Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C05896g1581567261e-100
Scas_248.1d1541474941e-64
ACL018W1341274347e-56
Kwal_56.225201571274142e-52
Kwal_47.1843116053612.0
Scas_719.84154469632.2
KLLA0E02200g83593604.9
KLLA0D05291g28842596.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05896g
         (156 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05896g 522074..522550 weakly similar to ca|CA3383|IPF8359 ...   284   e-100
Scas_248.1d                                                           194   1e-64
ACL018W [1031] [Homologous to NOHBY] complement(329990..330394) ...   171   7e-56
Kwal_56.22520                                                         164   2e-52
Kwal_47.18431                                                          28   2.0  
Scas_719.84                                                            29   2.2  
KLLA0E02200g complement(205466..207973) weakly similar to sp|P33...    28   4.9  
KLLA0D05291g 457872..458738 similar to sgd|S0004054 Saccharomyce...    27   6.3  

>KLLA0C05896g 522074..522550 weakly similar to ca|CA3383|IPF8359
           Candida albicans unknown function, start by similarity
          Length = 158

 Score =  284 bits (726), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 144/156 (92%)

Query: 1   MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQKMHVADVVLRSKLTPTK 60
           MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQKMHVADVVLRSKLTPTK
Sbjct: 1   MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQKMHVADVVLRSKLTPTK 60

Query: 61  FSKTIRPLNDTKAVENGATLLSEXXXXXXXXXXXXWETLRQRQKELDRREQVTQDIAFLQ 120
           FSKTIRPLNDTKAVENGATLLSE            WETLRQRQKELDRREQVTQDIAFLQ
Sbjct: 61  FSKTIRPLNDTKAVENGATLLSEGFVFGVTGSVVVWETLRQRQKELDRREQVTQDIAFLQ 120

Query: 121 SEIEELRSTTKTQSDQIKSCQSLKEELKLIQSKLSS 156
           SEIEELRSTTKTQSDQIKSCQSLKEELKLIQSKLSS
Sbjct: 121 SEIEELRSTTKTQSDQIKSCQSLKEELKLIQSKLSS 156

>Scas_248.1d
          Length = 154

 Score =  194 bits (494), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 116/147 (78%)

Query: 1   MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQKMHVADVVLRSKLTPTK 60
           MSAIA+KLGAL++RQVTRP+ANVLK QAK+H  FK ICI LAQ+MH ADV+LRS+LTP+ 
Sbjct: 1   MSAIAVKLGALVIRQVTRPVANVLKAQAKQHDSFKRICISLAQRMHRADVILRSRLTPSN 60

Query: 61  FSKTIRPLNDTKAVENGATLLSEXXXXXXXXXXXXWETLRQRQKELDRREQVTQDIAFLQ 120
           FSK IRPLN+ KAVENGATL SE            WETLRQR KEL+RREQV+QDI+FLQ
Sbjct: 61  FSKKIRPLNEEKAVENGATLFSEMFVFGVTGSVVVWETLRQRTKELNRREQVSQDISFLQ 120

Query: 121 SEIEELRSTTKTQSDQIKSCQSLKEEL 147
           SEIEELRS  + Q++ +K+    K++L
Sbjct: 121 SEIEELRSLMEIQNEILKNLTRDKQQL 147

>ACL018W [1031] [Homologous to NOHBY] complement(329990..330394)
           [405 bp, 134 aa]
          Length = 134

 Score =  171 bits (434), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 99/127 (77%)

Query: 1   MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQKMHVADVVLRSKLTPTK 60
           MSA+A KLGALL+RQVTRP+ANVLK+QAK+H+ FK++CI LAQ+MH ADV LRS+LTP  
Sbjct: 1   MSALAFKLGALLIRQVTRPVANVLKQQAKQHSAFKQVCIRLAQQMHRADVKLRSRLTPVA 60

Query: 61  FSKTIRPLNDTKAVENGATLLSEXXXXXXXXXXXXWETLRQRQKELDRREQVTQDIAFLQ 120
             K IRPLND +AVENGATLLSE            WET+RQR KELDRREQV QDI  LQ
Sbjct: 61  QPKKIRPLNDERAVENGATLLSELFVFGVTGTVVVWETVRQRNKELDRREQVLQDIKELQ 120

Query: 121 SEIEELR 127
            EI+EL+
Sbjct: 121 EEIDELK 127

>Kwal_56.22520
          Length = 157

 Score =  164 bits (414), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 94/127 (74%)

Query: 1   MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQKMHVADVVLRSKLTPTK 60
           MSA+A+KLG LL+RQVTRP+ANVLK QAK+H  FK IC+G+AQKMH  D  LR++LTP  
Sbjct: 1   MSALAVKLGTLLIRQVTRPVANVLKAQAKQHDKFKRICVGVAQKMHRVDAKLRTRLTPGN 60

Query: 61  FSKTIRPLNDTKAVENGATLLSEXXXXXXXXXXXXWETLRQRQKELDRREQVTQDIAFLQ 120
               +RPLND +AVENGAT LSE            WET+RQR KE++RREQV  DI+FLQ
Sbjct: 61  QEIKVRPLNDARAVENGATWLSEAFVFGVTGSVVVWETVRQRAKEINRREQVASDISFLQ 120

Query: 121 SEIEELR 127
           SEIE LR
Sbjct: 121 SEIEYLR 127

>Kwal_47.18431
          Length = 160

 Score = 28.1 bits (61), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 6/53 (11%)

Query: 104 KELDRREQVTQDIAFLQSEIEELRSTTKTQSDQIKSCQSLKEELKLIQSKLSS 156
           +EL+RR+Q TQ     +   E++R  TK Q DQ    QSL+EEL+ +QSK  S
Sbjct: 112 QELERRDQETQ---LRKQRAEQVRLKTK-QLDQ--ETQSLQEELRNLQSKTGS 158

>Scas_719.84
          Length = 1544

 Score = 28.9 bits (63), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 50   VVLRSKLTPTKFSKTIRPLNDTKAVENGATLLSEXXXXXXXXXXXXWETLRQRQKELDRR 109
            VVL S ++PT FS      N+T + E     +              W+T +++Q + +R+
Sbjct: 1036 VVLPSDISPTAFSAISSGRNETLSPEE--IRVEGLRRLIASITKFRWKTEKEKQAQRNRK 1093

Query: 110  EQVTQDIAF 118
            +++  ++ F
Sbjct: 1094 DEIQPEVMF 1102

>KLLA0E02200g complement(205466..207973) weakly similar to sp|P33301
           Saccharomyces cerevisiae YDR369c XRS2 DNA repair protein
           singleton, start by similarity
          Length = 835

 Score = 27.7 bits (60), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 44  KMHVADVVLRSKLTPTKFSKTIRPLNDTKAVENGATLLSEXXXXXXXXXXXXWETLRQRQ 103
           K   +D+++ +K   TKF++ I PL++T  V N  T+++             +E  +   
Sbjct: 54  KFDGSDLIITNKGKLTKFNEEIIPLDETIVVHNQNTVINIGGMPIDVNVRYFYEEWKIPH 113

Query: 104 K-ELDRREQVTQDIAFLQSEIEELRSTTKTQSD 135
           + EL+  + +  D     SE    ++TT+  SD
Sbjct: 114 RLELNETKSLVSDFGVKLSESFSKKTTTQICSD 146

>KLLA0D05291g 457872..458738 similar to sgd|S0004054 Saccharomyces
           cerevisiae YLR064w, start by similarity
          Length = 288

 Score = 27.3 bits (59), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/42 (26%), Positives = 22/42 (52%)

Query: 96  WETLRQRQKELDRREQVTQDIAFLQSEIEELRSTTKTQSDQI 137
           W  L+Q+ ++LD  +  T  I  L   +   ++ T+T+S  +
Sbjct: 103 WSNLKQQIRQLDNLQYFTLSIVLLICSLSGGKTLTQTESSMV 144

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.126    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,722,935
Number of extensions: 121494
Number of successful extensions: 746
Number of sequences better than 10.0: 54
Number of HSP's gapped: 744
Number of HSP's successfully gapped: 57
Length of query: 156
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 63
Effective length of database: 13,376,635
Effective search space: 842728005
Effective search space used: 842728005
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)