjct: 559 RKQQNLNATLPSECSQCFTNYCWNGTIDS 587

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/582 (63%), Positives = 441/582 (75%), Gaps = 8/582 (1%)

Query: 10  LFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTVP 69
           +  + S+   L  V AWSPTN Y PG V CD++INLVR+A  +S DE++WLK R   T  
Sbjct: 1   MLALASLVFLLSTVGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNS 60

Query: 70  ALKDFLQRGFKGFTNDTSIIDKLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTD 129
           AL+DFL R  + FT D SI+ K L    +AP++ +ACSGGGYRAMLSGAGM++AMDNRT 
Sbjct: 61  ALEDFLNRATENFT-DNSIV-KTLFNSSSAPRIGVACSGGGYRAMLSGAGMLAAMDNRTR 118

Query: 130 GANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVN 189
           G+ +HGLGGLLQS+TYLAGLSGGNWLVGTLA+NNWTSVQ I++ M  D+ IWDISNSI++
Sbjct: 119 GSVEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQDDDIWDISNSIIS 178

Query: 190 PGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTL 249
           PGG N+  + SRWDDISDAV+ K+ AGFN S+TDVWGRALSY+FFP+L  GG  YTW+TL
Sbjct: 179 PGGTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTL 238

Query: 250 RDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXX 309
           R+ DVFKN EMPFPISVA GRYPGTQV+NLNATVFEFNPFEMGSWD +L  FT+V+Y   
Sbjct: 239 READVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGT 298

Query: 310 XXXXXXXXXXXKCVAGFDNTGFVMGXXX------XXXXXXXXXXXXXDLPSFLYNLLHGF 363
                      +C+AGFDNTGF+MG                       LPS+LY   + F
Sbjct: 299 KVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQFSLQSNSTLMLLNASLPSYLYKFANKF 358

Query: 364 LTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTE 423
           LT  S DYDDI+++APNPF     +  NY++SI E + LYLVDGGEDGQNIPL PLLQ E
Sbjct: 359 LTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEE 418

Query: 424 REIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRP 483
           RE+DVIFALDNSADT+Q WP+GFSLTQTY RQF  QG  IAFPYVPDV+TF  LGLN RP
Sbjct: 419 RELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRP 478

Query: 484 TFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMK 543
           TFFGCDA NLTDL+ IPPLVVYMPNT+ESFNSN STFK+SYS+  R  MI+NGFEAVT  
Sbjct: 479 TFFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRN 538

Query: 544 NLTKDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWN 585
           NLT D +F+ C++CA++RRKQ+S+N TLP EC+ CF  YCWN
Sbjct: 539 NLTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580

>Kwal_56.22510
          Length = 641

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/578 (61%), Positives = 439/578 (75%), Gaps = 2/578 (0%)

Query: 9   LLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTV 68
           +L+++  +   + AV AWSPT+ Y PG V C ++INLVRKA ++S +E +WLK R   T 
Sbjct: 1   MLWILSLLLAAISAVQAWSPTDSYVPGNVSCADDINLVRKASSLSPNETEWLKKRDAYTK 60

Query: 69  PALKDFLQRGFKGFTNDTSIIDKLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRT 128
            AL+ FL R    F+N +S++D +  +    P++A+ACSGGGYRAMLSGAGM+SAMDNRT
Sbjct: 61  EALRTFLDRATSNFSN-SSLVDNVWKSGKI-PRIAVACSGGGYRAMLSGAGMLSAMDNRT 118

Query: 129 DGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIV 188
           +GA +HGLGGLLQS+TYLAGLSGGNWLVG+LA+NNWTSVQ II+    D+ +WDISNSI+
Sbjct: 119 NGATEHGLGGLLQSTTYLAGLSGGNWLVGSLAWNNWTSVQHIIDTRGTDDELWDISNSIL 178

Query: 189 NPGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNT 248
           NPGG+NI +S +RWD ISDAVE K  AGFNTS+ DVWGRALSY+FFP+L +GG+GYTW+T
Sbjct: 179 NPGGVNILTSANRWDQISDAVEAKGDAGFNTSLADVWGRALSYDFFPTLYKGGLGYTWST 238

Query: 249 LRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAX 308
           LRD DVFKNGEMPFPISVA GRYPGTQ+++LN+T+FEFNPFEMGSWD +L+ FTDV+Y  
Sbjct: 239 LRDADVFKNGEMPFPISVADGRYPGTQIIDLNSTLFEFNPFEMGSWDPSLNAFTDVKYLG 298

Query: 309 XXXXXXXXXXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNLLHGFLTDAS 368
                       +CVAGFDNTGFVMG                 + SFL   +  FL D S
Sbjct: 299 TEVKNGTPVTQGQCVAGFDNTGFVMGTSSTLFNQFLLQLNTTSVSSFLKGFIQDFLQDLS 358

Query: 369 DDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDV 428
           +D +DI+I+ PNPF +   +  NY+  I   + L+LVDGGEDG+NIPL PL+Q +R++DV
Sbjct: 359 EDSNDIAIYNPNPFRDTAYVDKNYTHGIVNSENLFLVDGGEDGENIPLVPLIQQDRDVDV 418

Query: 429 IFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGC 488
           IFALDNSADTD+ WP G SL  TY RQFG QGK IAFPYVPDV+TF N GLNT+P FFGC
Sbjct: 419 IFALDNSADTDEYWPAGLSLMHTYERQFGPQGKDIAFPYVPDVDTFVNEGLNTKPVFFGC 478

Query: 489 DARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKD 548
           DA N +DL   PPL+VYMPN R+S+NSNTSTFKMSYS+S+R KM QNGFEA+T  NLT D
Sbjct: 479 DATNTSDLAYTPPLIVYMPNNRQSYNSNTSTFKMSYSSSQRMKMYQNGFEAITRNNLTDD 538

Query: 549 ENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNG 586
            NFMGC++CA+LRRKQES N T P EC  CF+ YCW+G
Sbjct: 539 SNFMGCVACAVLRRKQESQNMTFPEECTKCFQNYCWDG 576

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/586 (60%), Positives = 441/586 (75%), Gaps = 4/586 (0%)

Query: 8   NLLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHEST 67
           +L+  V  +A     V AWSPTN Y P  V C  +INL+R A  +S  E DWLK R  +T
Sbjct: 5   DLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKRDVNT 64

Query: 68  VPALKDFLQRGFKGFTNDTS---IIDKLLATQDT-APKVAIACSGGGYRAMLSGAGMISA 123
             AL+ FL+R    FT+++S   +ID+L +T  +  PK+ IA SGGGYRAMLSGAGM+SA
Sbjct: 65  REALESFLKRVTSNFTSNSSASNLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSA 124

Query: 124 MDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDI 183
           MDNRTDGAN+HGLGGLLQ++TYLAGLSGGNWL  TL++NNWTSVQ I+++  +D++IWDI
Sbjct: 125 MDNRTDGANEHGLGGLLQAATYLAGLSGGNWLTTTLSWNNWTSVQDIVDSQDNDSAIWDI 184

Query: 184 SNSIVNPGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVG 243
           S+SIV+PGGINIF + SRWD ISDAVE+K+KAGFN S+ DVWGRALSY FFP+L  GGV 
Sbjct: 185 SHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVA 244

Query: 244 YTWNTLRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTD 303
           Y W+ LR+ DVFKN EMP PISVA GRYPGT V++LN+TVFE++PFE+GSWD +L  FTD
Sbjct: 245 YLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTD 304

Query: 304 VRYAXXXXXXXXXXXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNLLHGF 363
           V+Y              KC+AGFDN GF+MG                 +P F+ NL   F
Sbjct: 305 VQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHF 364

Query: 364 LTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTE 423
           L D S+DYDDI+++APNPF +   + +N S+S+SE + L+LVDGGEDGQN+PL PL+Q E
Sbjct: 365 LKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQE 424

Query: 424 REIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRP 483
           R++D++FALDNSADT+++WPDG SL  TY RQFG QG+G+ FP VP  +TF NLGLN +P
Sbjct: 425 RDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKP 484

Query: 484 TFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMK 543
           TFFGCDARN+TDLE IPPL+VY+PN+R S+N NTSTFK+SYS  ER  +I+NGFEA TM 
Sbjct: 485 TFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMN 544

Query: 544 NLTKDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVD 589
           NLT D NF GCI CAI+RRKQ++LN TLP EC+ CF  YCWNGT+D
Sbjct: 545 NLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTID 590

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/583 (58%), Positives = 438/583 (75%), Gaps = 2/583 (0%)

Query: 9   LLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTV 68
           ++  + +++  L A NAWSPT+ Y PG V C ++INLVR+A ++S +E+ WL+ R++ T 
Sbjct: 10  IISYIFAISQFLLAANAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTS 69

Query: 69  PALKDFLQRGFKGFTNDTSIIDKLL--ATQDTAPKVAIACSGGGYRAMLSGAGMISAMDN 126
            ALKDFL R    F++ + ++ KL      +  PK+A+A SGGGYR+ML+GAG+++AMDN
Sbjct: 70  VALKDFLTRATANFSDSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDN 129

Query: 127 RTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNS 186
           RT+GA +HGLGGLLQS+TYL+G SGGNWLVGTLA NNWTSVQ I+NNM +D+SIWD+S+S
Sbjct: 130 RTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDS 189

Query: 187 IVNPGGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTW 246
           IV PGGINIF +  RWD IS+AVE K+ A +NTS+ D+WGRAL+YNFFPSL+ GG+G TW
Sbjct: 190 IVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTW 249

Query: 247 NTLRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRY 306
           +++RD  VF+N EMPFPISVA GRYPGT+V+NLNATVFEFNPFEMGSWD +L++F +V+Y
Sbjct: 250 SSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKY 309

Query: 307 AXXXXXXXXXXXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNLLHGFLTD 366
                         KC AGFDN GF+MG                 LPSF+  L   FL D
Sbjct: 310 LGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKD 369

Query: 367 ASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREI 426
            S D++DI++++PNPF +   + S+Y+ SI + D+L+LVDGGED +N+P+ PL+Q ER++
Sbjct: 370 LSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDV 429

Query: 427 DVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFF 486
           D+IFA+DNSAD   +WPDG SL  TY RQF  QG+G++FPYVPD NTF NLGLN +PTFF
Sbjct: 430 DIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFF 489

Query: 487 GCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLT 546
           GCDA NLTDL+ IPPLVVY+PN   SFNSN S FK+SYS S+R  MIQNGFE  T  N T
Sbjct: 490 GCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFT 549

Query: 547 KDENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVD 589
            D  FMGC+ CAI+RRKQ++LN TLP EC+ CF+ YCWNGT+D
Sbjct: 550 DDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLD 592

>Scas_685.3
          Length = 677

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/578 (59%), Positives = 429/578 (74%), Gaps = 4/578 (0%)

Query: 12  LVCSVALHLDAVNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTVPAL 71
           L+   A+  +AV AWSP+NGYAP  V C +++NL+R+A  +S DE DWLK R+  T  +L
Sbjct: 6   LLLIAAISSNAVQAWSPSNGYAPANVTCADDVNLLREASDLSKDEQDWLKKRNTITAESL 65

Query: 72  KDFLQRGFKGFTNDTS-IIDKLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTDG 130
           K FL R  K F++ +S +++KL    D  PK+ IA SGGGYRAML+GAGM++AMDNRT G
Sbjct: 66  KTFLDRSTKNFSDSSSSLLNKLFQDGDNVPKIGIAASGGGYRAMLAGAGMLAAMDNRTSG 125

Query: 131 ANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNP 190
           ANDHGLGGLLQSSTYLAGLSGGNWL  TLA+NNWTSVQ II+N+T +NSIWDI NS+ + 
Sbjct: 126 ANDHGLGGLLQSSTYLAGLSGGNWLTTTLAWNNWTSVQDIIDNITVENSIWDIDNSLFS- 184

Query: 191 GGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLR 250
             I+  ++ S W DI++ V+ K+ AGFN ++ D+WGRAL+YNFFP L  GG GYTW+TLR
Sbjct: 185 --ISEMANSSIWTDIANDVKAKQDAGFNVTLADLWGRALAYNFFPDLYHGGAGYTWSTLR 242

Query: 251 DVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXX 310
           D +VFKN EMPFPI+VA GRYPGT V++LNATVFEFNPFEMGSWD TL++FTDV+Y    
Sbjct: 243 DSEVFKNAEMPFPITVADGRYPGTTVISLNATVFEFNPFEMGSWDPTLNSFTDVKYLGTN 302

Query: 311 XXXXXXXXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNLLHGFLTDASDD 370
                     +CVAGFDN GFV+G                 LP  L  L   F    +D 
Sbjct: 303 VSNGKPIDAGQCVAGFDNAGFVLGTSATLFNLMPLPFTSSMLPKSLSVLGDNFTASLADT 362

Query: 371 YDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIF 430
           Y+DI+I++PNPF +  ++ SN+S++I + D L+LVDGGEDG+ IPL PLLQ +R +DV+F
Sbjct: 363 YNDIAIYSPNPFRDADSVKSNFSKAIVDSDDLFLVDGGEDGEVIPLVPLLQEKRGLDVVF 422

Query: 431 ALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDA 490
           ALD ++DT  SWPDG SL  TY RQF  QG+G++FPYVPD  TF   GLNT+PTFFGCDA
Sbjct: 423 ALDFNSDTTTSWPDGSSLVATYQRQFEDQGEGMSFPYVPDTETFIKYGLNTKPTFFGCDA 482

Query: 491 RNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDEN 550
           +NLTDLE IPPL+VY+PN+R SFNSNTST ++SY++S+R  MIQNGFE+ T  N T D  
Sbjct: 483 KNLTDLEYIPPLIVYIPNSRYSFNSNTSTLQLSYNSSQRLGMIQNGFESATRGNFTDDPE 542

Query: 551 FMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTV 588
           F+GCI CAI+RRKQ+SLN TLPSEC+ CF  YCWNGT+
Sbjct: 543 FLGCIGCAIMRRKQQSLNETLPSECEQCFTNYCWNGTL 580

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/573 (57%), Positives = 415/573 (72%), Gaps = 3/573 (0%)

Query: 18  LHLDAVNAWSPTNGYAPGVVDC-DENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQ 76
           L L A ++ +  +GYAP ++ C  ++ +LVR A  +S  E DWLK R   T  AL  FL 
Sbjct: 16  LSLAADSSSTTGDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLS 75

Query: 77  RGFKGFTNDTSIIDKLLATQDT-APKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHG 135
           R    F+ DTS++  L ++  +  PK+ IACSGGGYRAML GAGMI+AMDNRTDGAN+HG
Sbjct: 76  RATSNFS-DTSLLSTLFSSNSSNVPKIGIACSGGGYRAMLGGAGMIAAMDNRTDGANEHG 134

Query: 136 LGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINI 195
           LGGLLQSSTYL+GLSGGNWL GTLA+NNWTSVQ I+++M++ +SIW+I+ SIVNPGG N+
Sbjct: 135 LGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNL 194

Query: 196 FSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVF 255
             +I RW+ I   V+ K  AGFN S++D+W RALSYNFFPSL + G   TW++LRDVDVF
Sbjct: 195 TYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVF 254

Query: 256 KNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXX 315
           KNGEMP PI+VA GRYPGT V+NLNAT+FEF PFEMGSWD +L+ FTDV+Y         
Sbjct: 255 KNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGK 314

Query: 316 XXXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNLLHGFLTDASDDYDDIS 375
                +CV+G+DN GFV+                      + +  + ++ + S D DDI+
Sbjct: 315 PVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIA 374

Query: 376 IWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNS 435
           I+A NPF +   +  NY+ SI + D L+LVDGGEDGQN+PL PL++ ER++DV+FALD S
Sbjct: 375 IYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDIS 434

Query: 436 ADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTD 495
            +TD+SWP G  +T TY RQ+  QGKG+AFPYVPDVNTF NLGL  +PTFFGCDA+NLTD
Sbjct: 435 DNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTD 494

Query: 496 LESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCI 555
           LE IPPLVVY+PNT+ SFN N ST KM+Y+ +ER  MI+NGFEA TM N T D NF+GCI
Sbjct: 495 LEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCI 554

Query: 556 SCAILRRKQESLNYTLPSECDACFEKYCWNGTV 588
            CAI+RRKQESLN TLP EC  CF  YCWNGT+
Sbjct: 555 GCAIIRRKQESLNATLPPECTKCFADYCWNGTL 587

>Scas_644.8
          Length = 704

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/581 (56%), Positives = 416/581 (71%), Gaps = 16/581 (2%)

Query: 25  AWSPTNGYAPGVVDC--------DENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQ 76
           AW+P+N YAP  +DC        +E+ +L+R+AD++S +E+ WL+ R ++T   L  FL 
Sbjct: 22  AWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFLN 81

Query: 77  RGFKGFTN----DTSIIDKLLATQDTA--PKVAIACSGGGYRAMLSGAGMISAMDNRTDG 130
           R           DT+ +   L   D+A  PK+ IA SGGGYR+ML+GAG+++AMDNRT G
Sbjct: 82  RSLTSLNTSSSFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRG 141

Query: 131 ANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNP 190
           A  HGLGGLLQS+TYL+G SGGNWLVGTLAYNNWTSVQ+II+N  + +SIWD+S SIV+P
Sbjct: 142 AQHHGLGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIWDLSESIVSP 201

Query: 191 GGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLR 250
           GG NIF S  RWD ISDA+++K+KAGF+TS+ DVWGRALSY FFPSL  GGV YTW++LR
Sbjct: 202 GGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLR 261

Query: 251 DVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXX 310
           D  VF  G+MPFPISVA GRYPG++V+NLNATVFEFNPFEMGSWD +L+TFTDV++    
Sbjct: 262 DSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTN 321

Query: 311 XXXXXXXXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXD--LPSFLYNLLHGFLTDAS 368
                     +CV GFDNT F+MG                +  LP F+  L   FL D S
Sbjct: 322 VSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKLATHFLKDIS 381

Query: 369 DDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDV 428
            D++D++ + PNPF +   I +NY++SI    +LYLVDGGED +NIPL PL+Q ER++D+
Sbjct: 382 QDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDI 441

Query: 429 IFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGC 488
           +FA+DNS D   +WPDG SL  T+ RQF  QG+G+AFPYVP  +TF NLGLN +PTFFGC
Sbjct: 442 VFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPTFFGC 501

Query: 489 DARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKD 548
           DA NLTDLE IPPLV+Y+PN + SF SN S FK+SY+  +R  MI NGFE  T  N T D
Sbjct: 502 DAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDD 561

Query: 549 ENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVD 589
            +F+GCI CAI+RRKQ+SLN TLP  C+ CF  YCWNGT+D
Sbjct: 562 PDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLD 602

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/580 (51%), Positives = 397/580 (68%), Gaps = 15/580 (2%)

Query: 24  NAWSPTNGYAPGVVDC-DENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQRGFKGF 82
           + +S  + YAP +  C  ++INLVR+A  +S +E  WL+ R   T  AL +FLQR     
Sbjct: 18  SGYSVADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSS 77

Query: 83  TNDTSIIDKLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQS 142
            N T +  ++       P++ IA SGGGYR+ML+GAG++SA DNRT GA DHGLGG+LQS
Sbjct: 78  QNFTQLFHRIFDA-GMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQS 136

Query: 143 STYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNS-----------IWDISNSIVNPG 191
           +TY+ G SGGNWLV +L++NNWTSVQ I++   D  +           IWD+S+SIV+PG
Sbjct: 137 TTYMTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPG 196

Query: 192 GINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRD 251
           G+NI  +  RWD I++AV+ K++AGFNTS+ DVWGRALSY FFP+L+ GG+ YTW++LRD
Sbjct: 197 GLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRD 256

Query: 252 VDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRY--AXX 309
             +F+ G+MP PI+VA GRYPG+  + LNATVFEFNPFEMGSWD +L+ FTDV+Y     
Sbjct: 257 SPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNV 316

Query: 310 XXXXXXXXXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNLLHGFLTDASD 369
                      KC+ GFDNT F+MG                 LP+F+       L   + 
Sbjct: 317 TNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAH 376

Query: 370 DYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVI 429
           +++D++++ PNPF +   +  N+S SI + + LYLVDGGED +N+PL PLLQ +R++D+I
Sbjct: 377 EFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDII 436

Query: 430 FALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCD 489
           FA+DNSAD    WPDG SL  TY RQF LQG+ IAFP++PD NTF NLGLN RPTFFGC+
Sbjct: 437 FAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCN 496

Query: 490 ARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDE 549
           A N+T L+ IPPLVVY PN+  SFNSN S FK+SYS  +   MI NGFE  T  N T D 
Sbjct: 497 ATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDP 556

Query: 550 NFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVD 589
            F+GCI+CAI++RKQE+L+  LPSEC+ C  +YCW+GTVD
Sbjct: 557 EFIGCIACAIMKRKQEALDLELPSECERCLARYCWDGTVD 596

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/559 (51%), Positives = 378/559 (67%), Gaps = 4/559 (0%)

Query: 32  YAPGVVDCDENINLVRKA-DAVSDDEADWLKVRHESTVPALKDFLQRGFKGFTNDTSIID 90
           Y P  V C +N N +R A D +S  E +WLK R   T  AL+ FL+R F   +  T I  
Sbjct: 22  YTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS--TEITS 79

Query: 91  KLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQSSTYLAGLS 150
            L    +  PK+ IA +GGGYRAM  GAG  +AMDNRTDGAN+HGLGGLLQ++TY+AGLS
Sbjct: 80  ALFNDTENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGLGGLLQAATYMAGLS 139

Query: 151 GGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISRWDDISDAVE 210
           GGNWL GTLAYNN+TSVQ I+      ++IW+I+NS +NP   +   +++RW  I   V+
Sbjct: 140 GGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQ 199

Query: 211 EKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMPFPISVAVGR 270
            K+ AGFN +ITD+W RAL+Y +FP+L   G G TW++LRD ++F NGEMP PISVA GR
Sbjct: 200 GKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGR 259

Query: 271 YPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXXXXXXXKCVAGFDNTG 330
           YPGT V+NLNATVFE  PFE+GSWD +L+ F+D++Y              +C+ GFD+  
Sbjct: 260 YPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKY-LGTQVTDGKPETERCINGFDDAS 318

Query: 331 FVMGXXXXXXXXXXXXXXXXDLPSFLYNLLHGFLTDASDDYDDISIWAPNPFYEITNIPS 390
           F+MG                   ++L  L    +     + +DI+++APNPF     + S
Sbjct: 319 FIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDS 378

Query: 391 NYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNSADTDQSWPDGFSLTQ 450
           NY+ SI + D+L+LVDGGED Q IP  PLL+ ER++D+IFA+D   +T  ++P G  + +
Sbjct: 379 NYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMK 438

Query: 451 TYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTDLESIPPLVVYMPNTR 510
           TY RQF  QGKG+AFPYVPD+ TF NLGL  +P+F+GCDA NLTDLE IPPL+VY+PN+ 
Sbjct: 439 TYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSY 498

Query: 511 ESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILRRKQESLNYT 570
            SF SN STFK++Y+ SER  MI+N FEA T  NLT+D +++ C+ CAI+RRKQ+SLN T
Sbjct: 499 HSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLT 558

Query: 571 LPSECDACFEKYCWNGTVD 589
           LP  CD CF  YCWNGT+D
Sbjct: 559 LPDICDKCFTNYCWNGTID 577

>Scas_92.0d
          Length = 236

 Score =  271 bits (693), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 151/211 (71%)

Query: 240 GGVGYTWNTLRDVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLH 299
           GG  YTW+TLR+ DVFKN EMPFPISVA GRYPGTQV+NLNATVFEFNPFEMGSWD +L 
Sbjct: 19  GGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLR 78

Query: 300 TFTDVRYAXXXXXXXXXXXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNL 359
            FT+V+Y              +C+AGFDNTGF+MG                 LPSF+Y L
Sbjct: 79  AFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQFLLQLNTTGLPSFIYKL 138

Query: 360 LHGFLTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPL 419
            + FLT  SDDYDDI+++APNPF    ++  NY++SI E + LYLVDGGEDGQNIPL PL
Sbjct: 139 ANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESEILYLVDGGEDGQNIPLVPL 198

Query: 420 LQTEREIDVIFALDNSADTDQSWPDGFSLTQ 450
           LQ ERE+DVIFALDNSADT+Q WP+GF    
Sbjct: 199 LQEERELDVIFALDNSADTNQYWPNGFEFHH 229

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  194 bits (492), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 132/422 (31%), Positives = 191/422 (45%), Gaps = 53/422 (12%)

Query: 199 ISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNG 258
           +S + D+   V  KK  GF  S TD WGRAL    +  ++E  +          ++  N 
Sbjct: 189 LSFYIDLHSEVRPKKIMGFPVSFTDYWGRALWKKIY--VNESMISSMSELFARSEITNNY 246

Query: 259 EMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXXXXX 318
           E P PI +A  +     +VN    VFEF PFE GSW+  L  F +++Y            
Sbjct: 247 EAPLPIIIANCK--NEDLVN---AVFEFTPFEFGSWNRLLGLFVNLKY---LGSNFTEGV 298

Query: 319 XXKCVAGFDNTGFVMGXXXXX---------XXXXXXXXXXXDLPSFLYNLLHGFLTDASD 369
              CV GFD+ GF+                                L++     L +  +
Sbjct: 299 AQSCVQGFDDIGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGVNLKNKPN 358

Query: 370 DY----DDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTERE 425
            +     D +++ PNPFY    + S     ++  D LYLVDGGEDG+NIPL P LQ ER+
Sbjct: 359 SFFGTRSDFALFQPNPFYRYPGVDS----PLTNSDKLYLVDGGEDGENIPLRPFLQPERQ 414

Query: 426 IDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIA------------FPYVPDVNT 473
           +D+IFALD+S+    ++P G  L   Y       G                 PY+P    
Sbjct: 415 VDLIFALDSSSGR-INYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIPSAEE 473

Query: 474 FTNLGLNTRPTFFGC-----DARNLTDLES---IPPLVVYMPNTRESFNSNTSTFKMSYS 525
           F   GL  RP  FGC       RN +   +   +PP+V Y  N   ++NSNTSTFK+ Y+
Sbjct: 474 FEAKGLLKRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFKLRYN 533

Query: 526 TSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILRRKQESLNYT--LPSECDACFEKYC 583
            SE   M++NG    T  N T    +  C+ C +++R  +++N +  LP  C  CF +YC
Sbjct: 534 HSEVQGMLENGASLFTHDNNTA---YFQCVGCLVVKRAYDNVNASAKLPPTCQQCFRRYC 590

Query: 584 WN 585
           +N
Sbjct: 591 YN 592

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 10/51 (19%)

Query: 114 MLSGAGMISAMDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNW 164
           ML+ +G +  M +R          GL   ++Y+A +SGG+W +  L   N+
Sbjct: 1   MLTSSGFLLGMHSR----------GLFNCASYIASISGGSWTLMRLLLTNF 41

>Kwal_0.173
          Length = 507

 Score =  186 bits (472), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 136/417 (32%), Positives = 194/417 (46%), Gaps = 62/417 (14%)

Query: 209 VEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGV-GYTWNTLRDVDVFKNGEMPFPISVA 267
           V+ KK +GF  S TD WG AL  +  P+   G +  +   + R    F+  E+P PI VA
Sbjct: 113 VKSKKLSGFPISFTDYWGEALVTSIAPTHTTGSISAFADKSQR----FQRYEVPLPIFVA 168

Query: 268 VGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXXXXXXXKCVAGFD 327
                  +  NL   VFEF PFE GSW   +  F  +RY              KC+ GFD
Sbjct: 169 -----NCKNDNLRNAVFEFTPFEFGSWT-NMRLFIPLRY---LGSQITAGTPQKCIIGFD 219

Query: 328 NTGFVMGXXXXXXXXXXXXXXXXDLPSF-----------LYNL-LHGFLTDASDD----- 370
             GFV                    PS             + L +H   T +  +     
Sbjct: 220 EVGFVTATSSSLFNSVLMYVWHLVAPSLDTRKAVRAIFSTFGLGIHKTTTVSKGEANIMS 279

Query: 371 YDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIF 430
           + + +I+ PNPFY+    P+  S  +++ + LYLVDGGEDG+NIP+ PLL  ER++DVIF
Sbjct: 280 HPEYAIYQPNPFYKH---PAT-SDVLAKHNQLYLVDGGEDGENIPIGPLLIPERKLDVIF 335

Query: 431 ALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPY-----VPDVNTFTNLGLNTRPTF 485
           ALD+S+D   S+P+G  L   Y   +G        PY     +P    F    L +RP  
Sbjct: 336 ALDSSSDV-CSFPNGTMLWNFYQNNYGHSSSKSNTPYQLLPLIPSSEEFVARRLLSRPVA 394

Query: 486 FGCD------------ARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMI 533
           FGC              RN + LE +PP+++Y  N   SF SN STFK+ YS  E  +M+
Sbjct: 395 FGCHMESYPTLNSTNWVRNSSHLE-LPPILIYHANANHSFASNLSTFKLKYSKIEVEQML 453

Query: 534 QNGFEAVTMKNLTKDENFMGCISCAILRRKQES-----LNYTLPSECDACFEKYCWN 585
           +NG    +  +  K   +  C++C +++R  +          LP  CD CF +YC+N
Sbjct: 454 RNGKHIFSFDDRPK---YKRCLACLLVKRNYDRSIILGEEVRLPFFCDVCFSEYCYN 507

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  187 bits (474), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 127/433 (29%), Positives = 204/433 (47%), Gaps = 57/433 (13%)

Query: 194 NIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVD 253
           N   ++  + ++   V  KK  GF+ S TD WGRAL       L           L +  
Sbjct: 168 NFRQTLEFYINLHFEVRPKKIKGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENCR 227

Query: 254 VFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXX 313
            FK  ++PFPI V+  +   ++ V     VFEF PFE GSWD  L+ F  ++Y       
Sbjct: 228 NFKEFKVPFPIIVSNCKNSPSKTV-----VFEFTPFEFGSWDEYLNEFIKLKYLGSKIVS 282

Query: 314 XXXXXXXKCVAGFDNTGFVMGXXXXX--------------XXXXXXXXXXXDLPSFLYNL 359
                  +C  GFD+ GF+                                 + +F   L
Sbjct: 283 GKTF---RCFNGFDDIGFISATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGLRL 339

Query: 360 LHGF-LTDASDD---YDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIP 415
           +      D  ++     D +++ PNPFY++  +    +  +++++ LYLVDGGE+G+NIP
Sbjct: 340 VKDMGAKDVPNNPLTRPDYALYRPNPFYKLLTV----NNELTKENHLYLVDGGENGENIP 395

Query: 416 LTPLLQTEREIDVIFALDNSADTDQSWPDGFSLTQTY------ARQFGLQGKGIA----- 464
           + PLL  +R++DVIFALD+S+D++ ++P+G  L   Y           +  +GI      
Sbjct: 396 IRPLLLPQRKLDVIFALDSSSDSN-NYPNGTILRNLYNNFHNGQESLNITREGITSNIDL 454

Query: 465 FPYVPDVNTFTNLGLNTRPTFFGCD----------ARNLTDLESIPPLVVYMPNTRESFN 514
            PY+P+  +F    L +RP  FGC               T+  ++PP+V+Y  N   S++
Sbjct: 455 LPYIPNSKSFVEQQLFSRPVAFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHSYS 514

Query: 515 SNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILRRKQESLNYT--LP 572
           SNTSTFK SY++SE   M++NG +         +  +  C+ C I++R+ +    T  LP
Sbjct: 515 SNTSTFKQSYNSSEIEGMLRNGQDIF---GFDANNTYHKCLGCIIIKREYDRRQTTAELP 571

Query: 573 SECDACFEKYCWN 585
             C  C++ YC+N
Sbjct: 572 EFCHQCYQDYCFN 584

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 12/58 (20%)

Query: 114 MLSGAGMISAMDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYN--NWTSVQA 169
           ML+G+G I+ M+            GLL    Y++GLSGG+W++ +L  +  N+ S+Q 
Sbjct: 1   MLTGSGFITKMEEY----------GLLDCLAYISGLSGGSWILTSLILHDFNFKSLQK 48

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  171 bits (434), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 154/585 (26%), Positives = 239/585 (40%), Gaps = 134/585 (22%)

Query: 100 PKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGL-------GGLLQSSTYLAGLSGG 152
           PK+ IA SGGGYR+ML G G IS M       ND+GL        GL   S  L  L   
Sbjct: 82  PKIGIAISGGGYRSMLVGTGFISQM-------NDYGLFEYSDYIAGLSGGSWILMDLVVQ 134

Query: 153 NWLVGTL------------------------------AYNN------------------- 163
           N+ V +L                               YN+                   
Sbjct: 135 NFEVKSLLQEWDLEEDLLLGIPEFDISEEEIVTNAKKEYNDNDLKMKKRQGGSLITSSSN 194

Query: 164 -WTSVQAIINNMTDDNSIWDISNSIVNP------------------GGINIFSSI-SRWD 203
            +  ++ I+N++ +    + I+   +NP                    I  F  +   + 
Sbjct: 195 FYEQIEEIMNSIEEIPEDYMITKRNLNPLARLKKIFFPNNTFTGTDAKIETFKKVLDFYK 254

Query: 204 DISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEG-GVGYTWNTL-RDVDVFKNGEMP 261
            +   ++ KK  GF  S TD WG+A+      + D+     ++++ L      FK   +P
Sbjct: 255 SLHLKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKLVNSSKKFKECSVP 314

Query: 262 FPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXXXXXXXK 321
            PI VA       +   L+  +FEF PFE GSW+  L  F  + Y              K
Sbjct: 315 IPIFVA-----NCKNGLLSNVIFEFTPFEFGSWENILRLFVKLPYLGSKIVSGKAE---K 366

Query: 322 CVAGFDNTGFVMGXXXX------------XXXXXXXXXXXXDLPSFLYNL----LHGFLT 365
           C+  FD+ GF+                              ++   ++ L    +     
Sbjct: 367 CINNFDDLGFITATSSSIFNNVLIFIWNLASQSSREAMKALNMVMGIFGLGKEEIFSISK 426

Query: 366 DASDDYDDISIWAPNPFY---EITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQT 422
           D+S    D +++ PNPFY   E  N+ +N        + LYLVDGGEDG+NIPL  L+  
Sbjct: 427 DSSRLETDYAVYQPNPFYLYPEKDNVLTN-------KNHLYLVDGGEDGENIPLRTLVIP 479

Query: 423 EREIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTR 482
           ERE+DVIF LD+S+D D ++P+G  L + + +   L  + + + +  +V TFT+      
Sbjct: 480 ERELDVIFVLDSSSDID-NYPNGSKLKRIFEK---LDEENVHYQFPNNVKTFTH------ 529

Query: 483 PTFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTM 542
           P   GC+A   T  +S  P+++Y  N      SNTSTFK++Y+ SE   M+  G    + 
Sbjct: 530 PIVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQSEVSSMLPTGRGVFSN 589

Query: 543 KNLTKDENFMGCISCAILRRKQESL--NYTLPSECDACFEKYCWN 585
                D  +  C+ C + +R  + L         C  CF+ YC++
Sbjct: 590 ---DYDLYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCFKDYCYS 631

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  165 bits (418), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 130/425 (30%), Positives = 195/425 (45%), Gaps = 59/425 (13%)

Query: 199 ISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNG 258
           I  + ++   V +KK+AGF  S+TD  G+AL  +  P+  +  +    N ++  + FK  
Sbjct: 277 IGFYINLHRQVRQKKEAGFPISLTDYLGQAL-LDRLPAQKQDHLKQLSNFVQS-ESFKKF 334

Query: 259 EMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXXXXX 318
           + P P+ VA  +   ++   L+  VFEF PFE GSW   +  F   +Y            
Sbjct: 335 DAPIPVFVANAK--TSKGPELHNVVFEFTPFEFGSWHLNVSKFISTKYLGSTALKGKLT- 391

Query: 319 XXKCVAGFDNTGFVMGXXXXXX--------XXXXXXXXXXDLPSFLYNLLHGFLTDASDD 370
             KCV GFDN GF+                          +    +  +   F    +  
Sbjct: 392 --KCVNGFDNLGFITATSSSLFNNALFYIWKTVTTNIESNEKLKAIKTIFGVFGVGFNAI 449

Query: 371 YDDISIWAPNPFY---EITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREID 427
             D +I+ PNPFY   E+ N+ S+ SQ       L+LVDGGEDG+NIPL  L  + R+ D
Sbjct: 450 RSDYAIYQPNPFYKDPEVLNLISDTSQ-------LFLVDGGEDGENIPLRSLFISGRQND 502

Query: 428 VIFALDNSADTDQSWPDGFSLTQTYARQFGL--QGKGIAF----------PYVPDVNTF- 474
           VIF +D+S+D  ++ PD   L  TY     +  Q + +A           PY+P      
Sbjct: 503 VIFIVDSSSDK-ENLPDMTKLRDTYDDIIHVEEQKRIVALKNEIWEMDLMPYIPTSEELL 561

Query: 475 -TNLGLNTRPTFFGC-----DARNLTDL--------ESIPPLVVYMPNTRESFNSNTSTF 520
             N  L+T P  FGC     + + LTD          S+PP+++Y  N   +F SNTSTF
Sbjct: 562 AANFSLST-PIAFGCHLQSYNTKRLTDTLITKETSSASLPPILIYHGNIPITFQSNTSTF 620

Query: 521 KMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILRRKQESLNYTLPSECDACFE 580
           K++Y+  E   M+ NG       N      ++ C+ C +L R+ + L   + S CDAC  
Sbjct: 621 KLNYTKDEYNGMLNNGHH--LFNNDDTQGEYLQCLGCVMLLRQNQEL---VSSFCDACIR 675

Query: 581 KYCWN 585
           K C+N
Sbjct: 676 KVCYN 680

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (50%), Gaps = 28/134 (20%)

Query: 32  YAPGVVDCDENINL-VRKADAVSDDEADWLKVRHESTVPALKDFLQRGFKGFTNDTSI-- 88
           YAP  VDC ++++L   K + +S  E D+L  R E         ++  F+ F  D +I  
Sbjct: 21  YAPVNVDCPKDLSLRAAKNEKLSALEFDYLSKRTE--------VIKGKFEKFYEDLAIPG 72

Query: 89  --IDKLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQSSTYL 146
             +D L       P++A+A SGGG+R+ML  +G +  M             GL + ++Y+
Sbjct: 73  INVDSL-----QFPRIAVAISGGGFRSMLISSGFVLGMQQH----------GLWECTSYV 117

Query: 147 AGLSGGNWLVGTLA 160
           AG+SGG+W +  L 
Sbjct: 118 AGISGGSWTLLKLV 131

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  158 bits (400), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 136/527 (25%), Positives = 224/527 (42%), Gaps = 110/527 (20%)

Query: 138 GLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAI-------------------------IN 172
           GL   S Y+AG+SGG+W V  L  N +   + I                         I+
Sbjct: 15  GLYHYSDYIAGISGGSWSVMDLVVNKFQLGKLISGWDLSTSMLPGMPDVDIGDDDTDFIS 74

Query: 173 NM-----------TDDNSIWDISNSIVNP--------------GGINIFSSISRWD---- 203
           +M           T   S++   N + +P                 N+F  +S++     
Sbjct: 75  DMHLDHLLQPNIATQKRSLFKRDNVVPSPLLKIKQILFPNNTLASENLFEKLSKFKNALQ 134

Query: 204 ---DISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEM 260
              D+   +  K+  GF  S TD W +AL  N         + Y+  ++R  + FKN  +
Sbjct: 135 FYIDLHLHIRSKRINGFPISFTDYWAQALVQNIKYRQLPTHLTYS-KSVRTSNYFKNYLV 193

Query: 261 PFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXXXXXXX 320
           P PI VA  R        L   +FEF P+E GSW+  L  F ++ Y              
Sbjct: 194 PIPIIVANCRNGF-----LKNVIFEFTPWEFGSWEQVLGLFVNIEY---LGSRIINGVSH 245

Query: 321 KCVAGFDNTGFVMGXXXXXXXXXX------XXXXXXDLPSFLYNLLHGF----------- 363
           +C  G D+ GF+                        D  + +  +L  F           
Sbjct: 246 QCYKGLDDLGFIAATSSSIFNNALIYVWKLASKSSKDAIAAVKTVLAVFGLGTTKFESAL 305

Query: 364 -----LTDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTP 418
                +T A D   D +++  NPFY+ +NI       ++++D LYLVDGGEDG+NIP+  
Sbjct: 306 QTSSQITAALDT--DYAVYRHNPFYKYSNI----KNELAQNDYLYLVDGGEDGENIPIRT 359

Query: 419 LLQTEREIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLG 478
           L+   R +D+I  +D+S+D  +++ +G  L     +    + +GI + Y   + T     
Sbjct: 360 LV--PRNVDMIMIMDSSSD-KKNYANGDKLKIVLNQM--KEKEGIYYRYPTKIVTS---- 410

Query: 479 LNTRPTFFGCDARNLTDLESIPPLVVYMPNTRESFN--SNTSTFKMSYSTSERFKMIQNG 536
              RPT  GC     +D + + P++VY PN+  S    +NTSTFKM Y++ E+  +I +G
Sbjct: 411 -QKRPTIIGCKPPRTSDTK-LAPILVYYPNSERSSTQVTNTSTFKMIYTSEEQQLLIDHG 468

Query: 537 FEAVTMKNLTKDENFMGCISCAILRRKQESLNYTLPSECDACFEKYC 583
           +  VT      + ++  C++C +++R  +  +   P +C  C+ KYC
Sbjct: 469 YTLVTGHG---EHDYQKCMACILVKRSYDQASIIPPKQCSICYSKYC 512

>Scas_695.10
          Length = 553

 Score =  138 bits (348), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 119/400 (29%), Positives = 176/400 (44%), Gaps = 62/400 (15%)

Query: 202 WDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGY----TWNTLRDVDV-FK 256
           + D+   V  KK  GF  S TD WG AL      + D+    +    +++ L + ++ F 
Sbjct: 177 YIDLHLRVRTKKIQGFFVSFTDYWGEAL-LKRLNNKDKKFSAFANTVSFSKLIESNLKFS 235

Query: 257 NGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAXXXXXXXXX 316
             E P PI VA  R        L   +FEF+PFE GSW+  L  F  + Y          
Sbjct: 236 KFEAPIPIFVANNRNG-----RLKNVIFEFSPFEFGSWEKMLRLFVKLPYLGSKIVNGTA 290

Query: 317 XXXXKCVAGFDNTGFVMGXXXXXXXXXXXXXXXXDLPSFLYNL--------LHGFL---- 364
                C   FD+ GF+                     S L  +        L G +    
Sbjct: 291 KI---CYKEFDDIGFITATSSSIFNNVLIFIWQKMSRSSLEAMKSVKAVMGLFGLIGTKD 347

Query: 365 --------TDASDDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPL 416
                     A     D +++  NPF+   NI      ++++DD LYLVDGGEDG+NIPL
Sbjct: 348 STKPLTLSNTAIAPETDYAVYYHNPFFRYPNI----DNALTKDDHLYLVDGGEDGENIPL 403

Query: 417 TPLLQTEREIDVIFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTN 476
             L+  ER++DVIFA+D+S+D + ++ +G  L  T  R     G     P +        
Sbjct: 404 RSLIIPERKVDVIFAIDSSSDVN-NYANGTKLI-TILRHLEKLGYHYKIPKISKKRI--- 458

Query: 477 LGLNTRPTFFGCDARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNG 536
                 P  FGC+A +L       P+++Y  NT  S+ SNTSTFK++Y+ +E   M+QNG
Sbjct: 459 ----NHPLIFGCNAPSL-------PIIIYHANTEHSYPSNTSTFKVTYNETEVGAMLQNG 507

Query: 537 FEAVTMKNLTKDEN--FMGCISCAILRRKQESLNYTLPSE 574
                M     +EN  +  C+ C IL ++    N+ L S+
Sbjct: 508 -----MDIFNDNENIYYQNCLGC-ILSKRTLDRNFKLHSQ 541

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 81/169 (47%), Gaps = 38/169 (22%)

Query: 100 PKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTL 159
           P + +A SGGGYR+ML+G G I  M  +          GL    +YL+GLSGG+W++  L
Sbjct: 9   PNIGVALSGGGYRSMLTGTGFILGMQEK----------GLWDCVSYLSGLSGGSWVLMDL 58

Query: 160 AYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISRWDDISDAVEE-----KKK 214
             NN+ ++  +INN       WD++  ++   GI  F  I++ D +S   E+     K++
Sbjct: 59  IVNNF-NITKMINN-------WDLTEGLLQ--GIPDF-DITQQDLVSGMEEQFPYLKKRQ 107

Query: 215 AGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNG-EMPF 262
              NT   + +    +    P           + LR  ++FK G E PF
Sbjct: 108 ELINTDFENFFNEVETSLSLP-----------DCLRKDELFKRGIENPF 145

>KLLA0A01760g 154859..156610 gi|2497468|sp|P56095|AP1_KLULA
           Kluyveromyces lactis AP-1-like transcription factor,
           start by similarity
          Length = 583

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 160 AYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISRW 202
           A NN  SV A+ N  + D    D S+S   P G++  SS+S W
Sbjct: 331 ALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAW 373

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,920,674
Number of extensions: 932178
Number of successful extensions: 2295
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2265
Number of HSP's successfully gapped: 36
Length of query: 630
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 522
Effective length of database: 12,857,365
Effective search space: 6711544530
Effective search space used: 6711544530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)