Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C05852g48247522560.0
ACL020W5394287153e-88
Kwal_56.225274813156642e-81
CAGL0J11792g5103646159e-74
YML043C (RRN11)5074755652e-66
Scas_611.0d153891229e-08
Scas_692.26841131674.3
CAGL0E03828g189684658.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05852g
         (475 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05852g 518508..519956 weakly similar to sp|Q04712 Saccharo...   873   0.0  
ACL020W [1029] [Homologous to ScYML043C (RRN11) - NSH] complemen...   280   3e-88
Kwal_56.22527                                                         260   2e-81
CAGL0J11792g complement(1148628..1150160) similar to sp|Q04712 S...   241   9e-74
YML043C (RRN11) [3925] chr13 complement(190244..191767) Componen...   222   2e-66
Scas_611.0d                                                            52   9e-08
Scas_692.26                                                            30   4.3  
CAGL0E03828g complement(357315..363005) similar to sp|P38737 Sac...    30   8.0  

>KLLA0C05852g 518508..519956 weakly similar to sp|Q04712
           Saccharomyces cerevisiae YML043c RRN11 RNA polymerase I
           specific transcription initiation factor singleton,
           start by similarity
          Length = 482

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/475 (89%), Positives = 427/475 (89%)

Query: 1   MFQLPVIDXXXXXXXXXXXXXXXXXSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENX 60
           MFQLPVID                 SLKRKYDQLNYNQSEASVSSEADNVTNGILTPEN 
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 61  XXXXXXXXDLEKKHRRKRRLQSVLGNAXXXXXXXXXXXXXXXXXXXXXXQFYESHIKPQH 120
                   DLEKKHRRKRRLQSVLGNA                      QFYESHIKPQH
Sbjct: 61  ESSEAEAADLEKKHRRKRRLQSVLGNALDSSDEELDGDEDGTDENDPETQFYESHIKPQH 120

Query: 121 TFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDV 180
           TFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDV
Sbjct: 121 TFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDV 180

Query: 181 YPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILN 240
           YPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILN
Sbjct: 181 YPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILN 240

Query: 241 SLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTFVLTWLWTRLFIA 300
           SLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTFVLTWLWTRLFIA
Sbjct: 241 SLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTPTFVLTWLWTRLFIA 300

Query: 301 TSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDI 360
           TSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDI
Sbjct: 301 TSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDI 360

Query: 361 LLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYTDELSVNC 420
           LLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYTDELSVNC
Sbjct: 361 LLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYTDELSVNC 420

Query: 421 TDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPEVESAEFTVPAPI 475
           TDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPEVESAEFTVPAPI
Sbjct: 421 TDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPEVESAEFTVPAPI 475

>ACL020W [1029] [Homologous to ScYML043C (RRN11) - NSH]
           complement(326268..327887) [1620 bp, 539 aa]
          Length = 539

 Score =  280 bits (715), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 242/428 (56%), Gaps = 20/428 (4%)

Query: 1   MFQLPVIDXXXXXXXXXXXXXXXXXSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENX 60
           MF+ P++                   ++RKY+QLN   S++   +  D+      TP+N 
Sbjct: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLN-GLSDSDKQAHIDSAC--FPTPDNS 102

Query: 61  XXXXXXXXDLE--------KKHRRKRRLQSVLGNAXXXXXXXXXXXXXX------XXXXX 106
                    LE        +  R++ RLQS+LG+A                         
Sbjct: 103 AAEASDGDALEGDVDTAARRLKRKRLRLQSILGHATLDAEEGDLGSEEEDDLNGGSTAKD 162

Query: 107 XXXQFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKK 166
              QF+  + KP++T+E+W  +   R PI+RK ++Y A K++E  + + +   L+  TKK
Sbjct: 163 YEKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKK 222

Query: 167 LNMYFQALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226
              Y + ++ G++  PK +++  + +HL HL  LLY+N++++NW  AYRCF++LIR++ V
Sbjct: 223 AAAYHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSV 282

Query: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTP 286
           D+RS+W++GS IL+ L +   +E +LEW+  VF S   F+Q     +DPVFR GSR HTP
Sbjct: 283 DLRSIWNLGSHILSHL-NFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHTP 341

Query: 287 TFVLTWLWTRLFIATSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVM 346
            F+L WLW  L  AT+    +D  + +  L++++ E+VL PPYMDD+EIW+++ + + + 
Sbjct: 342 NFMLAWLWLVLRGATA-DEVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYFIQ 400

Query: 347 ASELSSKFRQSKDILL-GSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLV 405
           A +LS++    + I L GS+ DIA+ QV Q+I + KNCL+ C+   N+ +PE +I+ QL+
Sbjct: 401 ADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERIIQEQLL 460

Query: 406 QLERSLYT 413
           + ER LY 
Sbjct: 461 EFERRLYA 468

>Kwal_56.22527
          Length = 481

 Score =  260 bits (664), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 129/315 (40%), Positives = 183/315 (58%), Gaps = 14/315 (4%)

Query: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169
           +F+  H KPQ T+E WN +      +    ++Y   K +E  A + V +++ + ++    
Sbjct: 109 EFFSHHEKPQDTYETWNTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIARS 168

Query: 170 YFQALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVR 229
           +F ++K G+++Y +P    Q T H+ HLN+LL+ NV+   WE A+RCFSILIRL  VD+R
Sbjct: 169 HFNSIKRGYEIYSRPSQVHQ-TTHITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIR 227

Query: 230 SLWSIGSEILNSLGDTQSNEA----YLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHT 285
           S+W +G  IL  L  T  N A    +L WL+ ++ SR  FN   N+ +DPVFR GS+ HT
Sbjct: 228 SMWGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPVFRTGSKKHT 287

Query: 286 PTFVLTWLWTRLFIAT-------SGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYI 338
             FV  WLW  LF A           +     K +Q L+++L EMVL PPYM+D EIW+I
Sbjct: 288 AKFVSAWLWEMLFAACPDKLEERQADNGSGNRKLIQ-LLEKLSEMVLIPPYMEDPEIWFI 346

Query: 339 FGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANS-NYEFPE 397
           + L HLV A ELS +F  +         DI+RNQV QHI NA NC++ C+A   ++ FP 
Sbjct: 347 YALCHLVSADELSQRFTFTYSESTELERDISRNQVTQHITNAHNCIRTCEAKGDDFFFPR 406

Query: 398 NVIEHQLVQLERSLY 412
            +IE QL   ER LY
Sbjct: 407 RIIEEQLAFFERRLY 421

>CAGL0J11792g complement(1148628..1150160) similar to sp|Q04712
           Saccharomyces cerevisiae YML043c RRN11 RNA polymerase I
           specific transcription initiation factor, hypothetical
           start
          Length = 510

 Score =  241 bits (615), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 203/364 (55%), Gaps = 36/364 (9%)

Query: 111 FYESHIKPQHTFEVW----NVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKK 166
           FY  + KP+H+FEVW    +VNT  +  +++  I Y  + ++E+ A K V K + +    
Sbjct: 112 FYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLV 171

Query: 167 LNMYFQALKFGFDVY-PKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLED 225
              YF     G++V  P   +      H+  L Q+L+++V   NW+IAYR FS+LIR+ +
Sbjct: 172 NKRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPE 231

Query: 226 VDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHT 285
           VD+R++W +G+ IL   G T  +  +L+W++ V+ S+  F Q   +   PVFR GSRTHT
Sbjct: 232 VDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHT 291

Query: 286 PTFVLTWLWTRLFIAT---------------------SGSSAVDKEKFLQSLIDRLDEMV 324
           P + LTWLW  L   T                     S  SA+DK   L  LID++ EMV
Sbjct: 292 PKYALTWLWNCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDK---LTELIDKISEMV 348

Query: 325 LSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCL 384
           L PPY+DD EIW+I+ + H+V A  LS KF   +  L GSR DIARNQV QHI+  K  L
Sbjct: 349 LVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQR--LSGSRRDIARNQVTQHIHYVKTYL 406

Query: 385 QMCKANSNYEFPENVIEHQLVQLERSLYTDE-----LSVNCTDESAKSSDEDGIEHSYPN 439
           Q C    N+E+P+  I+ +L + E+ +Y DE     + +  + ++   S+ED  E+ +  
Sbjct: 407 QNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQI 466

Query: 440 EDSN 443
           ++SN
Sbjct: 467 DESN 470

>YML043C (RRN11) [3925] chr13 complement(190244..191767) Component
           of RNA polymerase I core transcription factor (CF) along
           with Rrn6p and Rrn7p [1524 bp, 507 aa]
          Length = 507

 Score =  222 bits (565), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 143/475 (30%), Positives = 234/475 (49%), Gaps = 51/475 (10%)

Query: 28  KRKYDQLNYNQSEASVSSEADNVTNGILTPENXXXXXXXXXD--------------LEKK 73
           K KY  +NY        S+    T+ + TPEN         +               +KK
Sbjct: 18  KLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEGQNSEAGTYRRSVLQQKK 77

Query: 74  HRRKRRLQSVLGNAXXXXXXXXXXXXXX------------XXXXXXXXQFYESHIKPQHT 121
            RR+R  +SV+G                                    +F++ + KP+ +
Sbjct: 78  RRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKEDSDEERKFWKKYEKPEKS 137

Query: 122 FEVW-NVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFGFDV 180
           FE+W  V++  + PI ++K+TY+  KK+EK   + +   L + TK+  +YFQ++  G + 
Sbjct: 138 FEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEP 197

Query: 181 Y--PKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEI 238
                 ++   +T H+  L  LL+ NV   NW +AY+ F+ LIR+  V ++SLW IG EI
Sbjct: 198 LKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEI 257

Query: 239 LNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNY-SLDPVFRCGSRTHTPTFVLTWLWTRL 297
           L++L ++ S   +L+W+  ++ S+ +F Q  NY S+ P F+ GSRTHT  F +T+LW+ L
Sbjct: 258 LDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSL 317

Query: 298 FIATS----GSSAVDK-----EKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMAS 348
                     S+ +DK        LQ LID++ E VL+PP+M+D+E+W+I+   HL+ A 
Sbjct: 318 INCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKAD 377

Query: 349 ELSSKF--RQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQ 406
            LS +F      + L+G   DI  NQVI+HI+  +  L++C     +  P  +IE+QL  
Sbjct: 378 TLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKS 437

Query: 407 LERSLYTDELSVNCTDESA--KSSDEDGIEHSYPNE--------DSNLPDVGPLD 451
            E  LY +   +   D +    S D   +E+S+ +         D+ L D+ P D
Sbjct: 438 FESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVYETNAEFLDTQLMDLSPED 492

>Scas_611.0d
          Length = 153

 Score = 51.6 bits (122), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 46/89 (51%), Gaps = 7/89 (7%)

Query: 343 HLVMASELSSKFR--QSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVI 400
           H+V A +LS  F   QS     GS  DIARN+VIQ+I   K  LQ   +  ++E+PE  I
Sbjct: 1   HMVKADQLSLNFNLNQSN----GSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFI 56

Query: 401 EHQLVQLERSLYTDELSVNCTDESAKSSD 429
             QL   E  LY+ +   N  D+    SD
Sbjct: 57  TRQLNTFEERLYSKD-ETNSKDKDNNESD 84

>Scas_692.26
          Length = 841

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 55/131 (41%), Gaps = 18/131 (13%)

Query: 307 VDKEKFLQSLIDRLDEMVLSPPYMDDS--------EIWYIF----GLTHLVMASELSSKF 354
           V  EK    L++ L  M LSP  +DD         +++ +      +  L++   L  KF
Sbjct: 603 VKDEKPAPGLLNMLINMFLSPGTIDDELYPHQAKVQVFLLLMALACIPWLLLVKPLHFKF 662

Query: 355 RQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYTD 414
            Q K I L +  DI    ++   N     ++   +  + E   +++ HQ++      +T 
Sbjct: 663 TQKKHIALPTSDDIETQALLHDGNEDNEEVEGESSGGHGEDFSDIMIHQVI------HTI 716

Query: 415 ELSVNCTDESA 425
           E  +NC   +A
Sbjct: 717 EFCLNCVSHTA 727

>CAGL0E03828g complement(357315..363005) similar to sp|P38737
            Saccharomyces cerevisiae YHL030w ECM29 involved in cell
            wall biogenesis and architecture, start by similarity
          Length = 1896

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 3/84 (3%)

Query: 182  PKPQLSKQKTMHLAHLNQLLYTN--VLNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEIL 239
            P P L K  TM L  L Q   ++  ++ +  EI +RCF   +  +D  V+   + G  ++
Sbjct: 994  PNPTLKKAGTMWLLSLVQFTSSSPVIIEKCAEI-HRCFVSALIHKDEIVQESAARGLALV 1052

Query: 240  NSLGDTQSNEAYLEWLAHVFPSRV 263
              LG T   E  ++ L   F S V
Sbjct: 1053 YELGSTDVKEDMIKGLFKSFTSNV 1076

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,344,361
Number of extensions: 583726
Number of successful extensions: 2063
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2079
Number of HSP's successfully gapped: 25
Length of query: 475
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 370
Effective length of database: 12,961,219
Effective search space: 4795651030
Effective search space used: 4795651030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)