Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C05764g1173115559110.0
Kwal_14.18031174115452800.0
Sklu_1458.11132111452060.0
YBR218C (PYC2)1180115552050.0
AAR162C1171115552000.0
YGL062W (PYC1)1178115351880.0
Scas_686.171176115151860.0
CAGL0F06941g1180115351840.0
CAGL0K06787g1175115451570.0
Scas_563.121216116051020.0
CAGL0M05533g18344717324e-79
Scas_721.4018344787121e-76
KLLA0E08107g18294596942e-74
YBR208C (DUR1,2)18354596924e-74
Sklu_2124.118304606881e-73
Kwal_27.1195118694776702e-71
ADR051C18194726552e-69
Scas_720.7422315275035e-51
CAGL0L10780g22335434991e-50
KLLA0F06072g22315664874e-49
AAR071W22315774864e-49
YMR207C (HFA1)21234614775e-48
Kwal_23.615722305384767e-48
YNR016C (ACC1)22335184741e-47
ABR157W11132141153e-05
Kwal_33.1406122212591127e-05
CAGL0L05676g22112361091e-04
YJL130C (URA2)22142311082e-04
Sklu_2331.122202361082e-04
ACR263C22402321045e-04
Scas_582.4*21931771010.001
Kwal_55.197831121213910.019
KLLA0E15444g2228165890.027
Sklu_2413.41122213870.050
KLLA0F03190g1117217860.062
CAGL0C04917g1113156810.26
YJR109C (CPA2)1118217800.29
Scas_691.191117209800.31
Kwal_27.12090394218760.79
KLLA0E23782g39394760.81
Scas_701.3543070751.0
ADR107W442247741.5
KLLA0F05489g44174731.7
CAGL0J09240g437278712.9
YLR432W (IMD3)523131713.4
YDL131W (LYS21)44074713.6
Scas_704.343874703.8
CAGL0J06402g43174704.2
YDL182W (LYS20)42874704.2
Sklu_2431.239494704.4
ADR027W40847704.4
Kwal_56.2440144174688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05764g
         (1155 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05764g complement(512470..515991) highly similar to sp|P32...  2281   0.0  
Kwal_14.1803                                                         2038   0.0  
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement        2009   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...  2009   0.0  
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...  2007   0.0  
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...  2003   0.0  
Scas_686.17                                                          2002   0.0  
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...  2001   0.0  
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...  1991   0.0  
Scas_563.12                                                          1969   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...   286   4e-79
Scas_721.40                                                           278   1e-76
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...   271   2e-74
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...   271   4e-74
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement          269   1e-73
Kwal_27.11951                                                         262   2e-71
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...   256   2e-69
Scas_720.74                                                           198   5e-51
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   196   1e-50
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   192   4e-49
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   191   4e-49
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   188   5e-48
Kwal_23.6157                                                          187   7e-48
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   187   1e-47
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    49   3e-05
Kwal_33.14061                                                          48   7e-05
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    47   1e-04
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    46   2e-04
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            46   2e-04
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    45   5e-04
Scas_582.4*                                                            44   0.001
Kwal_55.19783                                                          40   0.019
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    39   0.027
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          38   0.050
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    38   0.062
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    36   0.26 
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    35   0.29 
Scas_691.19                                                            35   0.31 
Kwal_27.12090                                                          34   0.79 
KLLA0E23782g complement(2105401..2106582) highly similar to sp|Q...    34   0.81 
Scas_701.35                                                            33   1.0  
ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W ...    33   1.5  
KLLA0F05489g 541146..542471 highly similar to sp|Q12122 Saccharo...    33   1.7  
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    32   2.9  
YLR432W (IMD3) [3807] chr12 (1002553..1004124) Protein highly si...    32   3.4  
YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase...    32   3.6  
Scas_704.3                                                             32   3.8  
CAGL0J06402g complement(608851..610146) highly similar to sp|Q12...    32   4.2  
YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase...    32   4.2  
Sklu_2431.2 YDL131W, Contig c2431 3030-4214                            32   4.4  
ADR027W [1768] [Homologous to ScYPR108W (RPN7) - SH] complement(...    32   4.4  
Kwal_56.24401                                                          31   8.0  

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score = 2281 bits (5911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1111/1155 (96%), Positives = 1111/1155 (96%)

Query: 1    MSSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLK 60
            MSSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLK
Sbjct: 1    MSSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLK 60

Query: 61   ADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGIT 120
            ADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGIT
Sbjct: 61   ADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGIT 120

Query: 121  WVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAF 180
            WVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAF
Sbjct: 121  WVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAF 180

Query: 181  XXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNV 240
                         DDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNV
Sbjct: 181  GGGGRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNV 240

Query: 241  VHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ 300
            VHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ
Sbjct: 241  VHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ 300

Query: 301  NRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCR 360
            NRHYFIEINPRIQVEHTITEEIT               TLEQLGLMQDKITTRGFAIQCR
Sbjct: 301  NRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCR 360

Query: 361  ITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYE 420
            ITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYE
Sbjct: 361  ITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYE 420

Query: 421  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRA 480
            IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRA
Sbjct: 421  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRA 480

Query: 481  QKLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDY 540
            QKLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDY
Sbjct: 481  QKLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDY 540

Query: 541  GPEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWG 600
            GPEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWG
Sbjct: 541  GPEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWG 600

Query: 601  GATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 660
            GATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD
Sbjct: 601  GATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 660

Query: 661  NGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGDMLAPGKKYNLDYYLDITEK 720
            NGVDIFRVFDALNDLEQL                TICYSGDMLAPGKKYNLDYYLDITEK
Sbjct: 661  NGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDITEK 720

Query: 721  IVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALS 780
            IVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALS
Sbjct: 721  IVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALS 780

Query: 781  GADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEA 840
            GADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEA
Sbjct: 781  GADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEA 840

Query: 841  DLKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSK 900
            DLKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSK
Sbjct: 841  DLKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSK 900

Query: 901  VVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKR 960
            VVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKR
Sbjct: 901  VVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKR 960

Query: 961  RKLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSV 1020
            RKLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSV
Sbjct: 961  RKLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSV 1020

Query: 1021 LPTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVAD 1080
            LPTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVAD
Sbjct: 1021 LPTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVAD 1080

Query: 1081 RSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISS 1140
            RSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISS
Sbjct: 1081 RSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISS 1140

Query: 1141 PADGQVKEVLVKDGE 1155
            PADGQVKEVLVKDGE
Sbjct: 1141 PADGQVKEVLVKDGE 1155

>Kwal_14.1803
          Length = 1174

 Score = 2038 bits (5280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 974/1154 (84%), Positives = 1053/1154 (91%), Gaps = 1/1154 (0%)

Query: 3    SQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKAD 62
            S+LAGLRD+SNL+GEKNK+LVANRGEIPIRIFR+AHELSMKTVAIYSHEDRLSMHRLKAD
Sbjct: 2    SKLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKAD 61

Query: 63   EAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWV 122
            EAY+IG+QGKYTPVGAYLAIDEI+ IAK H V+FIHPGYGFLSENSEFA KV  +GITW+
Sbjct: 62   EAYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWI 121

Query: 123  GPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXX 182
            GP A VIDSVGDKVSARNLA KANVPVVPGTPGPI++VEEAQAFV +YG+PVIIKAAF  
Sbjct: 122  GPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGG 181

Query: 183  XXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVH 242
                       DDI+DAFQRA SEA T+FGNGTCFIERFL+KPKHIEVQLLAD YGNVVH
Sbjct: 182  GGRGMRVVREGDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVH 241

Query: 243  LFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNR 302
            LFERDCSVQRRHQKVVEVAPAKTLP++VRDAILTDAVKLA  A Y+NAGTAEFLVD+QNR
Sbjct: 242  LFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNR 301

Query: 303  HYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRIT 362
            HYFIEINPRIQVEHTITEEIT               +L+QLGL+QD+ITTRGFAIQCRIT
Sbjct: 302  HYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRIT 361

Query: 363  TEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIV 422
            TEDP+KNFQPDTGRI+VYRSAGGNGVRLDGGNA+AGS+ISPHYDSMLVKCSCSGSTYEIV
Sbjct: 362  TEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIV 421

Query: 423  RRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQK 482
            RRKMLRALIEFRIRGVKTNIPFLLTLLT+PVF  G YWTTFIDDTP+LF+MVSSQNRAQK
Sbjct: 422  RRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQK 481

Query: 483  LLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDV-SAKPPAGWRDVLLDYG 541
            LLHYLADLAVNGSSIKGQ+GLPKL T PT+P +H+  G+++DV +  PP+GWR VLL+ G
Sbjct: 482  LLHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKG 541

Query: 542  PEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGG 601
            P EFAK VR+ NGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHA+SGAFALECWGG
Sbjct: 542  PAEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGG 601

Query: 602  ATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 661
            ATFDV+MRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+N
Sbjct: 602  ATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKEN 661

Query: 662  GVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGDMLAPGKKYNLDYYLDITEKI 721
            GVDIFRVFDALNDLEQL                TICYSGDML  GKKYNLDYYL+IT+KI
Sbjct: 662  GVDIFRVFDALNDLEQLKVGVDAVKKAKGVVEATICYSGDMLQSGKKYNLDYYLEITDKI 721

Query: 722  VNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSG 781
            V  GTHILGIKDMAGTLKPSAA+LLIGSIRAKYP+LPIHVHTHDSAGT VASMAACA +G
Sbjct: 722  VAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAG 781

Query: 782  ADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEAD 841
            ADVVDVATNSMSGLTSQPSINALLA+LDGEI+ N+NV  VRELDAYWA+MRLLYSCFEAD
Sbjct: 782  ADVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEAD 841

Query: 842  LKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKV 901
            LKGPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW+ETKRAYREAN LLGDLVKVTPTSKV
Sbjct: 842  LKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKV 901

Query: 902  VGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRR 961
            VGDLAQFMVSNKL+SDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLR+DVL+NKRR
Sbjct: 902  VGDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRR 961

Query: 962  KLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVL 1021
            KLT RPGLE+APF+L KIKEDL  RF DI+ECDVASYNMYPKVYEDFRKI+E YGDLSVL
Sbjct: 962  KLTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVL 1021

Query: 1022 PTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADR 1081
            PTKNFLSPP +GEEIVVTIE+GKTLIIKPQAIG+LNKETG+REVYF+LNGELRKV+V D+
Sbjct: 1022 PTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDK 1081

Query: 1082 SQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSP 1141
            SQKV+ +SKPKADAHD +QIG+PMAGV++EVKVH GSL+ +GQPVAVLSAMKMEMVISSP
Sbjct: 1082 SQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSP 1141

Query: 1142 ADGQVKEVLVKDGE 1155
             DGQVKEVLVKDGE
Sbjct: 1142 IDGQVKEVLVKDGE 1155

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score = 2009 bits (5206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 962/1114 (86%), Positives = 1026/1114 (92%)

Query: 42   MKTVAIYSHEDRLSMHRLKADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGY 101
            MKTVAIYS+EDRLSMHRLKADEAY+IGE GKYTPVGAYLAIDEII+IAK HGV+FIHPGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 102  GFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVE 161
            GFLSEN+EFA KV  +GITW+GPP  VI+SVGDKVSAR+LA KANVP VPGTPGPIE+VE
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 162  EAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERF 221
            EA+AFV +YG+PVIIKAAF             DDI DAFQRA SEA TAFGNGTCF+ERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 222  LDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKL 281
            LDKPKHIEVQLLADNYGNV+HLFERDCSVQRRHQKVVEVAPAKTLP+EVRD+ILTDAVKL
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 282  AKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLE 341
            AKEA YRNAGTAEFLVD QNRHYFIEINPRIQVEHTITEEIT               +L+
Sbjct: 241  AKEAKYRNAGTAEFLVDAQNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASLQ 300

Query: 342  QLGLMQDKITTRGFAIQCRITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVI 401
            QLGL+QDKITTRGFAIQCRITTEDPSKNFQPDTGRI+VYRSAGGNGVRLDGGNA+AG+VI
Sbjct: 301  QLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAVI 360

Query: 402  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWT 461
            SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTH VFKSGEYWT
Sbjct: 361  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYWT 420

Query: 462  TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGS 521
            TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTT P++P LH+ +G+
Sbjct: 421  TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTQPSVPTLHDSNGN 480

Query: 522  LVDVSAKPPAGWRDVLLDYGPEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAA 581
            +VDV A PPAGWRDVLL+ GPE FAKQVRK+NGTLLMDTTWRDAHQSLLATRVRT+DLA 
Sbjct: 481  VVDVLAAPPAGWRDVLLEQGPEGFAKQVRKYNGTLLMDTTWRDAHQSLLATRVRTHDLAT 540

Query: 582  IAPTTAHAMSGAFALECWGGATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGV 641
            IAPTTAHA++GAFALECWGGATF V+MRFLHEDPWERLR LRKLVPNIPFQMLLRGANGV
Sbjct: 541  IAPTTAHALAGAFALECWGGATFVVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGV 600

Query: 642  AYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGD 701
            AYSSLPDNAIDHFV QAK+NGVDIFRVFDALNDLEQL                T+CYSGD
Sbjct: 601  AYSSLPDNAIDHFVLQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGD 660

Query: 702  MLAPGKKYNLDYYLDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHV 761
            ML PGKKYNLDYYL+IT+KIV  GTHILGIKDMAGTLKPSAA+LLIGSIRAKYP+LPIHV
Sbjct: 661  MLQPGKKYNLDYYLEITDKIVKMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHV 720

Query: 762  HTHDSAGTGVASMAACALSGADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYV 821
            HTHDSAGT VASMAACAL+GADVVDVATNSMSGLTSQPSINALLA+LDGEI+NNV+V  V
Sbjct: 721  HTHDSAGTAVASMAACALAGADVVDVATNSMSGLTSQPSINALLASLDGEINNNVDVNMV 780

Query: 822  RELDAYWAEMRLLYSCFEADLKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRA 881
            RELDAYWA+MRLLYSCFEADLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+WAETKRA
Sbjct: 781  RELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGERWAETKRA 840

Query: 882  YREANLLLGDLVKVTPTSKVVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIG 941
            YREAN LLGDLVKVTPTSKVVGDLAQFMV+NKL SDDVRRLASSLDFPDSVMDFFEGLIG
Sbjct: 841  YREANYLLGDLVKVTPTSKVVGDLAQFMVTNKLNSDDVRRLASSLDFPDSVMDFFEGLIG 900

Query: 942  QPYGGFPEPLRTDVLRNKRRKLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMY 1001
            QPYGGFPEPLRTDVL+NKRRKLT RPGLEL PF+LE+IKEDLS+RF DIDECDVASYNMY
Sbjct: 901  QPYGGFPEPLRTDVLKNKRRKLTCRPGLELPPFDLERIKEDLSSRFGDIDECDVASYNMY 960

Query: 1002 PKVYEDFRKIKEKYGDLSVLPTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETG 1061
            PKVYEDFRKI+E+YGDLSVLPTKNFLSPP +GEEIVVTIEQGKTLIIKPQAIGDLNK+TG
Sbjct: 961  PKVYEDFRKIREQYGDLSVLPTKNFLSPPAVGEEIVVTIEQGKTLIIKPQAIGDLNKDTG 1020

Query: 1062 IREVYFELNGELRKVSVADRSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIA 1121
            IREVYFELNGELRKVSV DRSQKVE++SKPKADAHDP+Q+G+PMAGVVVEVKVHKGSL+ 
Sbjct: 1021 IREVYFELNGELRKVSVVDRSQKVETISKPKADAHDPYQVGAPMAGVVVEVKVHKGSLVK 1080

Query: 1122 KGQPVAVLSAMKMEMVISSPADGQVKEVLVKDGE 1155
            KGQPVAVLSAMKMEMVISSPA G VK+VL+KDGE
Sbjct: 1081 KGQPVAVLSAMKMEMVISSPAAGLVKDVLIKDGE 1114

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score = 2009 bits (5205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1155 (82%), Positives = 1043/1155 (90%), Gaps = 1/1155 (0%)

Query: 2    SSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKA 61
            S +LAGLRDN +L+GEKNK+LVANRGEIPIRIFR+AHELSM+T+AIYSHEDRLSMHRLKA
Sbjct: 4    SKKLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKA 63

Query: 62   DEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITW 121
            DEAYVIGE+G+YTPVGAYLA+DEII IAK H V+FIHPGYGFLSENSEFA+KV  +GITW
Sbjct: 64   DEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITW 123

Query: 122  VGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFX 181
            +GPPA VIDSVGDKVSAR+LA +ANVP VPGTPGPIETV+EA  FV++YG+PVIIKAAF 
Sbjct: 124  IGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFG 183

Query: 182  XXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVV 241
                        DD++DAFQRA SEA TAFGNGTCF+ERFLDKPKHIEVQLLADN+GNVV
Sbjct: 184  GGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVV 243

Query: 242  HLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQN 301
            HLFERDCSVQRRHQKVVEVAPAKTLP EVRDAILTDAVKLAK  GYRNAGTAEFLVDNQN
Sbjct: 244  HLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQN 303

Query: 302  RHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRI 361
            RHYFIEINPRIQVEHTITEEIT               TL QLGL+QDKITTRGF+IQCRI
Sbjct: 304  RHYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRI 363

Query: 362  TTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEI 421
            TTEDPSKNFQPDTGR++VYRSAGGNGVRLDGGNA+AG+ ISPHYDSMLVKCSCSGSTYEI
Sbjct: 364  TTEDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEI 423

Query: 422  VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQ 481
            VRRKM+RALIEFRIRGVKTNIPFLLTLLT+PVF  G YWTTFIDDTPQLF+MVSSQNRAQ
Sbjct: 424  VRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQ 483

Query: 482  KLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVS-AKPPAGWRDVLLDY 540
            KLLHYLADLAVNGSSIKGQIGLPKL ++P++PHLH+  G++++V+ + PP+GWR VLL+ 
Sbjct: 484  KLLHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEK 543

Query: 541  GPEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWG 600
            GP EFAKQVR+FNGTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHA++GAFALECWG
Sbjct: 544  GPSEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWG 603

Query: 601  GATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 660
            GATFDV+MRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD
Sbjct: 604  GATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 663

Query: 661  NGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGDMLAPGKKYNLDYYLDITEK 720
            NGVDIFRVFDALNDLEQL                T+CYSGDML PGKKYNLDYYL++ EK
Sbjct: 664  NGVDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVVEK 723

Query: 721  IVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALS 780
            IV  GTHILGIKDMAGT+KP+AA+LLIGS+R +YP+LPIHVH+HDSAGT VASM ACAL+
Sbjct: 724  IVQMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALA 783

Query: 781  GADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEA 840
            GADVVDVA NSMSGLTSQPSINALLA+L+G ID  +NV +VRELDAYWAEMRLLYSCFEA
Sbjct: 784  GADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEA 843

Query: 841  DLKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSK 900
            DLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+WAETKRAYREAN LLGD+VKVTPTSK
Sbjct: 844  DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSK 903

Query: 901  VVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKR 960
            VVGDLAQFMVSNKLTSDD+RRLA+SLDFPDSVMDFFEGLIGQPYGGFPEPLR+DVLRNKR
Sbjct: 904  VVGDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKR 963

Query: 961  RKLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSV 1020
            RKLT RPGLEL PF+LEKI+EDL  RF DIDECDVASYNMYP+VYEDF+KI+E YGDLSV
Sbjct: 964  RKLTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSV 1023

Query: 1021 LPTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVAD 1080
            LPTKNFL+P    EEI VTIEQGKTLIIK QA+GDLNK+TG REVYFELNGELRK+ VAD
Sbjct: 1024 LPTKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVAD 1083

Query: 1081 RSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISS 1140
            +SQ ++SV+KPKAD HD  QIG+PMAGV++EVKVHKGSL+ KG+ +AVLSAMKMEMV+SS
Sbjct: 1084 KSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSS 1143

Query: 1141 PADGQVKEVLVKDGE 1155
            PADGQVK+V +KDGE
Sbjct: 1144 PADGQVKDVFIKDGE 1158

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score = 2007 bits (5200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 958/1155 (82%), Positives = 1038/1155 (89%)

Query: 1    MSSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLK 60
            M SQLAG R +SNL+GEKNK+LVANRGEIPIRIFRTAHELSM TVA+YS+EDRLSMHR K
Sbjct: 1    MGSQLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQK 60

Query: 61   ADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGIT 120
            ADEAY+IG +G+YTPVGAYLAIDEI+ IA+ H V+FIHPGYGFLSEN+EFA KV  +GIT
Sbjct: 61   ADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGIT 120

Query: 121  WVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAF 180
            W+GPPA+VI++VGDKVSARNLA  A+VP VPGT GPI +VEEA+ FV KYG+PVIIKAAF
Sbjct: 121  WIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAF 180

Query: 181  XXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNV 240
                         DDI DAFQRA+SEA TAFGNGTCF+ERFLD+PKHIEVQLLADNYGNV
Sbjct: 181  GGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNV 240

Query: 241  VHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ 300
            VHLFERDCSVQRRHQKVVEVAPAKTL +EVRDAILTDAVKLAK +GYRNAGTAEFLVD Q
Sbjct: 241  VHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQ 300

Query: 301  NRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCR 360
            NRHYFIEINPRIQVEHTITEEIT               +LEQLGLMQD+ITTRGFAIQCR
Sbjct: 301  NRHYFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRGFAIQCR 360

Query: 361  ITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYE 420
            ITTEDPSKNFQPDTGR+DVYRSAGGNGVRLDGGNAFAG+VISPHYDSMLVKCSCSGSTYE
Sbjct: 361  ITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYE 420

Query: 421  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRA 480
            IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVF SG+YWTTFIDDTPQLFEMV+SQNRA
Sbjct: 421  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRA 480

Query: 481  QKLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDY 540
            QKLL YL+DLAVNGSSIKGQ+G+PKL   P+IP LHN  G ++DV ++PPAGWR VLL++
Sbjct: 481  QKLLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEH 540

Query: 541  GPEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWG 600
            GPE FAK+VR+F+GTLL DTTWRDAHQSLLATRVRTYDLAAIAPTTAHA++GAFALECWG
Sbjct: 541  GPEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALAGAFALECWG 600

Query: 601  GATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 660
            GATFDV+MRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+
Sbjct: 601  GATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKE 660

Query: 661  NGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGDMLAPGKKYNLDYYLDITEK 720
            NGVDIFRVFDALNDLEQL                TICYSGDML PGKKYNLDYYL++TEK
Sbjct: 661  NGVDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEK 720

Query: 721  IVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALS 780
            IV  GTHILGIKDMAGT+KP AA+LLIGSIRAKYP+LPIHVHTHDSAGTGVASM  CA+S
Sbjct: 721  IVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAIS 780

Query: 781  GADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEA 840
            GADVVDVATNSMSGLTSQPSI AL A+L G+I   V+  +  ELDAYWAEMRLLYSCFEA
Sbjct: 781  GADVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEA 840

Query: 841  DLKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSK 900
            DLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+WAETKRAY EAN LLGDLVKVTPTSK
Sbjct: 841  DLKGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSK 900

Query: 901  VVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKR 960
            VVGDLAQFMVSN+L SDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLR+DVLRNKR
Sbjct: 901  VVGDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKR 960

Query: 961  RKLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSV 1020
            RKL  RPGLELAPF+L+KI+E+L +RF +IDECDVASYNMYPKVYEDFRKI+E YGDLSV
Sbjct: 961  RKLKVRPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSV 1020

Query: 1021 LPTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVAD 1080
            LPT NFLSPP IGEEI+VTIEQGK LIIK QAIGDLNKETG REVYFELNGELRKVSVAD
Sbjct: 1021 LPTHNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVAD 1080

Query: 1081 RSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISS 1140
            +SQK+E+VSK KADAHD FQ+G+PMAGV++EVKVHKGS + KGQPVAVLSAMKMEMVISS
Sbjct: 1081 KSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISS 1140

Query: 1141 PADGQVKEVLVKDGE 1155
            P+DGQVK+V V DGE
Sbjct: 1141 PSDGQVKDVFVSDGE 1155

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score = 2003 bits (5188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 953/1153 (82%), Positives = 1038/1153 (90%), Gaps = 1/1153 (0%)

Query: 4    QLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADE 63
            + AGLRDN NL+GEKNK+LVANRGEIPIRIFRTAHELSM+TVAIYSHEDRLS H+ KADE
Sbjct: 5    KFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADE 64

Query: 64   AYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVG 123
            AYVIGE G+YTPVGAYLAIDEII+IA+ H V+FIHPGYGFLSENSEFA+KV  +GITW+G
Sbjct: 65   AYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIG 124

Query: 124  PPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXX 183
            PPA VIDSVGDKVSARNLA KANVP VPGTPGPIETVEEA  FV++YG+PVIIKAAF   
Sbjct: 125  PPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFGGG 184

Query: 184  XXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHL 243
                      DD++DAFQRA SEA TAFGNGTCF+ERFLDKPKHIEVQLLADN+GNVVHL
Sbjct: 185  GRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 244

Query: 244  FERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 303
            FERDCSVQRRHQKVVEVAPAKTLP EVRDAILTDAVKLAKE GYRNAGTAEFLVDNQNRH
Sbjct: 245  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304

Query: 304  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRITT 363
            YFIEINPRIQVEHTITEEIT               +L QLGL QDKITTRGFAIQCRITT
Sbjct: 305  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRITT 364

Query: 364  EDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVR 423
            EDP+KNFQPDTGRI+VYRSAGGNGVRLDGGNA+AG++ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 365  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVR 424

Query: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQKL 483
            RKM+RALIEFRIRGVKTNIPFLLTLLT+PVF  G YWTTFIDDTPQLF+MVSSQNRAQKL
Sbjct: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 484

Query: 484  LHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVS-AKPPAGWRDVLLDYGP 542
            LHYLAD+AVNGSSIKGQIGLPKL ++P++PHLH+  G++++V+ + PP+GWR VLL+ GP
Sbjct: 485  LHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 544

Query: 543  EEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGGA 602
             EFA+QVR+FNGTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHA++G FALECWGGA
Sbjct: 545  AEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWGGA 604

Query: 603  TFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 662
            TFDV+MRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG
Sbjct: 605  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 664

Query: 663  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGDMLAPGKKYNLDYYLDITEKIV 722
            VDIFRVFDALNDLEQL                T+C+SGDML PGKKYNLDYYL+I EKIV
Sbjct: 665  VDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIAEKIV 724

Query: 723  NSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSGA 782
              GTHILGIKDMAGT+KP+AA+LLIGS+RAKYP+LPIHVHTHDSAGT VASM ACAL+GA
Sbjct: 725  QMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACALAGA 784

Query: 783  DVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEADL 842
            DVVDVA NSMSGLTSQPSINALLA+L+G ID  +NV +VRELDAYWAEMRLLYSCFEADL
Sbjct: 785  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 844

Query: 843  KGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKVV 902
            KGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+WAETKRAYREAN LLGD+VKVTPTSKVV
Sbjct: 845  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 904

Query: 903  GDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRRK 962
            GDLAQFMVSNKLTSDDVRRLA+SLDFPDSVMDFFEGLIGQPYGGFPEP R+DVLRNKRRK
Sbjct: 905  GDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNKRRK 964

Query: 963  LTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVLP 1022
            LT RPGLEL PF+LEKI+EDL  RF D+DECDVASYNMYP+VYEDF+K++E YGDLSVLP
Sbjct: 965  LTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLSVLP 1024

Query: 1023 TKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADRS 1082
            T++FLSP    EEI V IEQGKTLIIK QA+GDLNK+TG REVYF+LNGE+RK+ VADRS
Sbjct: 1025 TRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVADRS 1084

Query: 1083 QKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPA 1142
            QKVE+V+K KAD HDP  IG+PMAGV+VEVKVHKGSLI KGQPVAVLSAMKMEM+ISSP+
Sbjct: 1085 QKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPS 1144

Query: 1143 DGQVKEVLVKDGE 1155
            DGQVKEV V DGE
Sbjct: 1145 DGQVKEVFVSDGE 1157

>Scas_686.17
          Length = 1176

 Score = 2002 bits (5186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 947/1151 (82%), Positives = 1040/1151 (90%)

Query: 4    QLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADE 63
            +L+GLRDN +L+GEKNK+LVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLS HRLKADE
Sbjct: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64

Query: 64   AYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVG 123
            +YVIGE+G++TPVGAYLAIDEIINIAK H V+FIHPGYGFLSENSEFA+KVA +GITW+G
Sbjct: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124

Query: 124  PPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXX 183
            PPA VIDSVGDKVSAR LA +A+VP VPGTPGPI++V+EA+ FV +YG+PVIIKAAF   
Sbjct: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGG 184

Query: 184  XXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHL 243
                      +DI+DAFQRA SEA+TAFG+GTCF+ERFLD PKHIEVQLL DNYGNVVHL
Sbjct: 185  GRGMRVVREGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244

Query: 244  FERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 303
            FERDCSVQRRHQKVVEVAPAK +P EVRDAILTDAVKLAKE GYRNAGTAEFLVDNQNRH
Sbjct: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304

Query: 304  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRITT 363
            YFIEINPRIQVEHTITEEIT               +L QLGL+QD+ITTRGFAIQCRITT
Sbjct: 305  YFIEINPRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITT 364

Query: 364  EDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVR 423
            EDP+KNFQPDTGR++VYRSAGGNGVRLDGGNA+AG+VISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424

Query: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQKL 483
            RKM+RALIEFRIRGVKTNIPFLLTLLTHPVF SG+YWTTFIDDTPQLF+MVSSQNRAQKL
Sbjct: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484

Query: 484  LHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDYGPE 543
            LHYLADLAVNGSSIKGQIGLPKL  +P +PHLH+ +G++++V+  P AGWR VLL+ GP 
Sbjct: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVATPPTAGWRKVLLEQGPA 544

Query: 544  EFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGGAT 603
            EFAKQVR F GTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHA+SGAFALECWGGAT
Sbjct: 545  EFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGAT 604

Query: 604  FDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV 663
            FDV+MRFLHEDPW RLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV
Sbjct: 605  FDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV 664

Query: 664  DIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGDMLAPGKKYNLDYYLDITEKIVN 723
            DIFRVFDALNDL+QL                T+CYSGDML PGKKYNLDYYL++TEKIV 
Sbjct: 665  DIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTEKIVQ 724

Query: 724  SGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSGAD 783
             GTHILGIKDMAGT+KP+AARLLIGSIRAKYP+LPIHVHTHDSAGT V+SM   ALSGAD
Sbjct: 725  MGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGAD 784

Query: 784  VVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEADLK 843
            VVDVA NSMSGLTSQPSINALLA+LDG+ID  +NV  VRELDAYWAEMRLLYSCFEADLK
Sbjct: 785  VVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADLK 844

Query: 844  GPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKVVG 903
            GPD EVY HEIPGGQLTNLLFQAQQ GLGE+WAETKRAYREAN LLGD+VKVTPTSKVVG
Sbjct: 845  GPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVVG 904

Query: 904  DLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRRKL 963
            DLAQFMV+NK  SDD++RLA++LDFPDS+MDFFEGLIGQPYGGFPEPLR+D+LRNKRRKL
Sbjct: 905  DLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRKL 964

Query: 964  TQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVLPT 1023
            T RPGLELAPF ++ I+EDL TRF DIDECD+ASYNMYPKVYEDF+KIKEKYGDLSVLPT
Sbjct: 965  TTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLPT 1024

Query: 1024 KNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADRSQ 1083
            K+FLSP  + EEI VTIEQGKTLI+K QAIGDLNK TG+REVYF+LNGELRK+ V DRSQ
Sbjct: 1025 KSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRSQ 1084

Query: 1084 KVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPAD 1143
            KVE+++KPKADAHDP+QIG+PMAGVVVEVKVHKGSL+ KG+ VAVLSAMKMEMVISSPAD
Sbjct: 1085 KVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPAD 1144

Query: 1144 GQVKEVLVKDG 1154
            GQVKEVLV +G
Sbjct: 1145 GQVKEVLVSNG 1155

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score = 2001 bits (5184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 952/1153 (82%), Positives = 1039/1153 (90%), Gaps = 1/1153 (0%)

Query: 4    QLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADE 63
            +LAGLR N N++GEK+K+LVANRGEIPIRIFRTAHELSM+TVAIYSHEDRLS HRLKADE
Sbjct: 9    KLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADE 68

Query: 64   AYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVG 123
            AYVIGE+G+YTPVGAYLAIDEII+IAK HGV+FIHPGYGFLSENSEFA+KV  +GITW+G
Sbjct: 69   AYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIG 128

Query: 124  PPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXX 183
            PP  VI+SVGDKVSARNLA KA VP VPGTPGPI+TVEEA+AFV +YG+PVIIKAA+   
Sbjct: 129  PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGGG 188

Query: 184  XXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHL 243
                      +DI DAFQRA SEA TAFGNGTCF+ERFLDKPKHIEVQLLADN+GNV+HL
Sbjct: 189  GRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHL 248

Query: 244  FERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 303
            FERDCSVQRRHQKVVEVAPAKTLP +VRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH
Sbjct: 249  FERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 308

Query: 304  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRITT 363
            YFIEINPRIQVEHTITEEIT               +L +LGL+QD+ITTRGFAIQCRITT
Sbjct: 309  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRITT 368

Query: 364  EDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVR 423
            EDP+KNFQPDTGRI+VY S GGNGVRLDGGNA+AG+VISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 369  EDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 428

Query: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQKL 483
            RK++RALIEFRIRGVKTNIPFLLTLLTHPVF SG+YWTTFIDDTPQLF MVSSQNRAQKL
Sbjct: 429  RKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKL 488

Query: 484  LHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVS-AKPPAGWRDVLLDYGP 542
            LHYLADLAVNGSSIKGQIGLPKL+T P IPHLH+E G ++ V+   PP GWR VLL+ GP
Sbjct: 489  LHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKGP 548

Query: 543  EEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGGA 602
            E FAK VR F GTLLMDTTWRDAHQSLLATRVRT+DLAAIAPTTAHA++GAFALECWGGA
Sbjct: 549  EGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDLAAIAPTTAHALAGAFALECWGGA 608

Query: 603  TFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 662
            TFDV+MRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG
Sbjct: 609  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 668

Query: 663  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGDMLAPGKKYNLDYYLDITEKIV 722
            VDIFRVFDALNDLEQL                T+CYSGDML PGKKYNLDYYL++T+KIV
Sbjct: 669  VDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTDKIV 728

Query: 723  NSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSGA 782
              GTH+LGIKDMAGTLKP+AA+LLIGSIRAKYP+LPIHVH+HDSAGT VASMAACA +GA
Sbjct: 729  EMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGA 788

Query: 783  DVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEADL 842
            DVVDVA NSMSG+TSQ SINALLA+LDGEID  VNV + RELDAYWAEMRLLYSCFEADL
Sbjct: 789  DVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADL 848

Query: 843  KGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKVV 902
            KGPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW ETKRAY+EAN LLGD+VKVTPTSKVV
Sbjct: 849  KGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVV 908

Query: 903  GDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRRK 962
            GDLAQFMV+N+LTS+DV+RLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLR+D+LRNKRRK
Sbjct: 909  GDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRK 968

Query: 963  LTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVLP 1022
            LT RPGLEL PF+LE I+EDL  RF +IDECDVASYNMYPKVYEDF+K+KE YGDLSVLP
Sbjct: 969  LTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLP 1028

Query: 1023 TKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADRS 1082
            TKNFL+PP IGE+I V +EQGKTLIIK QA+GDLNKETG+R+VYFELNGE+RK+ V DRS
Sbjct: 1029 TKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRS 1088

Query: 1083 QKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPA 1142
            QKVE VSKPKAD HDPFQIG+PMAGV+VEVKVHKGSL+ KGQPVA+LSAMKMEMV+SS A
Sbjct: 1089 QKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQA 1148

Query: 1143 DGQVKEVLVKDGE 1155
            DGQVK+V VKD E
Sbjct: 1149 DGQVKDVFVKDAE 1161

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score = 1991 bits (5157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 947/1154 (82%), Positives = 1036/1154 (89%)

Query: 2    SSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKA 61
            +  L GLRDN +L+GEKNK+LVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLS HRLKA
Sbjct: 4    NKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKA 63

Query: 62   DEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITW 121
            DEAYVIG++G+YTPVGAYLAIDEII+IAK HGV+FIHPGYGFLSEN+EFA+KV  +GITW
Sbjct: 64   DEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITW 123

Query: 122  VGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFX 181
            +GPP  VI+SVGDKVSARNLA KANVP VPGTPGPIETVEEAQ FV+KYG+PVIIKAA+ 
Sbjct: 124  IGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYG 183

Query: 182  XXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVV 241
                        DD++DAFQRAKSEAITAFGNGTCF+ERFLDKPKHIEVQLLADN+GNVV
Sbjct: 184  GGGRGMRVVREGDDVADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVV 243

Query: 242  HLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQN 301
            HLFERDCSVQRRHQKVVEVAPAKTLP EVRD+ILTDAV+LAKEAGYRNAGTAEFLVDNQN
Sbjct: 244  HLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQN 303

Query: 302  RHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRI 361
            RHYFIEINPRIQVEHTITEEIT               +L QLGL+QD+ITTRGFAIQCRI
Sbjct: 304  RHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRI 363

Query: 362  TTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEI 421
            TTEDP+KNFQPDTGR++VYRSAGGNGVRLDGG A+AG+VISPHYDSMLVKCSCSGSTYEI
Sbjct: 364  TTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEI 423

Query: 422  VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQ 481
            VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVF SG+YWTTFIDDTPQLF MVSS+NRAQ
Sbjct: 424  VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQ 483

Query: 482  KLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDYG 541
            KLLHYLADLAVNGSSIKGQIG PKL THP IP LH+EDGS VDVS  P  GWR +L   G
Sbjct: 484  KLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQSEG 543

Query: 542  PEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGG 601
            PE FAK VR   GTL+MDTTWRDAHQSLLATRVRTYDLAAIA TTAHA +GAFALECWGG
Sbjct: 544  PEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLAAIAQTTAHAFAGAFALECWGG 603

Query: 602  ATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 661
            ATFDV+MRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN
Sbjct: 604  ATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 663

Query: 662  GVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGDMLAPGKKYNLDYYLDITEKI 721
            GVDIFRVFDALNDLEQL                T+CYSGDML PGKKYNLDYYLD+TEKI
Sbjct: 664  GVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLDVTEKI 723

Query: 722  VNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSG 781
            V  GTHILGIKDMAGT+KP+AA+LLIG+IRAK+P+LPIHVH+HDSAGT VASMAACAL+G
Sbjct: 724  VAMGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAG 783

Query: 782  ADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEAD 841
            ADVVDVA NSMSGLTSQ S+NA+LA+LDG+ID  +NV +V ELDAYWAEMRLLYSCFEAD
Sbjct: 784  ADVVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEAD 843

Query: 842  LKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKV 901
            LKGPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW ETK+AY++AN LLGD+VKVTPTSKV
Sbjct: 844  LKGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKV 903

Query: 902  VGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRR 961
            VGDLAQFMVSN+LT DD+RRLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLRTD+L+NKRR
Sbjct: 904  VGDLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDILKNKRR 963

Query: 962  KLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVL 1021
            KL +RPGLELAPF+L KI+EDL  RF DI+ECDVASYNMYPKVYEDF+KI E+YGDLSVL
Sbjct: 964  KLNRRPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVL 1023

Query: 1022 PTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADR 1081
            PT+NFL+ P +GEEI V IEQGKTLIIK QA+GDLN+ETGIREVYFELNGE RK+ +AD+
Sbjct: 1024 PTRNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADK 1083

Query: 1082 SQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSP 1141
            SQ V++++KPKAD HDP QIG+PMAGV+VEVKVHKGS + KGQPVAVLSAMKMEMVISS 
Sbjct: 1084 SQVVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISST 1143

Query: 1142 ADGQVKEVLVKDGE 1155
             +G VK+VLVKDGE
Sbjct: 1144 GEGLVKDVLVKDGE 1157

>Scas_563.12
          Length = 1216

 Score = 1969 bits (5102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 935/1160 (80%), Positives = 1042/1160 (89%), Gaps = 5/1160 (0%)

Query: 1    MSSQLAGLRDNSNLMGEKNKLL----VANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSM 56
            ++ +L G RDN NL+G +N+ L    V +    P+  FR+AHELSM+TVAIYSHEDRLS 
Sbjct: 39   INKKLNGPRDNFNLLGTRNRFLSPIVVKSPSYPPVCNFRSAHELSMQTVAIYSHEDRLST 98

Query: 57   HRLKADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAA 116
            HRLKADE+YVIGE  ++TPVGAYLAIDEIINIAK HGV++IHPGYGFLSENSEFA+KVA 
Sbjct: 99   HRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGVDYIHPGYGFLSENSEFADKVAK 158

Query: 117  SGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVII 176
            +GITW+GPPA+VIDSVGDKVSARNLA KANVP VPGTPGPI TV++AQ FV++YG+PVII
Sbjct: 159  AGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTPGPIRTVQDAQDFVNEYGYPVII 218

Query: 177  KAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADN 236
            KAAF             DD++DAFQRA SEA+TAFG+GTCF+ERFL+KPKHIEVQLLAD 
Sbjct: 219  KAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDGTCFVERFLNKPKHIEVQLLADT 278

Query: 237  YGNVVHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFL 296
            +GNV+HLFERDCSVQRRHQKVVEVAPAKTLP EVRDAILTDAVKLAKE GY+NAGTAEFL
Sbjct: 279  HGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYQNAGTAEFL 338

Query: 297  VDNQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFA 356
            VD+QNRHYFIEINPRIQVEHTITEEIT               +LEQLGL+QDKITTRGFA
Sbjct: 339  VDDQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLEQLGLLQDKITTRGFA 398

Query: 357  IQCRITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSG 416
            IQCRITTEDP+KNFQPDTGR++VY SAGGNGVRLDGGNA+AG++ISPHYDSMLVKCSCSG
Sbjct: 399  IQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGGNAYAGAIISPHYDSMLVKCSCSG 458

Query: 417  STYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSS 476
            STYE+VRRKM+RALIEFRIRGVKTNIPFLLTLLTHPVF +G+YWTTFIDDTPQLF+MVSS
Sbjct: 459  STYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFIAGDYWTTFIDDTPQLFKMVSS 518

Query: 477  QNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVS-AKPPAGWRD 535
            QNRAQKLLHYLADLAVNGSSIKGQ+G+P+L   P IPH+H+  G+++DV+   PPAGWR 
Sbjct: 519  QNRAQKLLHYLADLAVNGSSIKGQVGIPQLKKVPDIPHIHDAQGNVIDVTNVPPPAGWRQ 578

Query: 536  VLLDYGPEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFA 595
            VLL+ GPEEFAKQVR+F GTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHA++ AFA
Sbjct: 579  VLLEQGPEEFAKQVRQFQGTLLMDTTWRDAHQSLLATRVRTHDLAKIAPTTAHALASAFA 638

Query: 596  LECWGGATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFV 655
            LECWGGATFDV+MRFLHEDPW+RLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFV
Sbjct: 639  LECWGGATFDVAMRFLHEDPWKRLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFV 698

Query: 656  KQAKDNGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXXXTICYSGDMLAPGKKYNLDYYL 715
            KQAKDNGVDIFRVFDALNDL+QL                T+CYSGDML PGKKYNLDYYL
Sbjct: 699  KQAKDNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYL 758

Query: 716  DITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMA 775
            ++TEKIV  GTHILGIKDMAGT+KP+AARLLIGSIRAKYP+LPIHVHTHDSAGT VASM+
Sbjct: 759  EVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVASMS 818

Query: 776  ACALSGADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLY 835
            A A +GADV+DVATNSMSGLTSQPSINALLA+LDGEI+ ++NV +VRELDAYWAEMRLLY
Sbjct: 819  AAAYAGADVIDVATNSMSGLTSQPSINALLASLDGEINTSINVQHVRELDAYWAEMRLLY 878

Query: 836  SCFEADLKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKV 895
            SCF ADLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETKRAY+EAN+LLGD+VKV
Sbjct: 879  SCFGADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEQWTETKRAYKEANMLLGDIVKV 938

Query: 896  TPTSKVVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDV 955
            TPTSKVVGDLAQFMVSNKLTS+DV+RLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLR+D+
Sbjct: 939  TPTSKVVGDLAQFMVSNKLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDI 998

Query: 956  LRNKRRKLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKY 1015
            LRNKRRKLT RPGLEL PFEL  IKEDL TRF DI+ECD+ASYNMYPKVYEDF+K+KEKY
Sbjct: 999  LRNKRRKLTCRPGLELVPFELNNIKEDLQTRFGDINECDIASYNMYPKVYEDFQKMKEKY 1058

Query: 1016 GDLSVLPTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRK 1075
            GDLSVLPTK+FL+P  IGEEI+VTI+QGKTLIIK QAIGDLNKETG REV+FELNGE+RK
Sbjct: 1059 GDLSVLPTKSFLAPAEIGEEILVTIQQGKTLIIKLQAIGDLNKETGKREVFFELNGEMRK 1118

Query: 1076 VSVADRSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKME 1135
            +SV D+SQKVE+V+KPKAD HDPFQIG+PMAGV+VEVKVHKGSL+ KG+ VAVLSAMKME
Sbjct: 1119 ISVTDKSQKVETVAKPKADTHDPFQIGAPMAGVIVEVKVHKGSLVKKGEAVAVLSAMKME 1178

Query: 1136 MVISSPADGQVKEVLVKDGE 1155
            MVISSPADG VKEVLV + E
Sbjct: 1179 MVISSPADGLVKEVLVNESE 1198

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score =  286 bits (732), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 169/471 (35%), Positives = 260/471 (55%), Gaps = 20/471 (4%)

Query: 11   NSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVIGEQ 70
            N +  G    +LVANRGEI +RI +T   + +K++AIYS  D+ S H L  D A  +   
Sbjct: 623  NESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALD-- 680

Query: 71   GKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVID 130
              +T    YL +++II+IAK + V+ I PGYGFLSEN+ FA++    GI ++GP    I 
Sbjct: 681  -GHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIR 739

Query: 131  SVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXX 190
             +G K SAR +A+ A VP+VPG+P  ++  +EA       G+PV++K+            
Sbjct: 740  KLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKV 798

Query: 191  XXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSV 250
                D+  AF+  K +  + FG+   F+E+F+D  +H+EVQ++ D  G  + L ERDCS+
Sbjct: 799  DNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSL 858

Query: 251  QRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFIEIN 309
            QRR+QKV+E  PA  LP E R  +LT A +L     YR AGT EF+ D Q ++ YF+E+N
Sbjct: 859  QRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVN 918

Query: 310  PRIQVEHTITEEIT--XXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRITTEDPS 367
             R+QVEH ITE +T                 +L++  + Q+     G +I+ R+  E+P 
Sbjct: 919  TRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQN-----GASIEVRVYAENPL 973

Query: 368  KNFQPDTGR-IDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKM 426
            K+F+P  G  +DV      N  R+D      G+ ISP +D  L K    G        KM
Sbjct: 974  KDFRPSPGELVDVQFP---NDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKM 1029

Query: 427  LRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDD---TPQLFEMV 474
             +AL E +I G  TN+ +L +L++  +F++ +  T +++    +P   E++
Sbjct: 1030 KKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEII 1080

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 40/77 (51%)

Query: 1079 ADRSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVI 1138
            AD  Q    V +      D   I S  AG   +  V  G+ I K Q VAV+ AMK EM++
Sbjct: 1744 ADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIV 1803

Query: 1139 SSPADGQVKEVLVKDGE 1155
            SS   G++K+ L K+G+
Sbjct: 1804 SSSVVGKLKKFLFKNGD 1820

>Scas_721.40
          Length = 1834

 Score =  278 bits (712), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 165/478 (34%), Positives = 256/478 (53%), Gaps = 14/478 (2%)

Query: 1    MSSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLK 60
              + L  L  N+        +LVANRGEI +RI +T  ++ +++VAI+S  DR S H + 
Sbjct: 610  FKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVID 669

Query: 61   ADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGIT 120
            AD    +  +G  +    YL I++II+ AK  G   I PGYGFLSEN++F+E+  A GIT
Sbjct: 670  AD--LTVDLKG-VSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGIT 726

Query: 121  WVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAF 180
            +VGP   V+  +G K SAR +A+KANVP+VPG+   I T  EA+    K  +P+++K+  
Sbjct: 727  FVGPSGDVMRGLGLKHSAREIAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTA 785

Query: 181  XXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNV 240
                         DDI   F+  K +    FG+   F+ERF++  +H+EVQ++ D  GN 
Sbjct: 786  GGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNA 845

Query: 241  VHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDN- 299
            + + ERDCS+QRR+QK++E  PA  LPE  R  +   A +L     Y+ AGT EF+ D  
Sbjct: 846  LAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEI 905

Query: 300  QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQC 359
            ++  YF+E+N R+QVEH ITE +T                 +     Q KI   G A++ 
Sbjct: 906  RDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPD---FNQLKIDVNGVAMEA 962

Query: 360  RITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTY 419
            R+  E+P  +F+P  G++           R+D   +  G++++P YD  L K    G   
Sbjct: 963  RLYAENPVHDFKPSPGQL--VEVEFPKWARIDTWVS-KGTIVTPEYDPTLAKIIVHGKDR 1019

Query: 420  EIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFI---DDTPQLFEMV 474
                 K+ +AL+E ++ G  TNI +L ++ +  +F+  +  T  +   D  P   E++
Sbjct: 1020 HDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEII 1077

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%)

Query: 1101 IGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPADGQVKEVLVKDG 1154
            I S  +G   +  V +G  +  GQ + ++ AMK EM++ +  DG+V +++ K+G
Sbjct: 1764 IYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKVLKIVHKNG 1817

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score =  271 bits (694), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 160/459 (34%), Positives = 249/459 (54%), Gaps = 14/459 (3%)

Query: 21   LLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVIGEQGKYTPVGAYL 80
            +L+ANRGEI +RI +T   + +K+VA+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683

Query: 81   AIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARN 140
             ID+IIN AK  G   I PGYGFLSEN++F+++ +   I +VGP    I  +G K SAR 
Sbjct: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743

Query: 141  LAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAF 200
            +AE+A VP+VPG+ G I+  +EA+    K  +PV++K+               DDI   F
Sbjct: 744  IAERAKVPLVPGS-GLIKDAKEAKEVAKKLEYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802

Query: 201  QRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEV 260
            +  + +  + FG+   F+ERF++  +H+E+Q++ D +G  + + ERDCS+QRR+QKV+E 
Sbjct: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862

Query: 261  APAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 319
             PA  LPE  R  +   + +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922

Query: 320  EEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRITTEDPSKNFQPDTGRIDV 379
            E +T               + +       KI   G +I+ R+  E+P K+F+P  G++  
Sbjct: 923  EMVTGLDLVEWMLRIAANDSPD---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978

Query: 380  YRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 439
               +  +  R+D      G+ +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036

Query: 440  TNIPFLLTLLTHPVFKSGEYWTTFIDD---TPQLFEMVS 475
            TNI +L ++ +  +FK  +  T  +D     P  FE+++
Sbjct: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLA 1075

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 1070 NGELRKVSVADRSQKVESVSKPKADAHDPF--QIGSPMAGVVVEVKVHKGSLIAKGQPVA 1127
            N EL+K S  D+ Q VE         +  +  +   P+A V        G  +  G  V 
Sbjct: 1739 NAELKK-SGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAV--------GDHVEAGDGVI 1789

Query: 1128 VLSAMKMEMVISSPADGQVKEVLVKDGE 1155
            ++ AMK EMV+ +   G+V ++L K+G+
Sbjct: 1790 IIEAMKTEMVVGATKSGKVYKILHKNGD 1817

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score =  271 bits (692), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 161/459 (35%), Positives = 245/459 (53%), Gaps = 33/459 (7%)

Query: 19   NKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVIGEQGKYTPVGA 78
            + +L+ANRGEI +RI +T  +L +++VA+YS  D+ S H   AD +  +   G  T    
Sbjct: 634  DTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPL--HGT-TAAQT 690

Query: 79   YLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSA 138
            YL +++II+ AK      I PGYGFLSEN++F++   ++GIT+VGP   +I  +G K SA
Sbjct: 691  YLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSA 750

Query: 139  RNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISD 198
            R +A+KA VP+VPG+   I +VEEA+    +  +PV++K+               +DI  
Sbjct: 751  RQIAQKAGVPLVPGSL-LITSVEEAKKVAAELEYPVMVKSTAGGGGIGLQKVDSEEDIEH 809

Query: 199  AFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVV 258
             F+  K +  T FG+   F+ERF++  +H+EVQL+ D +G  + L ERDCS+QRR+QKV+
Sbjct: 810  IFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVI 869

Query: 259  EVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHT 317
            E  PA  LPE+ R A+   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH 
Sbjct: 870  EETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHP 929

Query: 318  ITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRITTEDPSKNFQPDTG-- 375
            ITE +T                 +       K+   G +++ R+  E+P KNF+P  G  
Sbjct: 930  ITEMVTGLDLVEWMIRIAANDAPD---FDSTKVEVNGVSMEARLYAENPLKNFRPSPGLL 986

Query: 376  ---------RIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKM 426
                     R+D +   G N              ISP YD  L K    G   +    K+
Sbjct: 987  VDVKFPDWARVDTWVKKGTN--------------ISPEYDPTLAKIIVHGKDRDDAISKL 1032

Query: 427  LRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFID 465
             +AL E ++ G  TNI +L +++T   F   +  T  ++
Sbjct: 1033 NQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 26/39 (66%)

Query: 1117 GSLIAKGQPVAVLSAMKMEMVISSPADGQVKEVLVKDGE 1155
            G +I  GQ + ++ AMK EM+IS+P  G++ ++   +G+
Sbjct: 1782 GDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNGD 1820

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score =  269 bits (688), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 161/460 (35%), Positives = 246/460 (53%), Gaps = 16/460 (3%)

Query: 21   LLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVIGEQGKYTPVGAYL 80
            +L+ANRGEI +RI +T  +L++++VA+YS  D+ S H + AD    +  +   T    YL
Sbjct: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685

Query: 81   AIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARN 140
             ID+II  AK      I PGYGFLSEN+EFA+K    GI +VGP    I  +G K SAR 
Sbjct: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745

Query: 141  LAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAF 200
            +AEKA VP+VPG+ G + + +EA+   +K  +PV++K+               ++I   F
Sbjct: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804

Query: 201  QRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEV 260
            +  + +    FG+   F+ERF++  +H+E+Q++ D YG  + + ERDCS+QRR+QK++E 
Sbjct: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864

Query: 261  APAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTIT 319
             PA  L E  R  +   A  L     Y+ AGT EF+ D  ++  YF+E+N R+QVEH IT
Sbjct: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924

Query: 320  EEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRITTEDPSKNFQPDTGRI-D 378
            E +T                 +        I   G +I+ R+  E+P+K+F+P  G + D
Sbjct: 925  EMVTGLDLVEWMLRIAADDAPD---FESANIVVTGASIEARLYAENPAKDFRPSPGLLTD 981

Query: 379  VYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGV 438
            V+        R+D   +  G+ +S  YD  L K    G        KM +AL E  + G 
Sbjct: 982  VHFP---EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGC 1037

Query: 439  KTNIPFLLTLLTHPVFKSGEYWTTFIDD---TPQLFEMVS 475
             TNI +L ++ +  +FK+ +  T  +D     P  FE+ S
Sbjct: 1038 ITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTS 1077

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 7/87 (8%)

Query: 1074 RKVSVADRSQKVESVSKPKADAHDPF-----QIGSPMAGVVVEVKVHKGSLIAKGQPVAV 1128
            R + VA+  Q++ES +  K+   + +      + S  +G   +  V  G  + KG  + +
Sbjct: 1734 RLIQVAN--QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVI 1791

Query: 1129 LSAMKMEMVISSPADGQVKEVLVKDGE 1155
            + AMK EMV+ +   G+V +++ K+G+
Sbjct: 1792 VEAMKTEMVVPAKKSGKVLKIVHKNGD 1818

>Kwal_27.11951
          Length = 1869

 Score =  262 bits (670), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 173/477 (36%), Positives = 259/477 (54%), Gaps = 18/477 (3%)

Query: 4    QLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADE 63
            QLA  R+ S        +LVANRGEI +RI +T  +L +K+VA+YS  D+ S H   AD 
Sbjct: 653  QLA--REESEKKKPFETVLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQHVTDADV 710

Query: 64   AYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVG 123
            A  +  +G+ T    YL ID+II  AK  G   I PGYGFLSEN++F+++ A+ GI +VG
Sbjct: 711  AVAL--KGR-TAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVG 767

Query: 124  PPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXX 183
            P    I  +G K SAR +AEKA VP+VPG+ G ++T +EA+       +PV++K+     
Sbjct: 768  PAGDAIRKLGLKHSAREIAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGG 826

Query: 184  XXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHL 243
                      +DI   F+  + +    FG+   F+ERF++  +H+E+Q++ D  G  + +
Sbjct: 827  GIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAI 886

Query: 244  FERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDN-QNR 302
             ERDCS+QRR+QKV+E  PA  L E+ R  +   +  L     YR AGT EF+ D  ++ 
Sbjct: 887  GERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDE 946

Query: 303  HYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRIT 362
             YF+E+N R+QVEH ITE +T                 +       KIT  G +I+ R+ 
Sbjct: 947  FYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPD---FDATKITVTGASIEARLY 1003

Query: 363  TEDPSKNFQPDTGRI-DVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEI 421
             E+P K+F+P  G++ DV   +     R+D   +  G+ IS  YD  L K    G   + 
Sbjct: 1004 AENPVKDFRPSPGQLTDV---SFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDE 1059

Query: 422  VRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDD---TPQLFEMVS 475
              +K+ +AL E  I G  TNI +L ++ +  +FK+ +  T  +D     P  FE+ S
Sbjct: 1060 AIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 1057 NKETGIREVYF-----ELNGELRKVSVADRSQKVESVSKPKADAHDPFQIGSPMAGVVVE 1111
            NK+ G +   F     E N EL K   A  SQ       P+    D   + S  +G   +
Sbjct: 1761 NKQNGEKAEEFAKLIQESNAELEK---APDSQGAVEEEFPE----DAEMVYSEYSGRFWK 1813

Query: 1112 VKVHKGSLIAKGQPVAVLSAMKMEMVISSPADGQVKEVLVKDGE 1155
              V  G ++  G  + V+ AMK EM++S+P  G+V +V+ K+G+
Sbjct: 1814 PLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNGD 1857

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score =  256 bits (655), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 160/472 (33%), Positives = 241/472 (51%), Gaps = 19/472 (4%)

Query: 8    LRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVI 67
            LR   ++    + +LVANRGEI +RI RT   L +++VA+YS  DR S H   AD A  +
Sbjct: 612  LRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVAL 671

Query: 68   GEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAA 127
            G     +    YL ID+I+  AK      I PGYGFLSEN+ FAE+  A GI +VGP   
Sbjct: 672  GGS---SAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGD 728

Query: 128  VIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXXXXXX 187
             I  +G K  AR LA  A VP+  GT G +++   A    ++ G+P+++K+         
Sbjct: 729  SIRKLGLKHWARELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGL 787

Query: 188  XXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERD 247
                   +++ AF++ + +    F +   F+E F+ + +H+EVQ++ D +G  V L ERD
Sbjct: 788  QRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERD 847

Query: 248  CSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFI 306
            CS+QRR+QK++E  PA  LP   R  +   A +L     Y+ AGT EF+ D Q +  YF+
Sbjct: 848  CSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFL 907

Query: 307  EINPRIQVEHTITEEITXXXXXXXXXXXXXXXTLEQLGLMQDKITTRGFAIQCRITTEDP 366
            E+N R+QVEH ITE +T                 +        +   G +++ R+  E+P
Sbjct: 908  EVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPD----FDAGVEIEGVSMEARVYVENP 963

Query: 367  SKNFQPDTGRID--VYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRR 424
             K F P  G +   V+ S      R+D      G+ ++  YD  L K    G   E    
Sbjct: 964  VKGFTPSPGLLTEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVS 1018

Query: 425  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDD---TPQLFEM 473
            K+L AL E RI G  TN+ +L ++ +   F+    +T  ++D   TP  FE+
Sbjct: 1019 KLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 3/97 (3%)

Query: 1059 ETGIREVYFELNGELRKVSVADRSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGS 1118
            ++G R   F     L KV+ +D    V   ++P     D   + S  AG   +  V  G 
Sbjct: 1712 QSGERAAEF---ARLIKVANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGD 1768

Query: 1119 LIAKGQPVAVLSAMKMEMVISSPADGQVKEVLVKDGE 1155
             + +G  + ++ AMK EMV+S+ ADG+V  +L  +G+
Sbjct: 1769 KVKEGDKLVIIEAMKTEMVVSATADGEVINILHANGD 1805

>Scas_720.74
          Length = 2231

 Score =  198 bits (503), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 153/527 (29%), Positives = 239/527 (45%), Gaps = 101/527 (19%)

Query: 19  NKLLVANRGEIPIRIFRT---------AHELSMKTVAIYSHEDRLSMHRLKADEAYV-IG 68
           +K+L+AN G   ++  R+          +E +++ VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPED------LEANAEYIRMA 113

Query: 69  EQGKYTPVGA----YLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASG--ITWV 122
           +Q    P G     Y  +D I++IA+   V+ +  G+G  SEN    EK+A S   + ++
Sbjct: 114 DQYVEVPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFI 173

Query: 123 GPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETV---------------------- 160
           GPP + + S+GDK+S+  +A+ A+VP +P +   I+ V                      
Sbjct: 174 GPPGSAMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCS 233

Query: 161 --EEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFI 218
             E+      K GFPV+IKA+              +D    + +A +E          FI
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFI 289

Query: 219 ERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDA 278
            +   K +H+EVQLLAD YGN + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSA 349

Query: 279 VKLAKEAGYRNAGTAEFLVDNQNRH-YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXX 337
           V+L K  GY +AGT E+L  ++++  YF+E+NPR+QVEH  TE +T              
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMG 409

Query: 338 XTLEQLGLM--------------------------QDKITTRGFAIQCRITTEDPSKNFQ 371
             + ++  +                          Q K   +G    CRIT+EDP + F+
Sbjct: 410 IPMHRISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFK 469

Query: 372 PDTGRIDV-----------YRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYE 420
           P  G +             Y S G NG    G ++F+        DS        G   +
Sbjct: 470 PSGGSLHELNFRSSSNVWGYFSVGNNG----GIHSFS--------DSQFGHIFAFGENRQ 517

Query: 421 IVRRKMLRALIEFRIRG-VKTNIPFLLTLLTHPVFKSGEYWTTFIDD 466
             R+ M+ AL E  IRG  +T + +L+ LL    F+     T ++DD
Sbjct: 518 ASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 1096 HDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPADGQVK 1147
            +DP Q+ +P  G +V+  V  G  IA GQP A +  MKM+M + +   G ++
Sbjct: 698  NDPTQLRTPSPGKLVKFLVESGDHIAAGQPYAEIEVMKMQMPLVAQETGIIQ 749

>CAGL0L10780g complement(1149588..1156289) highly similar to
           sp|Q00955 Saccharomyces cerevisiae YNR016c ACC1 or
           sp|P32874 Saccharomyces cerevisiae YMR207c HFA1, start
           by similarity
          Length = 2233

 Score =  196 bits (499), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 160/543 (29%), Positives = 247/543 (45%), Gaps = 107/543 (19%)

Query: 19  NKLLVANRGEIPIRIFRTAHELSMKT---------VAIYSHEDRLSMHRLKADEAYV-IG 68
           +K+L+AN G   ++  R+  + + +T         VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPED------LEANAEYIRMA 113

Query: 69  EQGKYTPVGA----YLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASG--ITWV 122
           +Q    P G     Y  +D I++IA+   V+ +  G+G  SEN    EK+A S   I ++
Sbjct: 114 DQYVEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFI 173

Query: 123 GPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETV--EEAQAFVD------------ 168
           GPP   + S+GDK+S+  +A+ A VP +P +   ++TV  +E    V             
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCS 233

Query: 169 ----------KYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFI 218
                     K GFPV+IKA+              +D  + + +A +E          FI
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANE----IPGSPIFI 289

Query: 219 ERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDA 278
            +   K +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAA 349

Query: 279 VKLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXX 337
           V+L K  GY +AGT E+L   + N+ YF+E+NPR+QVEH  TE +T              
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMG 409

Query: 338 XTLEQL-------GL-------------------MQDKITTRGFAIQCRITTEDPSKNFQ 371
             + ++       GL                    Q K   +G    CRIT+EDP+  F+
Sbjct: 410 IPMHRISDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFK 469

Query: 372 PDTGRIDV-----------YRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYE 420
           P  G ++            Y S G NG    G ++F+        DS        G   +
Sbjct: 470 PSGGTLNELNFRSSSNVWGYFSVGNNG----GIHSFS--------DSQFGHIFAFGENRQ 517

Query: 421 IVRRKMLRALIEFRIRG-VKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNR 479
             R+ M+ AL E  IRG  +T + +L+ LL    F+     T ++DD      ++S++  
Sbjct: 518 ASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEENTITTGWLDD------LISTKMT 571

Query: 480 AQK 482
           A+K
Sbjct: 572 AKK 574

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%)

Query: 1075 KVSVADRSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKM 1134
            K  VA     V+S++      +DP Q+ +P  G +V+  V  G  IA GQ  A +  MKM
Sbjct: 677  KEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGDHIAAGQAYAEIEVMKM 736

Query: 1135 EMVISSPADGQVK 1147
            +M + S  +G V+
Sbjct: 737  QMPLLSQENGIVQ 749

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955
           Saccharomyces cerevisiae YNR016c ACC1 acetyl-CoA
           carboxylase, start by similarity
          Length = 2231

 Score =  192 bits (487), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 156/566 (27%), Positives = 253/566 (44%), Gaps = 109/566 (19%)

Query: 19  NKLLVANRGEIPIRIFRTAHELSMKT---------VAIYSHEDRLSMHRLKADEAYV-IG 68
           +K+L+AN G   ++  R+  + + +T         VA+ + ED      L+A+  Y+ + 
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPED------LEANAEYIRMA 114

Query: 69  EQGKYTPVGA----YLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAAS--GITWV 122
           +Q    P G     Y  +D I+ +A+   V+ +  G+G  SEN    E++AAS   I ++
Sbjct: 115 DQYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFI 174

Query: 123 GPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETV---------------------- 160
           GPP   + S+GDK+S+  +A+ A VP +P +   ++ V                      
Sbjct: 175 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCS 234

Query: 161 --EEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFI 218
             E+      + GFP+++KA+              D+    +Q+A +E          FI
Sbjct: 235 SPEDGLKKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANE----IPGSPIFI 290

Query: 219 ERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDA 278
            +   K +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      +    +   A
Sbjct: 291 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAA 350

Query: 279 VKLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXX 337
           V+L +  GY +AGT E+L   ++++ YF+E+NPR+QVEH  TE +T              
Sbjct: 351 VRLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMG 410

Query: 338 XTLEQL--------------------------GLMQDKITTRGFAIQCRITTEDPSKNFQ 371
             + ++                             Q K T +G    CRIT+EDP++ F+
Sbjct: 411 IPMHRIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFK 470

Query: 372 PDTGRIDV-----------YRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYE 420
           P  G +             Y S G NG    G ++F+        DS        G   +
Sbjct: 471 PSGGALHELNFRSSSNVWGYFSVGNNG----GIHSFS--------DSQFGHIFAFGENRQ 518

Query: 421 IVRRKMLRALIEFRIRG-VKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNR 479
             R+ M+ AL E  IRG  +T + +L+ LL    F+     T ++DD      ++S +  
Sbjct: 519 ASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQKMT 572

Query: 480 AQKLLHYLADLAVNGSSIKGQIGLPK 505
           A+K    L+   + G++ K  I   K
Sbjct: 573 AEKPDRTLS--VICGAATKAHIASQK 596

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 1096 HDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPADGQVK 1147
            +DP Q+ +P  G +V+  V  G  +  GQP A +  MKM+M + S  +G V+
Sbjct: 699  NDPTQLRTPSPGKLVKFLVENGDHVIAGQPYAEVEVMKMQMPLISQENGVVQ 750

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score =  191 bits (486), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 162/577 (28%), Positives = 258/577 (44%), Gaps = 112/577 (19%)

Query: 8   LRDNSNLMGEK---NKLLVANRGEIPIRIFRTAHELSMKT---------VAIYSHEDRLS 55
           LRD   L G     +K+L+AN G   ++  R+  + + +T         V + + ED   
Sbjct: 46  LRDYVRLHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPED--- 102

Query: 56  MHRLKADEAYV-IGEQGKYTPVGA----YLAIDEIINIAKSHGVNFIHPGYGFLSENSEF 110
              L+A+  Y+ + +Q    P G     Y  +D I+++A+   V+ +  G+G  SEN   
Sbjct: 103 ---LEANTEYIRMADQYVEVPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLL 159

Query: 111 AEKVAASG--ITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVE------- 161
            EK+A S   + ++GPP + + S+GDK+S+  +A+ A VP +P +   ++ VE       
Sbjct: 160 PEKLARSKRKVVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKL 219

Query: 162 -----------------EAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAK 204
                            +      + GFPV++KA+              +D    +Q+A 
Sbjct: 220 VSVADDIYQKGCCLSPEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAA 279

Query: 205 SEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAK 264
           +E          FI +   K +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP  
Sbjct: 280 NE----IPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVT 335

Query: 265 TLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDN-QNRHYFIEINPRIQVEHTITEEIT 323
               +    +   AV+L K  GY +AGT E+L  + +++ YF+E+NPR+QVEH  TE +T
Sbjct: 336 IAKPDTFAEMERAAVRLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVT 395

Query: 324 XXXXXXXXXXXXXXXTLEQL-------GL-------------------MQDKITTRGFAI 357
                           L ++       GL                    Q +   +G   
Sbjct: 396 GVNLPAAQLQIAMGIPLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCT 455

Query: 358 QCRITTEDPSKNFQPDTGRIDV-----------YRSAGGNGVRLDGGNAFAGSVISPHYD 406
            CRIT+EDP++ F+P  G +             Y S G NG    G ++F+        D
Sbjct: 456 ACRITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGNNG----GIHSFS--------D 503

Query: 407 SMLVKCSCSGSTYEIVRRKMLRALIEFRIRG-VKTNIPFLLTLLTHPVFKSGEYWTTFID 465
           S        G   +  R+ M+ AL E  IRG  +T + +L+ LL    F+     T ++D
Sbjct: 504 SQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLD 563

Query: 466 DTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIG 502
           D      ++S +  A+K    LA   + G++ K  I 
Sbjct: 564 D------LISQKISAEKPDPMLA--VICGATTKAHIA 592

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 1096 HDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPADG 1144
            +DP Q+ +P  G +V   V  G  +  GQP A +  MKM+M + +   G
Sbjct: 698  NDPTQLRTPSPGKLVNFLVESGDHLEAGQPYAEIEVMKMQMPLIAQESG 746

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
           similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  188 bits (477), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 138/461 (29%), Positives = 217/461 (47%), Gaps = 60/461 (13%)

Query: 59  LKADEAYV-IGEQGKYTPVGA----YLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEK 113
           L A+  Y+ + +Q    P G     Y  ID I+++A+   V+ +  G+G  SEN    E 
Sbjct: 29  LHANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDVDAVWAGWGHASENPCLPEL 88

Query: 114 VAAS--GITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETV----------- 160
           +A+S   I ++GPP   + S+GDK+S+  +A+ A +P +P +   I+T+           
Sbjct: 89  LASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSV 148

Query: 161 -------------EEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEA 207
                        E+A       GFPV+IKA+              DD    +++A +E 
Sbjct: 149 PDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNET 208

Query: 208 ITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLP 267
                    F+ + +   +H+EVQLLAD YG  + LF RDCS+QRRHQK++E AP     
Sbjct: 209 ----PGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITK 264

Query: 268 EEVRDAILTDAVKLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXX 326
            E    +   A++L +  GY +AGT E+L     ++ YF+E+NPR+QVEH  TE I+   
Sbjct: 265 PETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVN 324

Query: 327 XXXXXXXXXXXXTLEQLGLMQ------------------DKITTRGFAIQCRITTEDPSK 368
                        +  +  ++                   + + +G  I CRIT+EDP++
Sbjct: 325 LPATQLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNE 384

Query: 369 NFQPDTGRIDV--YRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKM 426
            F+P TG+I    +RS+         GN  A   I    DS        G+  +  ++ M
Sbjct: 385 GFKPSTGKIHELNFRSSSNVWGYFSVGNNGA---IHSFSDSQFGHIFAVGNDRQDAKQNM 441

Query: 427 LRALIEFRIRG-VKTNIPFLLTLLTHPVFKSGEYWTTFIDD 466
           + AL +F IRG  KT I +L+ LL    F+S    T ++DD
Sbjct: 442 VLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLDD 482

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1097 DPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPADGQVKEVLVKDG 1154
            +P Q+ SP  G +V+  V  G  +  GQ  A +  MKM+M + + +DG V E+L + G
Sbjct: 618  NPTQVISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDG-VIELLRQPG 674

>Kwal_23.6157
          Length = 2230

 Score =  187 bits (476), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 154/538 (28%), Positives = 244/538 (45%), Gaps = 97/538 (18%)

Query: 19  NKLLVANRGEIPIRIFRTAHELSMKT---------VAIYSHEDRLSMHRLKADEAYV-IG 68
           +K+L+AN G   ++  R+  + + +T         VA+ + ED      L+A+  Y+ + 
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPED------LEANAEYLRMA 114

Query: 69  EQGKYTPVGA----YLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAAS--GITWV 122
           +Q    P G     Y  +D I+ +A+   V+ +  G+G  SEN    E++AAS   + ++
Sbjct: 115 DQYVEVPGGTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFI 174

Query: 123 GPPAAVIDSVGDKVSARNLAEKANVPVVP--GT----------------------PGPIE 158
           GPP   + S+GDK+S+  +A+ A VP +P  GT                       G  +
Sbjct: 175 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCD 234

Query: 159 TVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFI 218
           + E+  A   K GFPV++KA+               D    +++A +E          FI
Sbjct: 235 SPEDGLAKAKKIGFPVMVKASEGGGGKGIRKVEREQDFIPLYKQAANE----IPGSPIFI 290

Query: 219 ERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDA 278
            +     +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      +    +   A
Sbjct: 291 MKLAGNARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSA 350

Query: 279 VKLAKEAGYRNAGTAEFLVD-NQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXX 337
           V+L K  GY +AGT E+L   + ++ YF+E+NPR+QVEH  TE ++              
Sbjct: 351 VRLGKLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMG 410

Query: 338 XTLEQLG---LM-----------------------QDKITTRGFAIQCRITTEDPSKNFQ 371
             + ++    LM                       Q + T +G    CRIT+EDP++ F+
Sbjct: 411 IPMHRIKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFK 470

Query: 372 PDTGRIDV--YRSA----GGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRK 425
           P  G +    +RS+    G   V   GG       I    DS        G   +  R+ 
Sbjct: 471 PSGGSLHELNFRSSSNVWGYFSVSSSGG-------IHSFSDSQFGHIFAFGENRQASRKH 523

Query: 426 MLRALIEFRIRG-VKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQK 482
           M+ AL E  IRG  +T + +L+ LL    F+     T ++DD      ++S +  A+K
Sbjct: 524 MVVALKELSIRGDFRTTVEYLIKLLETEDFEGNSITTGWLDD------LISQKMTAEK 575

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 1096 HDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPADGQVK 1147
            +DP Q+ +P  G +V+     G  +  GQP A +  MKM+M + S   G ++
Sbjct: 699  NDPTQLRTPSPGKLVKFLFESGDHVIAGQPYAEVEVMKMQMPLVSQESGIIQ 750

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
           carboxylase, first and rate-limiting step in fatty acid
           biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  187 bits (474), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 145/518 (27%), Positives = 232/518 (44%), Gaps = 83/518 (16%)

Query: 19  NKLLVANRGEIPIRIFRTAHELSMKT---------VAIYSHEDRLSMHRLKADEAYV-IG 68
           +K+L+AN G   ++  R+  + + +T         VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPED------LEANAEYIRMA 113

Query: 69  EQGKYTPVGA----YLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASG--ITWV 122
           +Q    P G     Y  +D I++IA+   V+ +  G+G  SEN    EK++ S   + ++
Sbjct: 114 DQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFI 173

Query: 123 GPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETV---------------------- 160
           GPP   + S+GDK+S+  +A+ A VP +P +   ++TV                      
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCT 233

Query: 161 --EEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFI 218
             E+      + GFPV+IKA+              +D    + +A +E          FI
Sbjct: 234 SPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFI 289

Query: 219 ERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDA 278
            +   + +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      E    +   A
Sbjct: 290 MKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAA 349

Query: 279 VKLAKEAGYRNAGTAEFLVDNQN-RHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXX 337
           V+L K  GY +AGT E+L  + + + YF+E+NPR+QVEH  TE ++              
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMG 409

Query: 338 XTLEQLGLM--------------------------QDKITTRGFAIQCRITTEDPSKNFQ 371
             + ++  +                          Q +   +G    CRIT+EDP+  F+
Sbjct: 410 IPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFK 469

Query: 372 PDTGRIDV--YRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKMLRA 429
           P  G +    +RS+         GN      I    DS        G   +  R+ M+ A
Sbjct: 470 PSGGTLHELNFRSSSNVWGYFSVGN---NGNIHSFSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 430 LIEFRIRG-VKTNIPFLLTLLTHPVFKSGEYWTTFIDD 466
           L E  IRG  +T + +L+ LL    F+     T ++DD
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%)

Query: 1075 KVSVADRSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKM 1134
            K  VA     V+S++      +DP Q+ +P  G +V+  V  G  I KGQP A +  MKM
Sbjct: 677  KEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKM 736

Query: 1135 EMVISSPADGQVK 1147
            +M + S  +G V+
Sbjct: 737  QMPLVSQENGIVQ 749

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 98/214 (45%), Gaps = 21/214 (9%)

Query: 118 GITWVGPPAAVIDSVGDK-VSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVII 176
           G+T +G P +V+++  D+ + AR L E  N+P+         TVE+A A  +  G+PVI+
Sbjct: 133 GVTVLGTPISVLETTEDRELFARALKE-INMPIAESVA--CSTVEDAVAAANDIGYPVIV 189

Query: 177 KAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADN 236
           ++A+             DD+      A+S A++        +E+ L   K IE +++ D 
Sbjct: 190 RSAY--ALGGLGSGFADDDLQLRQLCAQSLALSP----QVLVEKSLKGWKEIEYEVVRDR 243

Query: 237 YGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNA 290
            GN + +    C+++            + +AP++TL +E    + T A+++ +  G    
Sbjct: 244 VGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIEIIRHLGVVGE 299

Query: 291 GTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
              ++ +      +  IE+N R+     +  + T
Sbjct: 300 CNVQYALQPDGLAFKVIEVNARLSRSSALASKAT 333

>Kwal_33.14061
          Length = 2221

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/259 (20%), Positives = 105/259 (40%), Gaps = 22/259 (8%)

Query: 73  YTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVIDSV 132
           + PV A   + ++I   +   +     G   LS   E  ++  A G+  +G P   + + 
Sbjct: 497 FLPVNAEF-VRKVILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTPIDTVITT 555

Query: 133 GDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXX 192
            D+    N  ++ N            TVEEA   V + GFPVI +AA+            
Sbjct: 556 EDRELFSNAMDEINEKCAKSKAAA--TVEEALEAVKEIGFPVICRAAYALGGLGSGFANN 613

Query: 193 XDDISDAFQRAKSEAITAFGNG-TCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQ 251
             ++ D           AF +     +ER +   K +E +++ D + N + +    C+++
Sbjct: 614 EKELVDLCN-------IAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNME 662

Query: 252 R------RHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHY- 304
                       + VAP++TL +E  + + T AV + +  G       ++ ++  ++ Y 
Sbjct: 663 NFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYC 722

Query: 305 FIEINPRIQVEHTITEEIT 323
            IE+N R+     +  + T
Sbjct: 723 IIEVNARLSRSSALASKAT 741

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 63/156 (40%), Gaps = 6/156 (3%)

Query: 157  IETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTC 216
            + ++EEA+ F D   FPV+++ ++             DD++       ++A+    +   
Sbjct: 1115 LTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRDYPV 1170

Query: 217  FIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPEEVRDAIL 275
             I ++++  K IE+  +A +   V+H+          H      + P + L  E  + I+
Sbjct: 1171 VITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVERIV 1230

Query: 276  TDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 311
                K+ K          +F+  N N    IE N R
Sbjct: 1231 VATAKIGKALKITGPFNIQFIAKN-NDIKVIECNVR 1265

>CAGL0L05676g 619734..626369 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2, start by
           similarity
          Length = 2211

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 98/236 (41%), Gaps = 29/236 (12%)

Query: 100 GYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIET 159
           G   LS   E  ++  + G+  +G P   I +  D+    N  ++ +            +
Sbjct: 521 GQTALSVGIEMKDEFESLGVKVLGTPIDTIITTEDRELFANAIDEIDEKCAKSQAA--NS 578

Query: 160 VEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAI----TAFGNG- 214
           VEEA A V   GFPVI++AA+               +   F   + E I     AF +  
Sbjct: 579 VEEALAAVKDIGFPVIVRAAY-----------ALGGLGSGFANNEQELIDLCNVAFASSP 627

Query: 215 TCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPE 268
              +ER +   K +E +++ D + N + +    C+++            + VAP++TL +
Sbjct: 628 QVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSD 683

Query: 269 EVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
           E  + + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 684 EDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT 739

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 51/280 (18%), Positives = 111/280 (39%), Gaps = 24/280 (8%)

Query: 35   RTAHELSMKTVAIYSHEDRLSMHRLKADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGV 94
            RT    ++KT+ I  + + +S    +AD  Y              + ++ +++I ++   
Sbjct: 1005 RTLRANNIKTIMINYNPETVSTDYDEADRLYF-----------ETINLERVLDIYEAEAS 1053

Query: 95   NFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTP 154
            N +    G  + N+  A  +    +  +G    +IDS  ++     + ++  V      P
Sbjct: 1054 NGVVVSMGGQTSNN-IAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGV----DQP 1108

Query: 155  G--PIETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFG 212
                + +++EA+ F +K G+PV+++ ++             +D+        ++A+    
Sbjct: 1109 AWKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSR 1164

Query: 213  NGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPEEVR 271
            +    I ++++  K IE+  +A N   V+H+          H      + P + L  E  
Sbjct: 1165 DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETV 1224

Query: 272  DAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 311
            D I+    K+ K          +F+  + N    IE N R
Sbjct: 1225 DRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVR 1263

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
           Multifunctional protein of pyrimidine biosynthesis
           pathway, contains glutamine amidotransferase,
           glutamine-dependent carbamylphosphate synthetase
           (CPSase), dihydroorotase-like (DHOase) domain, and
           aspartate carbamyltransferase (ATCase) [6645 bp, 2214
           aa]
          Length = 2214

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 96/231 (41%), Gaps = 19/231 (8%)

Query: 100 GYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIET 159
           G   LS      ++  A G+  +G P   I +  D+    N  ++ N            +
Sbjct: 523 GQTALSVGIAMKDEFEALGVKVLGTPIDTIITTEDRELFSNAIDEINEKCAKSQAA--NS 580

Query: 160 VEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIE 219
           V+EA A V + GFPVI++AA+              ++ D    A S +          +E
Sbjct: 581 VDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEKELVDLCNVAFSSS------PQVLVE 634

Query: 220 RFLDKPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPEEVRDA 273
           + +   K +E +++ D + N + +    C+++            + VAP++TL +E  + 
Sbjct: 635 KSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNM 690

Query: 274 ILTDAVKLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
           + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 691 LRTTAVNVIRHLGVVGECNIQYALNPVSKDYCIIEVNARLSRSSALASKAT 741

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/156 (19%), Positives = 65/156 (41%), Gaps = 6/156 (3%)

Query: 157  IETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTC 216
            + +++EA++F +K G+PV+++ ++             +D+        ++A+    +   
Sbjct: 1115 LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRDYPV 1170

Query: 217  FIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPEEVRDAIL 275
             I ++++  K IE+  +A N   V+H+          H      + P + L  E  D I+
Sbjct: 1171 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIV 1230

Query: 276  TDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 311
                K+ K          +F+  + N    IE N R
Sbjct: 1231 VATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVR 1265

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/236 (20%), Positives = 98/236 (41%), Gaps = 29/236 (12%)

Query: 100 GYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIET 159
           G   LS   E  ++    G+  +G P   + +  D+    N  ++ N            T
Sbjct: 523 GQTALSVGIEMKDEFETLGVKVLGTPIDTVITTEDRELFSNAMDEINEKCAKSKAA--ST 580

Query: 160 VEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAI----TAFGNG- 214
           V+EA   V + GFPVI++AA+               +   F   ++E +     AF +  
Sbjct: 581 VKEALEAVKEIGFPVIVRAAY-----------ALGGLGSGFASNETELVDLCNVAFASSP 629

Query: 215 TCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPE 268
              +ER +   K +E +++ D + N + +    C+++            + VAP++TL +
Sbjct: 630 QVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSD 685

Query: 269 EVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
           E  + + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 686 EDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT 741

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 30/156 (19%), Positives = 64/156 (41%), Gaps = 6/156 (3%)

Query: 157  IETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTC 216
            + +++EA+ F +  G+PV+++ ++             DD++       ++A+    +   
Sbjct: 1115 LTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRDYPV 1170

Query: 217  FIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPEEVRDAIL 275
             I ++++  K IE+  +A +   V+H+          H      + P + L  E  + I+
Sbjct: 1171 VITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVNRIV 1230

Query: 276  TDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 311
                K+ K          +F+  N N    IE N R
Sbjct: 1231 VATAKIGKALKITGPYNIQFIAKN-NDIKVIECNVR 1265

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH]
           (827830..834552) [6723 bp, 2240 aa]
          Length = 2240

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 94/232 (40%), Gaps = 21/232 (9%)

Query: 100 GYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIET 159
           G   LS   E  ++  A G+  +G     I +  D+    N  ++ N            T
Sbjct: 539 GQTALSVGIEMKDEFEALGVKVLGTSIDTIITTEDRELFANAMDEINEKCAKSKAA--ST 596

Query: 160 VEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNG-TCFI 218
           V+EA   V   GFPVI++AA+              ++ D           AF +     +
Sbjct: 597 VDEALEAVKDIGFPVIVRAAYALGGLGSGFASNEQELVDLCN-------VAFASSPQVLV 649

Query: 219 ERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPEEVRD 272
           ER +   K +E +++ D + N + +    C+++            + VAP++TL +E  +
Sbjct: 650 ERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYN 705

Query: 273 AILTDAVKLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
            + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 706 MLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT 757

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 64/157 (40%), Gaps = 8/157 (5%)

Query: 157  IETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTC 216
            + ++EEA+ F +K G+PV+++ ++             DD+        ++A+        
Sbjct: 1131 LTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYL----NQAVEVSREYPV 1186

Query: 217  FIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ--KVVEVAPAKTLPEEVRDAI 274
             I ++++  K IE+  +A +   ++H+          H     + V P    PE VR  I
Sbjct: 1187 VITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVR-RI 1245

Query: 275  LTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 311
            +    K+ +          +F+  N N    IE N R
Sbjct: 1246 VDATAKIGRALKITGPYNIQFIAKN-NEIKVIECNVR 1281

>Scas_582.4*
          Length = 2193

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 76/177 (42%), Gaps = 27/177 (15%)

Query: 159 TVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAI----TAFGNG 214
           +VEEA   V   GFPVI++AA+               +   F   + E I     AF + 
Sbjct: 575 SVEEALTAVKDIGFPVIVRAAY-----------ALGGLGSGFANNEQELIDLCNVAFASS 623

Query: 215 -TCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLP 267
               +ER +   K IE +++ D + N V +    C+++            + VAP++TL 
Sbjct: 624 PQVLVERSMKGWKEIEYEVVRDAFDNCVTV----CNMENFDPLGIHTGDSIVVAPSQTLS 679

Query: 268 EEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
           +E  + +   AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 680 DEEYNMLRNTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT 736

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/156 (19%), Positives = 67/156 (42%), Gaps = 6/156 (3%)

Query: 157  IETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTC 216
            + +++EA++F +K G+PV+++ ++             +D++       ++A+    +   
Sbjct: 1090 LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYL----NQAVEVSRDYPV 1145

Query: 217  FIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPEEVRDAIL 275
             I ++++  K IE+  +A N   V+H+          H      + P + L +E  D I+
Sbjct: 1146 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAKETVDRIV 1205

Query: 276  TDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 311
                K+ K          +F+  + N    IE N R
Sbjct: 1206 VATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVR 1240

>Kwal_55.19783
          Length = 1121

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/213 (18%), Positives = 88/213 (41%), Gaps = 19/213 (8%)

Query: 118 GITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIK 177
           G+  +G P   +++  D+       ++ N+P         ETV+EA +   + G+PVI++
Sbjct: 136 GVKVLGTPIKTLETSEDRDLFAQALKEINIPTAESFA--CETVDEALSAASRVGYPVIVR 193

Query: 178 AAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNY 237
           +A+              ++ +   +A S +          +E+ L   K +E +++ D  
Sbjct: 194 SAYALGGLGSGFAENEAEMKELAAQALSLS------PQILVEKSLKGWKEVEYEVVRDRV 247

Query: 238 GNVVHLFERDCSVQR------RHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAG 291
            N + +    C+++            +  AP++TL +E    + T A+K+ +  G     
Sbjct: 248 DNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAAIKIIRHLGVVGEC 303

Query: 292 TAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
             ++ +      Y  IE+N R+     +  + T
Sbjct: 304 NVQYALQPDGLDYRVIEVNARLSRSSALASKAT 336

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2 multifunctional
           pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 70/165 (42%), Gaps = 19/165 (11%)

Query: 167 VDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNG-TCFIERFLDKP 225
           V   GFPVI++AA+              ++ D           AF +     +ER +   
Sbjct: 586 VKDIGFPVIVRAAYALGGLGSGFASNEKELVDLCN-------VAFASSPQVLVERSMKGW 638

Query: 226 KHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPEEVRDAILTDAV 279
           K IE +++ D + N + +    C+++            + +AP++TL +E  + + T AV
Sbjct: 639 KEIEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAV 694

Query: 280 KLAKEAGYRNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
            + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 695 NVIRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKAT 739

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/157 (19%), Positives = 63/157 (40%), Gaps = 8/157 (5%)

Query: 157  IETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTC 216
            + +++EA+ F +K  +PV+++ ++             DD+        ++A+        
Sbjct: 1113 LTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYL----NQAVEVSREYPV 1168

Query: 217  FIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ--KVVEVAPAKTLPEEVRDAI 274
             I ++++  K IE+  +A +   ++H+          H     + V P    PE VR  I
Sbjct: 1169 VITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVR-RI 1227

Query: 275  LTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 311
            +    K+ +          +F+  N N    IE N R
Sbjct: 1228 VEATAKIGRALQITGPYNIQFIAKN-NEIKVIECNVR 1263

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 39/213 (18%), Positives = 88/213 (41%), Gaps = 19/213 (8%)

Query: 118 GITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIK 177
           G+  +G P   +++  D+       ++ N+P+        ET+++A     K  +PVI++
Sbjct: 136 GVKVLGTPIKTLETSEDRDLFAQALKEINIPIAESFA--CETIDQALEAAAKVKYPVIVR 193

Query: 178 AAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNY 237
           +A+              ++ +   ++ S A          +E+ L   K IE +++ D  
Sbjct: 194 SAYALGGLGSGFANDEQEMKELASQSLSLA------PQILVEKSLKGWKEIEYEVVRDRV 247

Query: 238 GNVVHLFERDCSVQR------RHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAG 291
           GN + +    C+++            +  AP++TL +E    + + A+K+ +  G     
Sbjct: 248 GNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLGVVGEC 303

Query: 292 TAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
             ++ +      Y  IE+N R+     +  + T
Sbjct: 304 NVQYALQPDGLDYRVIEVNARLSRSSALASKAT 336

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 41/217 (18%), Positives = 88/217 (40%), Gaps = 19/217 (8%)

Query: 114 VAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFP 173
           +A   I  +G P   +++  D+       ++ ++P         ETV+ A    D  GFP
Sbjct: 130 LAKYNIKVLGTPIKTLETSEDRDLFAQALKEIDIPTAESIA--CETVDAALEAADIVGFP 187

Query: 174 VIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLL 233
           VI+++A+              ++     ++ S A          +E+ L   K +E +++
Sbjct: 188 VIVRSAYALGGLGSGFANNAQEMKQLASQSLSLA------PQILVEKSLKGWKEVEYEVV 241

Query: 234 ADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGY 287
            D  GN + +    C+++            +  AP++TL +E    + + A+K+ +  G 
Sbjct: 242 RDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLGV 297

Query: 288 RNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
                 ++ +   +  Y  IE+N R+     +  + T
Sbjct: 298 IGECNVQYALSPDSLDYRVIEVNARLSRSSALASKAT 334

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 54/128 (42%), Gaps = 5/128 (3%)

Query: 157 IETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTC 216
           + +VEEA+ F ++ G+PV+I+ ++              ++      A   +     +   
Sbjct: 714 LSSVEEAKVFANQVGYPVLIRPSYVLSGAAMSVVTGEHELEVKLTTASDVS----PDHPV 769

Query: 217 FIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPEEVRDAIL 275
            + +F++  + I+V  +A N   +VH           H      V P + L + ++D + 
Sbjct: 770 VMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLVLPPQNLSQNIKDRLK 829

Query: 276 TDAVKLAK 283
             A K+AK
Sbjct: 830 EIADKVAK 837

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 61/156 (39%), Gaps = 5/156 (3%)

Query: 157 IETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTC 216
           + +VEEA+ F +K  +PV+I+ ++              ++ D    A   +     +   
Sbjct: 714 LTSVEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVS----PDHPV 769

Query: 217 FIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPEEVRDAIL 275
            + +F+   + I+V  +A N   +VH           H      + P + L E V+  + 
Sbjct: 770 VMSKFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLILPPQHLSENVKSQLK 829

Query: 276 TDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 311
           T A K+AK          + +   +N    IE N R
Sbjct: 830 TIAKKVAKAWNITGPFNMQVIKAGENDLKVIECNIR 865

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 36/217 (16%), Positives = 89/217 (41%), Gaps = 19/217 (8%)

Query: 114 VAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFP 173
           +A   +  +G P   + +  D+    +  ++ ++P+        E +++  +     G+P
Sbjct: 128 LAKFNVKVLGTPIKTLITSEDRDLFASALKEIDIPIAESIA--CENIDDVLSAASTIGYP 185

Query: 174 VIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLL 233
           VII++A+             +++ +   ++ S A          +E+ L   K +E +++
Sbjct: 186 VIIRSAYALGGLGSGFANNPEELKELASQSLSLA------PQVLVEKSLRGWKEVEYEVV 239

Query: 234 ADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGY 287
            D   N + +    C+++            +  AP++TL +E    + + A+K+ +  G 
Sbjct: 240 RDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLGV 295

Query: 288 RNAGTAEF-LVDNQNRHYFIEINPRIQVEHTITEEIT 323
                 ++ L  N   +  IE+N R+     +  + T
Sbjct: 296 VGECNVQYALSPNSLDYRVIEVNARLSRSSALASKAT 332

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 40/217 (18%), Positives = 89/217 (41%), Gaps = 19/217 (8%)

Query: 114 VAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFP 173
           +A   +  +G P   + +  D+    +  +  N+P+        ETV+EA    ++  +P
Sbjct: 129 LAKYNVKVLGTPIKTLITSEDRDLFASALKDINIPIAESFA--CETVDEALEAAERVKYP 186

Query: 174 VIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLL 233
           VI+++A+              ++ +   ++ S A          +E+ L   K +E +++
Sbjct: 187 VIVRSAYALGGLGSGFANNASEMKELAAQSLSLA------PQILVEKSLKGWKEVEYEVV 240

Query: 234 ADNYGNVVHLFERDCSVQRRHQKVVEV------APAKTLPEEVRDAILTDAVKLAKEAGY 287
            D  GN + +    C+++      V        AP++TL +E    + + A+K+ +  G 
Sbjct: 241 RDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGV 296

Query: 288 RNAGTAEFLVDNQNRHY-FIEINPRIQVEHTITEEIT 323
                 ++ +      Y  IE+N R+     +  + T
Sbjct: 297 IGECNVQYALQPDGLDYRVIEVNARLSRSSALASKAT 333

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 63/156 (40%), Gaps = 5/156 (3%)

Query: 157 IETVEEAQAFVDKYGFPVIIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTC 216
           + +VEEA+ F  K  +PV+I+ ++             +++      A   +     +   
Sbjct: 714 LTSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVS----PDHPV 769

Query: 217 FIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVE-VAPAKTLPEEVRDAIL 275
            + +F++  + I+V  +A N   +VH           H      V P + L ++V+ A+ 
Sbjct: 770 VMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLVLPPQHLSDDVKIALK 829

Query: 276 TDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPR 311
             A K+AK          + + D ++    IE N R
Sbjct: 830 DIADKVAKAWKITGPFNMQIIKDGEHTLKVIECNIR 865

>Scas_691.19
          Length = 1117

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 39/209 (18%), Positives = 85/209 (40%), Gaps = 19/209 (9%)

Query: 122 VGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFX 181
           +G P   + +  D+    N  ++ N+P+         TV+EA A  +   +PVII++A+ 
Sbjct: 137 LGTPIKTLITSEDRDLFANALKEINIPIANSIA--CATVDEALAAANSIKYPVIIRSAYA 194

Query: 182 XXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVV 241
                        ++     ++ S +          +ER +   K +E +++ D  GN +
Sbjct: 195 LGGLGSGFANNDQELKQLSSQSLSLSP------QILVERSMKGWKEVEYEVVRDRVGNCI 248

Query: 242 HLFERDCSVQR------RHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEF 295
            +    C+++            +  AP++TL +E    + + A+K+ +  G       ++
Sbjct: 249 TV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEYHMLRSAAIKIIRHLGVIGECNVQY 304

Query: 296 LVDNQNRHY-FIEINPRIQVEHTITEEIT 323
            +      Y  IE+N R+     +  + T
Sbjct: 305 ALQPDGLDYCVIEVNARLSRSSALASKAT 333

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 55/128 (42%), Gaps = 10/128 (7%)

Query: 117 SGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPG--PIETVEEAQAFVDKYGFPV 174
           +G   +G     ID   D+    ++ +  NV    G P    + +V+EA+ F DK G+PV
Sbjct: 676 NGCKILGTSPVDIDRAEDRHKFSSILDSINV----GQPAWSELTSVDEAKVFADKVGYPV 731

Query: 175 IIKAAFXXXXXXXXXXXXXDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLA 234
           +I+ ++             D++      A   +     +    + +F++  + I+V  +A
Sbjct: 732 LIRPSYVLSGAAMSVVNNEDELKLKLTLASDVS----PDHPVVMSKFIEGAQEIDVDAVA 787

Query: 235 DNYGNVVH 242
            N   ++H
Sbjct: 788 YNGKVLIH 795

>Kwal_27.12090
          Length = 394

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 83/218 (38%), Gaps = 21/218 (9%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     L+ +++       I  H HD  G  + + 
Sbjct: 165 LNIYKTVSAIGVNRVGIADTVGCANPRQVYDLVRTLKG-VVTCDIECHFHDDTGCAIGNA 223

Query: 775 AACALSGADVVDVAT---NSMSGLTSQPSINA-LLAALDGEIDNNVNVGYVRELDAYWAE 830
            +   +GA ++DV+       +G+T    + A ++ A    + +   +  +R+++   AE
Sbjct: 224 YSALEAGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEYVKSKYKLHKIRDIENLVAE 283

Query: 831 MRLLYSCFEADLKG-----PDPEVYVHEIPGGQLTNLLFQAQQLGLGE---------KWA 876
              +   F   + G         ++   I     T  +   Q  GL            W 
Sbjct: 284 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPQDFGLKRYIHFANRLTGWN 343

Query: 877 ETKRAYREANLLLGD--LVKVTPTSKVVGDLAQFMVSN 912
             K    + NL L D  +  VT   K +GD+ Q  + +
Sbjct: 344 AIKSRVEQLNLHLTDDQIKDVTQKIKKIGDVRQLSIDD 381

>KLLA0E23782g complement(2105401..2106582) highly similar to
           sp|Q12122 Saccharomyces cerevisiae YDL131w LYS21
           homocitrate synthase, start by similarity
          Length = 393

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     L+ ++++      I  H HD  G  + + 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHDDTGCAIGNS 223

Query: 775 AACALSGADVVDVATNSMSGLTSQPSINALLAAL 808
            +   +GA ++DV+   +       S+  L+A +
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARM 257

>Scas_701.35
          Length = 430

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 2/70 (2%)

Query: 720 KIVNS-GTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACA 778
           K VNS G + +GI D  G   P     L+ ++R+      I  H H+  G  +A+     
Sbjct: 174 KTVNSIGVNRVGIADTVGCANPRQVYELVRTLRS-VVSCDIECHFHNDTGCAIANAYTAL 232

Query: 779 LSGADVVDVA 788
             GA ++DV+
Sbjct: 233 EGGARLIDVS 242

>ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W
           (LYS20) - SH] complement(897769..897784,897846..899158)
           [1329 bp, 442 aa]
          Length = 442

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 49/247 (19%), Positives = 85/247 (34%), Gaps = 33/247 (13%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     L+ ++++      +  H H+  G  +A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDVECHFHNDTGCAIANA 240

Query: 775 AACALSGADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGY----VRELDAYWAE 830
                 GA +VDV+   +        +  L+A +     + V   Y    +R+++   AE
Sbjct: 241 YTALDGGAKLVDVSVLDIGERNEITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVAE 300

Query: 831 MRLLYSCFEADLKG-----PDPEVYVHEIPGGQLTNLLFQAQQLGLGE---------KWA 876
              +   F   + G         ++   I     T  +      G+            W 
Sbjct: 301 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPNDFGMTRYIHFANRLTGWN 360

Query: 877 ETKRAYREANLLLGDLVKVTPTSKVVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFF 936
             K    + NL L D        +V   + QF  S  L  DDV          DS++  F
Sbjct: 361 AIKSRVDQLNLHLTD----DQVKEVTAKIKQFGTSRPLNIDDV----------DSIIKAF 406

Query: 937 EGLIGQP 943
              I  P
Sbjct: 407 HAQIATP 413

>KLLA0F05489g 541146..542471 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 homocitrate
           synthase, start by similarity
          Length = 441

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     L+ ++++      I  H H+  G  +A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 240

Query: 775 AACALSGADVVDVA 788
                 GA ++DVA
Sbjct: 241 YTALEGGARLIDVA 254

>CAGL0J09240g 911669..912982 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, start by
           similarity
          Length = 437

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 57/278 (20%), Positives = 102/278 (36%), Gaps = 44/278 (15%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     L+ ++++      I  H H+  G  +A+ 
Sbjct: 177 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 235

Query: 775 AACALSGADVVDVAT---NSMSGLTSQPSINA-LLAALDGEIDNNVNVGYVRELDAYWAE 830
                 GA ++DV+       +G+T    + A ++ A    + +   +  +R+++   AE
Sbjct: 236 YTALEGGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEYVKSKYKLHKIRDIENLVAE 295

Query: 831 MRLLYSCFEADLKG-----PDPEVYVHEIPGGQLTNLLFQAQQLGLGE---------KWA 876
              +   F   + G         ++   I     T  +      G+            W 
Sbjct: 296 AVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWN 355

Query: 877 ETKRAYREANLLLGD--LVKVTPTSKVVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMD 934
             K    + NL L D  + +VT   K +GD+        L  DDV          DS++ 
Sbjct: 356 AIKSRVDQLNLNLTDDQVKEVTTKIKKLGDI------RPLNIDDV----------DSIIK 399

Query: 935 FFEGLIGQPY-------GGFPEPLRTDVLRNKRRKLTQ 965
            F   +  P            EPL+ D    K+ KL+Q
Sbjct: 400 DFHADLATPMVRPTEDGADNEEPLQLDEPAKKKSKLSQ 437

>YLR432W (IMD3) [3807] chr12 (1002553..1004124) Protein highly
           similar to Imd2p and inosine-5'-monophosphate
           dehydrogenase of human and E. coli [1572 bp, 523 aa]
          Length = 523

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 60/131 (45%), Gaps = 12/131 (9%)

Query: 362 TTEDPSKNFQPDTGRIDVYRSAGG-NGVRLDG--GNAFAGSVISPHYDSMLVKCSCSGST 418
           TTE P + F  D  R+  YR  G  + ++  G  GNA      S   DS+LV    SG+ 
Sbjct: 397 TTESPGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFS-ESDSVLVAQGVSGA- 454

Query: 419 YEIVRRKMLRALIEFRIRGVKTNIPFL----LTLLTHPVFKSGEYWTTFIDDTPQLFEMV 474
             +V +  ++  I +   G++ +   +    LTLL   V +SG+    F   + QL   V
Sbjct: 455 --VVDKGSIKKFIPYLYNGLQHSCQDIGYKSLTLLKENV-QSGKVRFEFRTASAQLEGGV 511

Query: 475 SSQNRAQKLLH 485
            + +  +K LH
Sbjct: 512 HNLHSYEKRLH 522

>YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase
           isoenzyme, involved in lysine metabolism [1323 bp, 440
           aa]
          Length = 440

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     LI ++++      I  H H+  G  +A+ 
Sbjct: 180 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 238

Query: 775 AACALSGADVVDVA 788
                 GA ++DV+
Sbjct: 239 YTALEGGARLIDVS 252

>Scas_704.3
          Length = 438

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     L+ ++++      I  H H+  G  +A+ 
Sbjct: 179 LNIYKTVNKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 237

Query: 775 AACALSGADVVDVA 788
                 GA ++DV+
Sbjct: 238 YTALEGGARLIDVS 251

>CAGL0J06402g complement(608851..610146) highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, hypothetical
           start
          Length = 431

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     L+ ++++      I  H H+  G  +A+ 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 223

Query: 775 AACALSGADVVDVA 788
                 GA ++DV+
Sbjct: 224 YTALEGGAKLIDVS 237

>YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase
           isoenzyme, involved in lysine biosynthesis [1287 bp, 428
           aa]
          Length = 428

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     LI ++++      I  H H+  G  +A+ 
Sbjct: 166 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 224

Query: 775 AACALSGADVVDVA 788
                 GA ++DV+
Sbjct: 225 YTALEGGARLIDVS 238

>Sklu_2431.2 YDL131W, Contig c2431 3030-4214
          Length = 394

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G   +GI D  G   P     L+ ++++      I  H H+  G  + + 
Sbjct: 165 LNIYKTVDKIGVDRVGIADTVGCANPRQVYELVRTLKS-VIHCDIECHFHNDTGCAIGNS 223

Query: 775 AACALSGADVVDVATNSMSGLTSQPSINALLAAL 808
            +   +GA ++DV+   +       S+  L+A +
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARM 257

>ADR027W [1768] [Homologous to ScYPR108W (RPN7) - SH]
           complement(752295..753521) [1227 bp, 408 aa]
          Length = 408

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 603 TFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDN 649
           TF VS+ FL +D       L K +PN     ++   NG+  ++ PDN
Sbjct: 334 TFGVSVEFLDKD-------LSKFIPNKQLNCIIDRVNGIVETNRPDN 373

>Kwal_56.24401
          Length = 441

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 1/74 (1%)

Query: 715 LDITEKIVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASM 774
           L+I + +   G + +GI D  G   P     L+ +++       +  H H+  G  +A+ 
Sbjct: 179 LNIYKTVDAIGVNRVGIADTVGCANPRQVYELMRTLKT-VVSCDVECHFHNDTGCAIANA 237

Query: 775 AACALSGADVVDVA 788
                 GA ++DVA
Sbjct: 238 YTALEGGAKLIDVA 251

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,335,211
Number of extensions: 1492805
Number of successful extensions: 3867
Number of sequences better than 10.0: 60
Number of HSP's gapped: 3890
Number of HSP's successfully gapped: 93
Length of query: 1155
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1042
Effective length of database: 12,684,275
Effective search space: 13217014550
Effective search space used: 13217014550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)