Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C05720g1891868281e-114
Scas_686.181801013123e-36
YBR217W (ATG12)1862073002e-34
CAGL0K06765g181812793e-31
Sklu_752.2200902794e-31
Kwal_14.18111961682682e-29
AAR160W1891802637e-29
KLLA0A05478g42237614.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05720g
         (186 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces c...   323   e-114
Scas_686.18                                                           124   3e-36
YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated t...   120   2e-34
CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces c...   112   3e-31
Sklu_752.2 YBR217W, Contig c752 791-1393                              112   4e-31
Kwal_14.1811                                                          107   2e-29
AAR160W [348] [Homologous to ScYBR217W (APG12) - SH] complement(...   105   7e-29
KLLA0A05478g 503729..504997 similar to sp|P53312 Saccharomyces c...    28   4.5  

>KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 component of the autophagic
           system singleton, start by similarity
          Length = 189

 Score =  323 bits (828), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 161/186 (86%), Positives = 161/186 (86%)

Query: 1   MNSGVLLSESETDTSEVSGRQSELISGDESIKGKLEEFSAKLNELRLADGNSDGGDEEES 60
           MNSGVLLSESETDTSEVSGRQSELISGDESIKGKLEEFSAKLNELRLADGNSDGGDEEES
Sbjct: 1   MNSGVLLSESETDTSEVSGRQSELISGDESIKGKLEEFSAKLNELRLADGNSDGGDEEES 60

Query: 61  LSPDTKXXXXXXXXXXXXXXXXXXXXXXXXXIVSSVEREQLKSQVKVKIRLQPIGAIPQI 120
           LSPDTK                         IVSSVEREQLKSQVKVKIRLQPIGAIPQI
Sbjct: 61  LSPDTKSQREESSENSENVSRSTSRPPLTSSIVSSVEREQLKSQVKVKIRLQPIGAIPQI 120

Query: 121 QPRVCQISAHQQFLALTRFLCKRLKRKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIV 180
           QPRVCQISAHQQFLALTRFLCKRLKRKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIV
Sbjct: 121 QPRVCQISAHQQFLALTRFLCKRLKRKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIV 180

Query: 181 SYCETV 186
           SYCETV
Sbjct: 181 SYCETV 186

>Scas_686.18
          Length = 180

 Score =  124 bits (312), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 78/101 (77%), Gaps = 7/101 (6%)

Query: 93  VSSVEREQLKSQ-------VKVKIRLQPIGAIPQIQPRVCQISAHQQFLALTRFLCKRLK 145
           +S  E+E++K++        KVKI+ QPIG++PQI+P VC+ISA Q F ++  FL KRL+
Sbjct: 77  LSQAEKEKIKNEEGPDVNSFKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLR 136

Query: 146 RKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIVSYCETV 186
            ++++CY+N++FAP+  QN+GDLWTQFKVNDELI+SYC  V
Sbjct: 137 MENVYCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAV 177

>YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated to
           Apg5p, involved in autophagy and cytoplasm-to-vacuole
           protein targeting pathway [561 bp, 186 aa]
          Length = 186

 Score =  120 bits (300), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 106/207 (51%), Gaps = 48/207 (23%)

Query: 3   SGVLLSESETDTSEVS-------------GRQSELISGDESIKGKLEEFSAKLNELRLA- 48
           S +L SE+ET++ E S                 EL S   +++ +LE FS +L++L LA 
Sbjct: 2   SRILESENETESDESSIISTNNGTAMERSRNNQELRSSPHTVQNRLELFSRRLSQLGLAS 61

Query: 49  ---------DGNSDGGDEEESLSPDTKXXXXXXXXXXXXXXXXXXXXXXXXXIVSSVERE 99
                    D +S   ++EE++  + +                                 
Sbjct: 62  DISVDQQVEDSSSGTYEQEETIKTNAQTSKQKSHKDE----------------------- 98

Query: 100 QLKSQVKVKIRLQPIGAIPQIQPRVCQISAHQQFLALTRFLCKRLKRKHIHCYINNAFAP 159
             K+  K++I+ QPIG+I Q++P VC+IS  Q F  +  FL +RLK  H++CYINN+FAP
Sbjct: 99  --KNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAP 156

Query: 160 SLDQNIGDLWTQFKVNDELIVSYCETV 186
           S  QNIG+LW QFK NDELIVSYC +V
Sbjct: 157 SPQQNIGELWMQFKTNDELIVSYCASV 183

>CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 Autophagy protein, start by
           similarity
          Length = 181

 Score =  112 bits (279), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%)

Query: 106 KVKIRLQPIGAIPQIQPRVCQISAHQQFLALTRFLCKRLKRKHIHCYINNAFAPSLDQNI 165
           KV I+ Q IG+I  I P VCQIS ++ F  +  FL ++LK ++IHCYINN+FAP   QN+
Sbjct: 98  KVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKMENIHCYINNSFAPVPSQNV 157

Query: 166 GDLWTQFKVNDELIVSYCETV 186
           GDLW QFKVNDELIVSYC +V
Sbjct: 158 GDLWNQFKVNDELIVSYCGSV 178

>Sklu_752.2 YBR217W, Contig c752 791-1393
          Length = 200

 Score =  112 bits (279), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 69/90 (76%)

Query: 97  EREQLKSQVKVKIRLQPIGAIPQIQPRVCQISAHQQFLALTRFLCKRLKRKHIHCYINNA 156
           ++E+ ++  K++I+ QPIG+I QI P+VC+IS  Q F  +  FL ++LK   ++CYINN+
Sbjct: 108 QQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVITFLRRKLKVSEVYCYINNS 167

Query: 157 FAPSLDQNIGDLWTQFKVNDELIVSYCETV 186
           FAP+  QN+GDLWTQFK+ +EL+VSYC +V
Sbjct: 168 FAPTPQQNVGDLWTQFKIQEELVVSYCSSV 197

>Kwal_14.1811
          Length = 196

 Score =  107 bits (268), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 92/168 (54%), Gaps = 14/168 (8%)

Query: 30  SIKGKLEEFSAKLNELRLADG-----------NSDGGDEEESLSPDTKXXXXXXXXXXXX 78
           +++ +LE++S +LN L L  G           N +  D+ +S + ++             
Sbjct: 29  TVRDELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDNDSSTVESNRAHTAPVSTSAI 88

Query: 79  XXXXXXXXXXXXXIVSSVEREQLKSQVKVKIRLQPIGAIPQIQPRVCQISAHQQFLALTR 138
                         ++  EREQ +   K+ IR +PIG++PQ+ P++ +ISA Q F  +  
Sbjct: 89  LGHLSVAGDQALKKMA--EREQ-ELPTKIPIRFKPIGSVPQVAPQLARISASQPFSVVVT 145

Query: 139 FLCKRLKRKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIVSYCETV 186
           FL KRLK  +++CYINN+F+P+  Q++GDLW  F++ DEL+VSYC  V
Sbjct: 146 FLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGV 193

>AAR160W [348] [Homologous to ScYBR217W (APG12) - SH]
           complement(632807..633376) [570 bp, 189 aa]
          Length = 189

 Score =  105 bits (263), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 97/180 (53%), Gaps = 6/180 (3%)

Query: 7   LSESETDTSEVSGRQSELISGDESIKGKLEEFSAKLNELRLADGNSDGGDEEESLSPDTK 66
           +S+S+ D+   S   +      ES++ +LEE+  +L+ L+L   +    D E   S   +
Sbjct: 13  ISQSQFDSESASAEPTPPQHTQESLQNRLEEYHERLSRLQLPSSS----DSE--CSDIEQ 66

Query: 67  XXXXXXXXXXXXXXXXXXXXXXXXXIVSSVEREQLKSQVKVKIRLQPIGAIPQIQPRVCQ 126
                                    + SS E  +     KV IR QPIG++ Q+ P+VC+
Sbjct: 67  ESLELEQEVPLSTSVYLAGARSAGGLPSSSELSETPEPPKVAIRFQPIGSVGQVMPQVCR 126

Query: 127 ISAHQQFLALTRFLCKRLKRKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIVSYCETV 186
           IS+ Q F A+  FL +RL+   +HCY++N+FAP+  QN+G LW QFKVNDEL+VSYC TV
Sbjct: 127 ISSAQSFGAVLVFLRRRLRLDTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATV 186

>KLLA0A05478g 503729..504997 similar to sp|P53312 Saccharomyces
           cerevisiae YGR244c LSC2 succinate-CoA ligase beta
           subunit singleton, start by similarity
          Length = 422

 Score = 28.1 bits (61), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 1   MNSGVLLSESETDTSEVSGRQ--SELISGDESIKGKL 35
           M SG+ + +S  D +EVSG+     LI+    IKGKL
Sbjct: 88  MQSGIHMIDSVQDATEVSGKMLGYHLITKQSGIKGKL 124

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,064,198
Number of extensions: 178057
Number of successful extensions: 536
Number of sequences better than 10.0: 22
Number of HSP's gapped: 533
Number of HSP's successfully gapped: 24
Length of query: 186
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 90
Effective length of database: 13,272,781
Effective search space: 1194550290
Effective search space used: 1194550290
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 58 (26.9 bits)